ELFbx4 ά4 (44 @P /usr/lib/ld.so.1wn  $&(*+,./1356789;<=>ABDHILMNOPQRSUWXZ[]^_bdegijkmptuvwx|~   !"$%&'*-./45678;=?ACEFIJLNPQRSTUVXYZ]^_`acdefijkmnopqtvxyz{|~    !"$%&()+,-./01356789<=>?@BCDEGJKOPRSTUVXYZ[\]_abcdfghijlm !"#%')-024:?@CEFGJKTVY\`acfhlnoqrsyz{}   #()+,01239:<>@BDGHKMOW[\bghlrsuw}  #'*24:;AFHILMNQW^`ekj   #:  /oP Jgx Ur, a ku X~  <  d38 @#  ܠ HE\ N8,   X` J ) 27l ;0 I gW `f j t T 5 d $  f0 8x( P  f0 ` x !F\ +L 4 I ۘR f| pՌ  ~u0  X<T e,  P  w  "@   dn " $(<L 6 8 E aA o kv=P8 ;      D @  yX  \ 4 L d M   <  O (! ; DJ  Mz8 a` k x (}   ތ@ xh }( 8d     t  \Ot #d - L A I ݄R8  e.8 {: x$  L8  k((   } ~T   e\ ! @-IP 6 BxL N X _ d xp Tw l\( @  0 $    k ,   ٔFx  k ܈ k*H 3 8:k|t UE g/P z$x  xP  g@! Ex  S  (  dt  T0 -"  :h  HL Ut _ h To v }h g,  t   h y$H  G4 ۤ  k ) ޘ 4 ?|x IG Qd \ i` ! ch ~D0 , K4    x `   X  x  iX  X % ߸ . ی 6|t AK$ I k P < X ٠ _ x/4H h h ܸ " ` B( P j4 ( ޼ D q  "  ' ! /h =P` Iy W< a  i < ooP P \ ޤ x {|D  (l | d  @  fx0 @ "$   P A %Ol  ;}$ Q ۀ FeD| Zu,  j  qlT ڜ L X   t  ,  bx  | l@  k w  )D  I0 9 W D e  lo< v ݨ  T0    ڄ PH  ,  4 l fL,  ET <%:  2+D Aix4 M#  U L\ ߠe` x@  i8` |  p  e0 ( ϼ  ՘$   T &4d 4L = I[4 Y a ڴi rhD ( <  < 4  @  ݜ#$  ۰|0 $  و# k3p| C< R `v l8 ~"x  w\ z` $ 0|l  ! l  D  $ ٸD`x  84  4X8  +H 9 @ F4 \ LfvLx qt  kl"   P \ n`  k ݐ  l p< fX   , 9"\  D,D Q dN l  h  kP 1  0l  k ڨHp *  l88 +Ѩx <4` E4 R94 [Q f Hmʰ\ zH p  ,l X$  kp Hqx | l "   .tp -| 1D$ Dt4 S ް] el4  y ߈}   ||T E pw@   s4   zhH T F  $ k"C< +rH 9X E x R ZDT c 09od hD } (    4/  @D  iP `P\  0 & &4 4$ @ i@J  dJL d (lc v p|  ( F k c /l  ހH 0 <4 C, @  & , x:| L S@>P d ݴ h xr/|  D ylp E K   @f Np /h  88  |L\ F, / "E S,H$ dv4 wd x4 ΐ \    "  t  ψ D4   ) ">T WH aj h tp "v D8 (P rX [ i` #8   D  ,< P  T$ = D  t@ (D 30 E ٬SF Y ڐ` kxtl w   L :l  nH @d D  $  )e\ XJ8\ 1P4  < ܬC!d, RnP mz {FH {   ߔ w 4 ( ܄ ,$ J   lw ׼  ܔ!{ 0p  KD`4 \ r "\( e x\8 (x8  i<  f S 08 / C , k?P J#H XE$ hА yEP ͐ t DD  р   (  ߬*  E$  g@!X {x v " ۼmkostempdownloaded_fileclearerrurl_set_dirwarc_write_metadata_recordwarc_closestrdupdelimerror_message_countstrptimecalc_ratecompilation_stringuuid_unparsesecure_getenvvasnprintfstrcatyyset_debugfreeaddrinfo__assertquotearg_charxalloc_dieselecthash_table_iter_nextx2reallocfd_closeftp_lprtrpl_re_searchoutput_streamyylineno.st_floatc_toupperftruncate64register_downloadurl_errorfree_urlposglthread_in_usesetsockoptversion_stringfile_exists_pstable_sortfeof_getopt_long_rmd5_process_byteshash_table_getquote_memftp_systregister_delete_filereadlinkyypush_buffer_stateyyrestartretrieve_treeconcat_stringsyyfreedetermine_screen_widthrpl_getopt_longres_retrieve_file_GLOBAL_OFFSET_TABLE_escnonprint_urimd5_finish_ctxyyget_outxmallocftp_parse_lsfwritesha1_init_ctxyy_scan_stringset_progress_implementationquotearg_freeyylengftp_lpsvmkalldirsrpl_wcrtombretr_ratemmap64_etextptimer_resolutionhash_table_get_pairfreopen64warc_uuid_strc_isdigitappend_urlsetoptvalyylexhuman_readableftp_sizeprint_broken_linkssufmatchftp_listhash_table_containsc_islower__cg92_used_exithash_table_countfcntldrand48string_set_addc_strcasecmpfnmatch_nocaseres_parse_from_filebase32_decode_ctx_initfdopenstrtok_rstrtoll__xnet_bindioctlperrorc_ispunctstring_set_to_arraystrpbrkfseeko64hash_table_iterateclone_quoting_optionsurl_freefd_peekstrncatc_iscntrldownloaded_html_seturl_escape_unsafe_and_reservedsha1_process_blockfd_register_transportfd_transport_contextutimelog_cleanuplink_stringftp_retrstrncasecmpremove_linkchar_propstrchrforktoken_namesunlinkclock_getresyypop_buffer_stateprogress_updateprogress_interactive_pftp_last_resplinesetlocaleregister_redirectionstrncpy___errnoquote_nnetrc_listgetaddrinforpl_optargftp_restmemchrwarc_write_response_recordquotearg_n_customset_custom_quotingvalid_progress_implementation_plocaltimesocket_ip_address__iobcookie_jar_savequotearg_colonmemmoverpl_gai_strerrorptimer_readyy_scan_buffer.ld_floatbase32_encode_allocyyset_linenowarc_tempfilefd_read_hunkc_isgraphgetpwuidungetcstrtokstrtolrpl_localeconv.st_double_foreffstrncmpretrieve_from_fileextract_paramfd_read_linefile_non_directory_prpl_re_compile_fastmapinitializesymlinkoutput_stream_regularsiglongjmpaccept_urlfd_errstrftp_cwdwarc_init__ctypeprogress_schedule_redirectquoteargvec_appendxstrdupsscanfhttp_loopyy_flush_bufferfscanf___Argvpathconfaddress_list_address_at_DYNAMICprogress_createtotal_downloaded_bytestcsetattrtowlowerlstat64file_mergexmemdupyytextfstat64strcmpaddress_list_connected_pset_char_quotingwarc_write_request_recordgetpidstrcspnpthread_mutex_lockfopen64defaultsvfprintfmemrchrcookie_jar_newnanosleepmemcmplog_initc_toloweryyget_debug_environprint_decimalrpl_regfreesocket_familyc_isspacegetuidfcloselog_set_save_contextmunmapfputcsetitimerres_parsefopen_exclrpl_snprintfmktimeyyinquotearg_allocfread_getopt_long_only_risbase32yyget_inyy_scan_bytesquotearg_alloc_memschemes_are_similar_pacceptablerpl_getopt_internalconnect_to_hostacceptstring_set_freefputssearch_netrcmd5_process_blockmd5_read_ctxres_register_specsres_cleanuphost_cleanupmd5_stream_startfree_netrclogputsrpl_re_syntax_optionshash_table_newrpl_re_search_2make_nocase_string_hash_tablehash_pointerxcallocftp_indexstrftimec_isasciiquote_quoting_optionsgetsockname_finistrcpysuffix_lib_versionscheme_disablerpl_re_matchftp_looprpl_getopt_long_onlyprintf_parsequotearg_char_memurl_set_fileurl_has_schemerpl_mbrtowcyyallocmemcpyiswalnumsha1_process_bytesmd5_init_ctx__ctype_maskyy_create_buffernumdigitfgetcget_exit_statusrpl_getoptmerge_vecsgetdelimlocale_charsetbase64_decodecookie_jar_loadaddress_list_set_faultybase64_encodefree_vecgetpeernamewarc_timestampxreallocsprintfiswctypecleanup_html_urlconvert_to_bitsrpl_vsnprintffd_read_bodyc_isalnum__fsetlockingiswprintgmtimequoting_style_argschmodsha1_bufferprogress_handle_sigwinch__xnet_connectdl_url_file_mapdebug_logprintfset_local_fileskey_responseescnonprintcookie_jar_deleteyyget_texttouchretryable_socket_connect_errorhash_table_clearget_urls_html_edatac_isprintquotearg_n_memisattywgetrc_user_file_nameurl_full_path_getopt_internal_rsha1_read_ctxatexitbtowcaddress_list_containstcgetattrbind_localyy_delete_buffer__xargvyyset_outexit_failureerror_at_linebase32_encodelog_set_flushexec_namerewindc_isalpha.stret4address_list_releaseis_robots_txt_url.st_doublesha1_streampthread_joinyyget_lengrandom_floatwith_thousand_sepsftp_pwdbase32_decode_alloc_ctxferroryy_flex_debugerror_print_prognameare_urls_equalftp_loginretrieve_urlerror_one_per_linesleep_between_retrievalsget_urls_css_file_endwget_read_file_freeprintf_fetchargsftp_portregister_cssftp_eprtrpl_ftellowctombgen_tempnamesubdir_pmap_html_tagsscheme_default_portptimer_reset__xargcsignallog_closehash_table_for_eachmake_string_hash_tableyyget_linenorpl_opterrftp_responserewrite_shorthand_urlquotearg_style_memurl_uses_proxysigsetjmpmbsinitlog_set_warc_log_fpiswlowerhash_table_removenl_langinfomemsethash_table_putfd_writerpl_regexecsepstringlistenunique_namefree_keys_and_valuesftp_typeissetugidprogram_argstringhome_dirxstrdup_lowerlookup_hostgettimeofdayfnmatchftp_epsvrecvrpl_re_set_registersrpl_optindhas_wildcards_pbasenamepthread_createatoiset_quoting_styleyy_switch_to_bufferrpl_re_match_2warc_cdx_dedup_table__sysconf_xpg5ftp_process_typewcslenaccept_domainrpl_regcompdummy_iri_PROCEDURE_LINKAGE_TABLE_lseek64.ld_llongabort__environ_lockhtml_quote_stringurl_escapepath_search.ld_intlrand48rpl_re_compile_patternmd5_buffersave_cookiesurl_file_nameinform_exit_statusrpl_re_set_syntaxyyoutclock_gettimeconvert_all_linksfilenonumber_to_stringuuid_generateset_quoting_flagsquotearg_stylefile_sizequotearg_colon_memurl_stringsetsidstrlen.st_float_foreffrun_commandurl_parsemkdirc_isblankfflushis_valid_ip_addressquotearg_custom_mempthread_mutex_destroyget_urls_fileurl_valid_schemefork_to_background.ld_doubleregister_htmlrandom_numberprint_addressaccdirres_get_specsnumurlsyyset_incookie_headerptimer_measure__fsr_init_valuequotearg_n_style_memstring_set_containspthread_mutex_unlockcookie_handle_set_cookieuri_mergetimegmsrand48pthread_mutex_initdatetime_strwgetrc_file_nameinput_file_urlconnect_to_ipquoting_style_valsres_match_pathquotearg_nqsortc_isupperprogress_finishfd_readhttp_cleanupaprintfptimer_newbase32_decode_ctx__xnet_socketquoterenametotal_download_timeaddress_list_get_boundsaccept_connectionsha1_finish_ctxconvert_cleanupmatch_posix_regexftp_pasv__1cG__CrunMdo_exit_code6F_v_logflushquotearg_bufferptimer_destroyyyrealloc.st_intc_isxdigitstrspnspider_cleanupwarc_write_resource_recordunique_createquote_n_memselect_fdtowupperhas_html_suffix_prpl_optoptprintwhatget_max_lengthrotate_backupsxzalloc__filbufhash_table_destroycompile_posix_regexinet_ntopmake_directoryaddress_list_set_connectedquotearg_n_styleis_valid_ipv6_address_get_exit_frame_monitorwget_read_file.st_llonglog_request_redirect_outputget_urls_cssprogram_name__flsbufgnu_getpassrpl_getlinehttp_atotmget_quoting_stylewgetrc_env_file_namedownloaded_css_setmatch_tailyylex_destroyquotearg_customrun_with_timeoutquotearg_n_custom_memnumber_to_static_stringrpl_regerrorquotearg_memstrrchrxsleepcompiled_featuresurl_schemeftello64run_wgetrcnonexisting_urltest_socket_openstrstrlibsocket.so.1SUNW_1.4libnsl.so.1SUNW_1.7librt.so.1SUNW_1.2libuuid.so.1SUNW_1.1libc.so.1SUNW_1.21SUNWprivate_1.1) ='8A ='MV ='aj ='wy Nq + gi i8. i` f (Z 4< @ L* X4 d< p | وM ٔ ٠ ٬! ٸ` f c    <   $> 0 < H T ` l[ x ڄ ڐ# ڜ ڨ ڴ? k P |  3 ] `   , 8 D P \ h te ۀ ی ۘ/ ۤ ۰J ۼm     >    ( 4 @ Lq X  d  p1 | ܈ ܔE ܠ ܬ4 ܸ  (     b  $_ 0X < H T ` l x ݄l ݐs ݜH ݨ ݴ   d c    L x ,  8 DH P \g h t ހ ތ] ޘ ޤ ް ޼  u G   \ Q g ( 4c @F Li X d p | ߈ ߔ: ߠ+ ߬e ߸    g     @ $ 0 <% H T ` lB x  z J @"cpD"clx"a, @'x᠀ $+`-` `?-)x!- =--% # @~@{ x! x!@o@`]@@h@i "      **`* @*  ""  "     + **      + **     **   㿘 "    //// 77㿘 "" "   ////    ////   7777 `" 2 2 *@2 *`2 *`*`2@2`""2 2 **2 **2`*2`*2`**222`22"㿘`" 6 6 6 6 .@.`.`.`'6@6`'㿘" &"6 6 6 6 ....6`6`6`....?6`6666?&`" 2 2 2 2 *@*`*`*`2@2`"""2 2 2 2 ****2`2`2`****2`2222"  d@ 㻠@\ @Y $@ @)% @P /@J@@G@F@% @9 /@@@3@@@0㻠@% @! @$@@!@%` @.@  @ @@@ @ 2@ 㿠?w@@@6 @(6 6`K @ 㿠?w@@@6`@6`6K @㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @@ݞ @@#`K` @@O#`   'l'@?` @i?z9`aJ 9`0 @ :` @ :  8N:`~#(" *`9   **@ @&@za9 J 0 8`9  (`"* @*2@ a9 8H2 :9 " ( (` *! 2 0?`( ("* ` + )   `(( @`)`(`*"(@ )`+ #@*@ ?  d@ 㻠@ @ $@ @)% @ /@ @@@@% @ /@@@@@@㻠@ @ @$@@@%` @Ҕ.@͔ @ @@Ȑ@ @ 2@ 㿠?w@@@6 @6 6`K @Ӂ 㿠?w@@@6`@6`6K @Ձ㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @@㿠``@`"H@r @q 6  6 `&   @f 6 6 `& `& ` & `& `&  `@`"H`@H`@ "` "`@ "@ "` "` "` "`  "` "`@ "㿠 `"@ `"@ @㿠;aOa`@ N"@6N N! .#@G{ @1@A#'% 㴒Ȗ@q . @D   & & & & & &@Eߐc . 㿠  @ & 㿐';\'b'@׎* ? "@@Ȫ " ?@ @ 2@@ " 㽀@)@E@"@  @ b @@  $ @ @  "< @~ @ @Oc8\(``\( `,""=`?# ;0  c$@'@m l@?* > @ (@_Hq@@3 b@~ L;@ 7 @~@5 @ΐ@. @ ; @'@4 b@~ @?" 㿘@F @7@D@@DX@ @DaO@Dq@D@Dr* ?` @ @D@F[ OԒ@Dِ?@+) c"@~K ?㾘 '  @Ӕ @??c @ʘ  @!`6@@+@I?Mcs @- @~]`@!n'@@@/? 74Ns@ @D9 "@~;`@ @@?㾘97]#8!'@@-88`@Ɩ @?@] " @?@j3Ncs @5  @~㾘!' @:!@@L @<@M @  @$ &` @ "@+'&` &`&` &`&`Ls"@ @DJ3 @}Őc@ &`7Ns@ @D<; @}cP@Ȁ @㾘!' @!`@@ `@ @ 6@?@ " c@ )` 2@$ @    2 1p?Jb<3`  30?2  1`3p?  0? ` @3 20?*`9`A.'H'L 6    /H;`@ `^cxD'x@$d@d@• FJ'|@ @@p O6  @] 'x   /@'|'x @r 2 3p?`- > 㿠@d?@@> `O㿠@S?@@* `O㿠@: ?@@ `O㿠@/;Ocs`@9 #`@|㿠H/  @" 3" a @  5@>F &9@?!`'!- px@#@ 㿠;@>a 㿐'P;_'TbxP BP+_)#(b B`$`@`@ `#h#lhlŀ #`#d`d @: @ "  3p? 㿈!'P!'T`P@#h  #lhl* :H4?xa@ !??@?;p)x @>,'?%!?p'?#` #d`d* =`@?@ @㿈!'P!'T`P@#h  #lhvl* :H4?xa@ !??@?;p)x @='?%!?p'?#` #d`Pd* =`@?@  @㿈!'P!'T`@ @ P Lx@ ! @PP#x;`@=$a&&`@ `@+#h #l;`hl* <@9``` @ ;``` ~` @#@Oې#p #t;`pt* =@`;`b@ `@O?㿠;a @3a@=A@`@ `ƀ@@m @y㿠@%-@@=@`` @`F@>]@8`&9  d@ 㻠@ @ $@ @)% @ /@@@@@% @ /@@@@@@㻠@ @ߐ @$@@@%` @Д.@˔ @ @@Ɛ@ @ 2@ 㿠?w@@@6 @6 6`K @с 㿠?w@@@6`@6`6K @Ӂ㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @@㿈@''@>C@.`* #`@@|' ' ' ) ` Ԫcs @<@ M`@]?@zZ`M``@?@y`@@( @Oq @89!@`@"@`'`+` @ @"1#@;@'`@'`M``@@yʔ `"H'`'`M`@ $@y@Y``2O`@/ `& @A``@$O`㿀@@';c;f c9 a @X#`#d`@Kd @yE @;㿠/  @@y8 @  `;`{T@ ``:``yT2O`@ @xV@@  @@ $ @y@7Nu`@u@@=@@`@ @`@@@ D @x@@@ ` `@ - ) @  @ $ @ `@;`@ `@z@ @Gt   @ @  @1N?@  @- N? @RN? @ @x@G `@p`@A @o 1` (8@p:p8 @  @N?@  @ N? @N? @  `@x@ې@ِ`  N?`@ @x ` `2Oo  % N? @% @x``% @" @@@=D @x0@@ d @x&@,@ 㿠N N`@ @ &/O`8`Nx @`O&/M @/@ ! /I``; {D@ ! /I``; z O! /@f -$@@ / ጒ@W  O .@L@x  .&@㿘@>`@``* ' #`@% @9` `* / #9`@s@p!`@!@<$ &@J@@d"@@ @- ; a @w@ 㿠@P㿘N "@ '@ " -  ?  @?@9@6* =@ &@` f@@&㿘? ) 3 @@ `!`* #`@ @ K` &"@   #"@  H "" `@*OK` 㿘9 !@.`?`@@@@@}* N %@  * #`@;;5 B % 3 F 2 5@#@%"H *$*;@?"HM*** *** *** @*** * N OҀ;@*@@㿠N @5N`@1@/`O` @ `N``@ O` N`@ O`/"@O`O'` /@9 O``@9  !@2 3p?`.> 㿠@@ ;c@:@@ ceax@:{㿘;aaĀ`@+@:ސ $c @c@:א &@8̒@@ِ@7* =@@8"H@9ؒ@@ǐ@$@!@9e@8@@9@@@ @ @9N㿠;aĀ`@/@: )%!㰀@@: %``@8JH7 `@8@ @@`@9&5 @#R`㿘;aaĀ`@7@:Z &㰀`2@@:S 9'#@8G@ @9e@@@>T㿠;c @@:7 ;'c@H㿠;c @@:* ;'c@;㿠;aaĀ`@)@q`@7`&`#@ 5/-@f@7+%c @7@G@Q @@?x a@ @ "@ ` "@ ` "H`     㿠9 @!2@ @72@  @@9̐ &@7@ Ő @.@8r㿐;a @@9a@9g@ @@9`2O;9@7;a'!㿠N `@ `&@`<  @ `>@ `"@`    d@   N  `O逧`&@뜐 N``@J`< o & # 3 2 ; a m p t q u@ ` @+`""H!* `&"@ * ,* `<@ `>"@ * %* * * * *   `* N` g l* *   "@ @8  "@ @2  @@,@*㿠 @5`@  @2`2@`@, 2@ `@   2O &&& 㿀 `@5@#ђ@`"@``%`&`&` 9& O#s@ @s  &` &`@O`' @6  & Jcs`@*`a-` ?Ԯ?̀`? ?#? ?d@`f@f@ "@`@``#d5 `8#\#`#h``@sl㿘@7z @+p@%"@'`% `@5 H5 `@ @6`@ @6:69O#s@; @s;b3 pb|@ !.`x'.`/ @P ;* >?`@쀣`@L"@$'M` "@`'@&`@&`@P ;* h< @٠!@*@  @쀥@쀦@` "@@ J`.@ '@t&`#`"@ H$`@ Z @쀤@쀤@` "@@ @O&`%`"Hn@{`@ 6 @'쀠@쀠@}"@* #`@ .@bv?@[` &``.` Ȁ @T` `.` O$@9`@  @3?? @N쀥@@J * #`@ .` @ ? N@5`  `.` DH&` JP` .` # @ `$@ Ȕ @` `@.` @O ;* <2O,M` @  @  @(`,'@qɐ  㿠@{N * ?` @  @rN * <@ `@jL`* =` 2O`L`.@` @]L`* > @ @TN* ;`@ `@LN`* 8`2O`N`.@` @?N`* 9 @  @6O * :``@ `@.O`* :2O`O` .@` @!O`* <`@  @L * =` @ @L* =2OL6 3p?.`> 㿠; Ocscs@c(@qz* ; @ @ Ē2 3p?/ ?`O @@qm@ 2@O   @@q`@є * =`@  N  O  .d@`"HN@qIN ."H @ `N.@@``"@_ N`@ O @@q%&@M O @ @q"H  O @ 2@#N  x!ԥ, @~ * ;`@    O, `@ O "@ N @p`?  @ ` @ `@$O  /` @  =@: ; @ @ @ *@@ ,  ,@ $O .@/` @.@ H  @ #@ $&㿠&@@ H :@ @ @ &@O`* <` @ . O``-`@?@ @O`* ? O. & P/ #\w,@ݐ@@@@ 9   0@n@ /%Ȑ@@'N @@* >`@ N @@* <2O N @値 #@〤 @  N `@` 2O @'N @ԐN @Ϫ  @ `M` @ǀ 2O`@ÐM``@`` @ #`M@ 2O`@@M@ @ `N``@` 2O`@N``@`` @ L@ 2O@@L@ @ N @ 2O@}@@N?` 2@N?& @N?& ` d@ @M'`@I'``@E&@'` @ %@ T@M 2 30? ` *`@.@/` @     \@; 2 0?` - *  /` @'`L .d@@'m'`ȔbșJ?,% d@#mbЅP`)!ȑ p ` F'`/` \D\@ 4O@y@`;5 Ocscs@@m3@ѐ 9'!@@ `(@⪐@k@x ` @l؁@%@Ȓ`@@ʐ`\@ @0@1@P-+7' . @? @L A`"@5 ܐ* 8@- @@@o @`x@  #\ @  @#``| #df@ #h#lf@h@@@   2O @02O@u@@8@@ ) ! @le@(6@L @'@@ ` @lUL `@@l`ȁ㿐 @0}@0@@@ u`2O@0r2O@.O @  d@ 㻠@ @ $@ @)% @ /@@@@~@% @q /@@@k@@@h㻠@] @Y @$@@Y@%` @J.@E @ @@@@ @8 2@ 㿠?w@@@6 @`6 6`K @K 㿠?w@@@6`@R6`6K @M㿠`@ `@ @ w4 30? &` /*⪪u@@`@47`@&`4`6K @,@p; 'DDa`DI` @K (@ D'DJ@C(2ODD'D@Z DL` "@7 2`*0 @s`@2* [`= @D`'DM` @!s`@#* [`>`2ODDO @s`@6 bG[`s`D@ 2OD[`  3 㿠Z * ?`H5` @ @'1!L#p@# ah@j4 @֔Lp@) !x@j' @ 7 $@-Mp`@/ @j @X@[`@W 㿈 * ?` H2耦@@).#Lcp @% @i @ M#p@+ a@i @5 @/Mp@1 !@iԐ @@@ 㿈66`.0 . sh@s`7 @ 2p @j| [h/ [`?`d` s`' sh@2p @jl [`[h `"@d`sp+ @2p [p@2p aܐ @jW @ޑ2p - @jN 51 "d@ @i|㾨\.p '7`  6w/0 /  $`"H }wH@'2H wH"H wHu (' ,wHw@' @vQ _@_H쀦@ /쀦@)'"'@` '@ 5`@''쀥`@?''耍@t  Հ ("@  wH wHw@Q?@ 6@_@@a   * < f@_H@?$ wH$ wHw@@  @i _@Hcp_H@ cpw@8wH@h _@_H ( @w@+wHa @ @#@_@_H w@wH@_@_H @ @K "H>耥 "@0wH @ "Hx 4"HwH<?@h @@h $ @h |@h ?$ @h ?@h $ @h ̺?@h t$  @h~ @h{ j?$  O @w@wH@hl _@_HO @ w@` wH@i* _@_Hw@  wH@ s @ _H _@"HwH "@O wH`@hI ` @hF 5?$ w@`X@h< `\@h9 _@_HO @ @ w@`wH@h, _@_H  @ "H ;O O  "@  w@wH@i)`_@_H `$  $ )O @O "@  w@wH@i`_@_H  $  $ O @O "@  w@wH@ia _@_H $   $ O @ wHw@al@h _H_@wHw@ @ o @ _@ _H"H "@O  wHa|?@gʐ a@gǐ $  @wH@w@_H_@wHw@@ta$ _@_HO @ wHw@a@g _H_@wHw@@  O _@* _H@ <`w@aĐ wH@hb_@_Hw@wH@>_@ _H@ @0 "@"bDwH @ 4"HbwHa@g| a@gy h?$ @gq b?@gm \$ @gf bH @h+Q?$ O @ w@bxwH@gS _@_H"@wH O @ w@bwH@gD _@_H7Ns`@sw@wH@hFb_@_HO /"@  @wH@ʌw@* ;``_@_H"@ O  :"HL  @"@JLwHw@@V _@_H@ @M /@ @@N/"Ow@`wH@?   @* #p@8 /,@L_@_H "@, w@wH@gbL_@_H@!bw@wH @g_@_H @; L /@ L@ wHw@@gאc _H`_@"HwH)   @$ L`/3 2?wH`@  wHw@@` /_@_H@L`@  w@wH@gc0_@_H  @m c\"@ "Hd@L @  w@wH@ܧc` @gI_@_Hw@wH@U_@ _H@ @2 "@"cwH @ 4"@cwHcx?@fb c|@f_ N$ @fX c@fU D?$ @fM @ c@g 6?$ L @ w@dwH@f8 _@_HO w@d@f- _@_H)@"0' _ `"` ' J``@O!@@ w@wH $@5 d @fؐ _@_Hw@wH $@ِ @  @_@_H "@ K' d4?@e d8@e $ ' Kp@_``7wHwHdpw@_@12p  @f_@_H``_@` dx@eΐ 뽐?$  ' @'$zt'4 {t', ?`  '8 "@ '(?d'0O ƀ @w@wHwPwXZ_@_H $_P_X@ @C @ #@2wHw@ $@ 4"@dwHd?@e d@e x$ @e dܰ?@e~ m$ w@ewHwPwX@er e @eo _@_H_P_X w@e,wPwX@ec e0@e` _@_H_P_X @MO!C@wHw@wPwX@,ВeP@f\_H_@_PwH_Xw@wPwX @_@O!@_X_H_P@ w@ewHwPwX@e0 _H_@_P_X`@} ? $ @,Р@̘et @e蝐*  ; `f@@`w@wHwPwX_@_H _P_X@ @0 @a "@Pf8UwH @< @ 4"@eLwHe@d e@d Ԑ?$ А@dِ e@d֐ Ő?$ f?@dȐ @@( f@e ꯐ$ ꬐f @d @@ f$@eu ꛐ@d f<?@d ꑐ$ ꎐO!@@`w@fLwHwPwX@d _H_@_P_X ```2HwHF`@AO!@@3p w@wHwPwX@Ȓ fX@e9 _@_H_P_XwHw@3p wPwX@t _@_H _P_X@ @8 "@ flwH @$ 4"@fwH@dM fp@dJ 9?$ 53@d> f@d; *?$ &$w@fwHwPwX@d* _H _P_X'4_@ @O!@@ w@gwHwPwX@d _@_H_P_XO D @ @-O!@@*w@gwHw@wPwX@ @J 2@_@_H_X_Pw@wHwX@@wP,`_@_H_P_X2@ w@wHwPwXݐ $ _@_H_P_X@O!@@jw@wHwPwX@ $ $@_i_@_H_P_X2@'w@wHwX@ wP@-  $i@a _@_H_P_XI w@wHwPwX'@ڈ_@_H_P_X@+@M? "H? @ ?(@@@H G O?w@wH wPwX@ֶi@aY @__@_H_P_XO٨@w@wHwPwX@Đ@ _@_H_P_X @Y@@_@`3_`$  $  $ O!C @5w@wHwPwX@aji_@_H_P_X*$_ ` $  '$  `$  ?$ O!C "@W '@aOjH '$ O!C`"@M '@aEi 'O@ _$ $2O{O = '$   $ O!C "@4 '@a,j '@_ih @`ݖit@`  i@ @`ӖiL@` ?$  @T@a  $h?@` $   'w@~D~X@h! _@_Hw@~t~@_!_@_Hw@~~@V!_@_Hx@w@_@_HcO @w@_@_HO @w@_@_H O @w@_@_H_O @w@_@_HtLwH@w@_@_Hw@wX@wP_@_H_P_XH w@wX@wP_@_H_P_XO!@w@wX@wP_@_H_P_Xl w@wX@wP_@_H_P_XO!@w@wX@wP_@_H_P_XO!@8Н㽸' ;bIJbwb @1p?$ @ L@' `@! @ג &$ @ L@ @;* $9 2@  `@ @ `@){ &< '( ',"h5`'0   3p?'$`@("@ @ && ?"@ @ &&@@@@"@z =(`@ @  #h'(ἔ  @ w8L%`@`@p@ x,0 @@@_w8 `4H_w8@= @&l_8@ w8@m `(@``_8@`4w8`@_8w8@``@ @_5@_8`@ `@ ^`w8#\2 #`#d3p _8@ ?&%%&=@*@@͐t@n2@t$ "@@w@ &$ t`@_^``t@TtG5t@O3`?"@Ԭ )`"@Ь )?& )w8@ @L`@   _8_ @ @2p  ^ "@L?&L @`@K``-@ J@`X!_@j`_@'2p  @^l@Lp@@ _@2p #\` @^@@`@?#`  #d #\ (@E * = `@ <1yX @!L`@5\`_&`@ t.$L@)\L`_ &`t@@* =`@L @`@^`` @^5@@ @@ a @^( $`"@`& & "@ @  & @ڐ@^   @w8_83w8㿠`)`%&`? &`&``$@ @G#@mLs`@@ӳ@^, @ؐ&`$@^ ۖ @`$@S`$ @$&`$`@&Kㅀ`@@@ @O@\ ! (@]  @Ӂ1 4@] &@+`&`Px ' bLbL"@ D @`L'`@@]Ր$ `H`,' @&& ?&&`@&`` &@ _L\)(!< `` 7^X\ $h$?$ 3$@I $`@-@@ &$L(`@?```@9`@F`@2`_`@`@ + ^`@{+ `8@@ @@$`T @] `@ @$`@]  `@2p `@]  `@ @"H L $@H $ @ @ҽ`a@\ {$@ҵ`a@\ s$Lq@W` @ a@\ f$$@Ȁ@)@H` @@"  * #`'$@Д%` @`@@@Ҁ$@}`a( @\ 9$@s$@p`aP @\@\$`@$?@ a|@$@1 al@\ a|@[Ɛ $@ $ $@  $v $@@! @F``@L`"@L``"@L'@s@a@\ L2@`#``@&L@`@Lq "@``@@@$* :@@V` `?@a@\)@$&$@@3@@@<@ =@ >@  &`$`2O\L`@?@ @ L'`@ @\Ba@ $`8@'ng'㿘9_#h@iaX7`#h `_` ```` @W@K @H`@ @  * #`L`@`/@L@ `@O `@O @ @[O @`@[@6* = 2@ @c@[ _ `$ &@҃ @_@% @X@_ `$`O```_` ` 3 㿠N `/@ ;@c(2 3p?㿘``&`X @!"x"x`@L`"@ @ `"@ $@ * ; 2@  $@ @[6 @w 2O @* ;`"@ $@c<@[ @]2O $H@a@8O`v cȈa(f@ @(  $@ ?@ @@=  $ 2O   -@E @v@  $ @Z@@2@05@!O`%v#vbf@ @ $@@$2O2@`2@ # HH @l $$@Z @ `&`  @_` ` _`3^aX@h 3ȯ/ &иВ @ 0?'ب 'Э/`#'='=' $L@fcـ@c_ @XM`@PM~@M~瀦`"@@F~̀ @@>@7 ̶@G @,~W@"~瀠`@0@:?"H_hs`@[`@2p  @Z" @@Z @@u< @@o7`@k6` "@/ 4؀@ @ /"H @F* 9` @ @M @ M``@  `  |` @` `2@ &؀"@ "@'@D'􀤠@@=㿠  $@6   @@0@. @`' "@&`'`$㿠@ $@   @@@`2O $  d@ 㻠@ @ $@ @)% @ /@@@@@% @Ӕ /@@@͔@@@ʐ㻠@ @ @$@@@%` @.@ @ @@@ @ 2@ 㿠?w@@@6 @6 6`K @ϭ 㿠?w@@@6`@д6`6K @ϯ㿠`@ `@ @ w4 30? &` /*⪪u@@`@Ж7`@&`4`6K @ώ@wLd (08@HPX`hpx$lD㿘x"c`@." $`@x $ `@/xxc  @1x #`@, H @T3xb @.'@@e "4#\#` 6%Hl$aԴN`a-M- `Q+``@ &&Q@+S@@Q$@. ( . Q@*R@@2OQ@\-R@M* $%&`(M$P@-.` ,@ė+ €                                       M9x"@ c N`-*  N`-*` , @  x"  + &`#`, `  (@.%@D@ "H G1%@@$,M$&`0;\`,`. @ @$E* @@$@@7*  $M@cx㿠aa3+aaد. `c @ c'@ِ`)`(`@  `  '@`d@ `%@^ @7&=  " @&@2   `?@K # k lK , K?,K?,K?O,,@ K , $OK `* (, ' @' nn`N@.N.N.NO.@@ N`.@&ON`.,@1&!"`  @@0 '<``@  (@ 0% @Ӓ%H % @ʒ%H %@5`,$`@  "O3 "1: x )!تb @3@- @`?@! @`(@@+ @`?@ 2O``*%@ `(A`@Y`@)@ h%7`@ `" + `@b@&%`@>@ @ `@@" @Q` `) ``@@D%"O``@`*`@ !` @ @ )x@"  ` `.$,` `@`-@` @@`5  @``*"`@7@`,``'``,``(@@+@ $ 㿠;x7b9x"@@:&/-N`0!py~L#l}̒ @.  *P @ ` P@.S@@ `hP$@/ ) @ P@+ R2OP@`. @S@(ON`a0* R@ @ x "!!"̆LR@l ) P@ @@ lR@L@*@ `*R@ (`S@@ 2OR@*cQ@$d@㿠;xaa`@-@ 2@@$5x @Q.`'@`H / @@~@-x㿠@a` @``+  @@`@/M!` ``,-`@!% @#`` H `` /`@&1&!ԁxaa+`x@@`  @" `#b J *ܝ㿠@ 0@9@ & @ `@&;@a &@%㿠@+xaa @ . @@.&` @@`@㿠@G 9x @!& & (@ +x-xa- @ & & $@/& " @ `x#`)``a) ` #`#`#`,@ xx!* @ @u㿠@+@Ox *``@@ @/M'   - +` %`$`@  `@`.$ ;D!  'aԁ㿠+xa@a-  @d`-@%%``@ $.@@  ;'aԁ㿠;xaa`2@@> @&%@0  @ &&% @ @ @..@&/@d / @@ &㿠` @!'`N@'`N@ @ 0@ 5@y'`'`'` '`'`'`'`'`'`('`, 㿠@A@㿠`@@)@W!Ā @E @<6 $:# "@9`> 2?0? `"@,   ?@O`& `o`m O`-`O-O-OO--@ O` -`$OO`   O/ *OO ,,@ /@& 㿠;`;@[b @΁xbxb xbccx#bx#b x#bxbx#bxx#aax#?#?# # # #b " 㿠;xa @a-`@!.&@ @/``2O@& @_@@N  d@ 㻠@: @7 $@ @)% @. /@(@@%@$@% @ /@@@@@@㻠@ @ @$@@@%` @.@ @ @@@ @ސ 2@ 㿠?w@@@6 @6 6`K @ 㿠?w@@@6`@6`6K @㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @ҁ@Ȼ㿠`/@ @ `-`&`&`8N/ @8&`?&"@7 ``L/ @`2O`J* @ '&``L$+ 2ON '@ "H&`&@n@ `@/@㿘 @@} /-㐀@H` "O` @@e`'' ```''@4@`,@ @I@$K#s@!# @Q@  ,  , ,@+`@'`'' H@@$UHs@   c#@@Q@ - `-@뻐` O#Lcs @9@Qw#\㿈@@/+@@ c` @Q Ms"@   3>@2p ch@QU '耧`'@'';c''/ C @  d@ 㻠@b @_ $@ @)% @V /@P@@M@L@% @? /@@@9@@@6㻠@+ @' @$@@'@%` @.@ @ @@@ @ 2@ 㿠?w@@@6 @.6 6`K @ 㿠?w@@@6`@ 6`6K @㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @@㿠@v;5c@Sp@ @N 2@N&@.N "H.L` @  @v@P  L``@ @j@PT@N* < @@N* = @@N* =`@N H 9#1@ . 7&` @f@vO 㿘;@>cȒ@걐@.+@L * #`@ꖒO` @  @ 2H`+``K` O %Ls`@ @ @ Ē@O +)b"@  3-3@ Ncp@@ꂔ @ @O@N 9O#s@$@OŒ㿈; @J 2@@ @ c@ڪ/ @@Ր 4@А @J`2@`3 @@  @x┙-@@ @ O-)@@% @O * < @/`O  @O -к* <`O/`O ` H @@ @{9 @o/ Ӏ@@j 4@e 2@J `2@@X @T 㿘 9 `H H9?#@`=#` #d#\   @A&.@k 瀦@f 9?X * ?` @ 耥 HC-'O䐐@&`  5@/  @ @ӟ` 4@3 @J 2@ @Ӌ` @ۺ ӂ`+`@ !'XTa HQ @ "H/?@Ɓ/?`@ =`#l  #\ #` #p#h#d @ `@ =`# #\ #` #d #h #l #p #t #x  #|` # # # # # ### @ @貔!J 7 * ?` @ 耤@耥 HC-'Ϙ䐐@&`  U5@D/ U@ @?` 4@8| @J 2@ @+` @$ `+pa@U!s'㿠8 H  ` d@@S9"@ &.-+̒a@3! 8Ϸ * ?` @ '䐐@&` Ɩ 95 v@ˮ/ ܒ@ @Ɛo` 4@翐 @J 2@ @[` @竺 R`㿈;bHHА @瞔 5 @犦/ ћ@@煐 4@瀐Đ @M` 2"@@q $M @V@* > @ L @J@* 8`"O L @? /@@L * 9 @@L ,` +Д /@@|L * :``2O@L ,@` `@``&O/@@, &``1?@" # / @@&@ #@ #@J!s@E!q㿀bH?H?А @  @/ @@ 4@& @H`2"@@ $N  @@ * 8`@ M @s@* 9` "O M @h@* :`@\ ,M @ ,?@M @* :O,@@IM @@,@> @M * <`@Z -`L  /`?Ъ@@L * ? O-`L @M ,@K`@ #@t@ `@I@G  -H``@>  -@>  -@L * :``@ L - +Ж-@L * <2O L ,@  &O-@9 #L @,H@. #@H @% #@]L * 8`@ . L  *а@OL * 8`O. L @,@ $@  @ #L @ ,@ @5M` * ;` @. M`@`@*M`. ?Ш*  ;O. M`@,@}`@M` * 9 `@x.L  .Д @L * :``O. H)@-#s &``@嶔 ?. &L `@I@ c$@KqL @>`@KkL @8`(@KeL `@2`<@K_.HX &``@刔 #?. c @&L @@ɐ+c@KCL @@K=L @ (@K7L `@<@K1@f @a #@\ #@W #@R #@M #?@僔"7J?@~"8H@y"{)@t" 㿐7@HH;`bb d@Ɛ@/ ,@@ 4@U @`J`2@ @  $Ics @ @JŐ< @g (2@O @ #߀]@ @ # O @@2 &OO @O  * < @.O  @O -ж* <`O.O @O `)"@&@ #@ @ #@ #@"zВ@ݔ"w`㿐/;/`8@䍶/ Ξ@@䈐 4@䃐ǐ @J 2@@v @r 㿐; `@_/ p@@Z 4@U @J 5@ 2@H @@B @> x;6.p @@>2p А`@%/ 6@@  4@` @J 3@@ @  㿐;`@/ @@ 4@2 @J `5@`1@ @@ @ `-/ . ?`.'`=@'  Kcs @ @I@H-@Q@㦢/ ͷ@p@㡐 @ N5@ @1@ @5  0?`/ @"H @ Oȫ- Ics @@@I7`Ё-@ @`/ q@*@[ @L`5@ @N`1@ @G 5 2? / @= OΓ-@3 4㿐;`˒ @ / 1@@ 4@[ @[J 5@@  @㴒``  @㰐 @& B&``@_@ :&``@W@/&`㸒`@I @1*&#`0@@ )@# !&`\@>@`h@9@`t@4@ &``|@,@ &` &` &`@ 㿐;ahR @⧮/ ̸@@⢐ 4@➐ "@N 5@ ;9@<al!p@9 2H`@  @@@&`@z h;at@i/ z@@dv 4@_ @'J `5@@Rv @\"  `@Δ 2`*0 @@Qv  @@;v @6 v㿠@9!|@⅔ @ N  @@* ?` I  d@ 㻠@ @ $@ @)% @ /@@@@@% @ߔ /@@@ٔ@@@֐㻠@ː @ǐ @$@@@%` @Ḕ.@᳔ @ @@ᮐ@ @ᦐ 2@ 㿠?w@@@6 @6 6`K @ 㿠?w@@@6`@6`6K @㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @@㿠@R @%  /`N  x@N s2 1p? N `r 6`    w4 3p?2?-,`@O/` @   K? "H#  @# @ + K?` O# @K?` O#  J `@  J @  "H* J  O  +#\aw@6@ @@   @Fk #`2 #d@m@1#p" #l x#h+p ?s✨s #x@) [@s@o[@''M-@ dH l"@ & 'Jcs@*s@Fp[%\!'L#s`@s@Fd$[\'Js`@s@FX0[ \'Kcs @s@FL<[\`@Ѐ@"@! !!'M 'M 'M @Hs@F1[ s M '[`@`s@F"[  #tls    @ [@   Ժ?@O s@ࡐ[@  &Os "@"@8 s@8"  @૔ 2`[*0 @2` wss@( [[`"2@wwM @s_@2p @EϐpM [@ s.@EŐ|[  LԀ`@`N` @ =N`+ @ *@ M N`M Ѐ@s@E[@`s@N`  [ * 8``@ mM s@N`[* >@$. N``. sа@N`[* < O. N` :@ @ MM M @X s@Ej[RN` :@ s` [h"[`2@wwL`!'耥@ s`_@,2p @B |[` @'s`@< (ж@  (& & $[`s`s`'@. (&$$@ (&$[`s`@[`4O s`@@9J `@H`^@ `K``@A`^2O`} `^@0K`` @@! 9@?З+ :*`?  (8`*`K`` 9@; І )`` @  )` _@ / )` ?d@ )`K````Oʆ`)`H;wc@ڐ2@  @ܢ@ܯ  @B @@â T@ `@L`]@  @4O @ڔ @ /Рs@ @L`@@B@M% @@N* :``@ &@ @~N* :2O&N ;@N`^2H.IL@0@A@$D&@܅ @ .!L''耠`@"@AL&\@r @ .!L''耡 @@Aΐd L!''耥`@@AÐt@oL'Ԁ`@|@A'w/@ܙ 2H&LL`@@A@k@@ O @ LGp@Am@v$@L@P@A@۷ @@' -@L @@Ay`@h@do@۠ @@ :@L`@@Abl@ۑ &@OL@Tt@AUQ@ [@ L`@H@AHD@ (@7 @o@)  M@E@ ,@,`@Dd@`E@R"HWd@ ` - d@d@``@H@*OM@L'耡`@ @A  L`@@A@ 2OtL@۝ '@@@ސ'@Ԑ@ @Js@ @'' '' @@ג @''@''+Mcs @ @@ @ '@ (@ (& & $ '@ ($`$`$@ ($`$@m@4OzL`@@@(L @ @@L`@@@@ھ@㿠`@`@ `@.0;`@ `"H) ); 3a@@@ڨ@ڵ 5Ȑ @@ @S@Ґ?Ѐ @ waв @? ~㿘;c; @b@ڰ2@`(@x@څ   @? #`(c @&@n`, @-@n@79"@= @D@B- @1 @8@ʝ`  @ګ D@ڨ` \` @ڢ t@ڟ` ` @ڙ @ږ@71x$"̺ / @ڌ@!'@ڸ   )  l@{`@!  @s ! @n@j`@ `H !8`"@ !H!X!(@\ @X@T@P<@m`!h` @D` J` /@@!@9` K @@!@.`@@!@$@@!@@ ^@2p !@  @!f@@ @ْ@ك@ف$Oo !5@@w@u`@@ٷ@4   d@ 㻠@T @Q $@ @)% @H /@B@@?@>@% @1 /@@@+@@@(㻠@ @ @$@@@%` @ .@ @ @@@ @ 2@ 㿠?w@@@6 @ 6 6`K @ 㿠?w@@@6`@6`6K @ 㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @@՞㿠`G@9".@G O.'`@؜??㿘@ ;`" b 7f@d" f@" -+#d)cdȡLP#``ǒ ' #\#\ RV' @* ' ,@l ' 㿠@] @[㿠   &ŀ@ H- rW@"-@@. $@ @`f@O㿠   &ŀ@ H- rW@"-@@@. @$@@  f@O  ?2H 㿠   '`@@@ `H- rW"-@/` $`@ f@O?@ @&"@ &  㿠   &ŀ@ H- rW@"-@@@. @$@@  f@  O ?6` 3p??㿠   **& #\* \DH&@ @׆@7&.` %"  ?"@+ &`@@ `H+  rU"+ @% ;{T@ % 8xTO% %   % (O @C㿠   '`Ā@@ `H, rU@",@/`  "@@ f@O"@ && @@-`w   $@@ H- rW"-@@, #`@ f@  `O `& &&㿠   '`Ā@@ `H, rU@",@/` #`@ f@  O?2@   ? % & .`@# f@ @-ŀ&`@@ `H- rV"-@?@ @@@`f@?O ?$` $`&  f@ `Oא 㿠  /`@u & 㿠  /`@%?"@@@ @?2O(O "`  +` "`   @@ *O " " "    J `@J @ "J`)``@  `"J`)` O"㿠@2 3p?``aDh㿠@~N @N  @  @u.'@ @O O㿠@C2 3p?`aaB*  3  * 1` @ ( 0+`@2   3` 2?  d@ 㻠@դ @ա $@ @)% @՘ /@Ւ@@Տ@Վ@% @Ձ /@@@{@@@x㻠@m @i @$@@i@%` @Z.@U @ @@P@ @H 2@ 㿠?w@@@6 @p6 6`K @[ 㿠?w@@@6`@b6`6K @]㿠`@ `@ @ w4 30? &` /*⪪u@@`@D7`@&`4`6K @<@% "` "㿠 @@ / @@.` '@/ /-̒@  h.`㿠``@`"@ B `$@<    2@ `  "@0  `@ $O  `@%   2@  `2@  `2@  ` 2@   `2@ ` "@  &O  @ԝ㿠 @H 7 & 6H& 5$@Կ   * J 㿠@L  @ 2H2O@= @ ,$ @|* &   & & `@`" "  " " " "   `2@``" `"  ``2O` UU">K 2 =>%@H9 ' @\@V  ``3 ` 2??f@ ``3 ` 2??f@㿠@ @㿠 7?& Ns@- x@9``@1N#s@3` @9@؁㿠   @Ԟ & 㿈';'b''@* ?  "@@̮ "  㿠;  a@Ԁ @@ 9@ӻ@ 75@ @! @3 K`   Ѐ @* Ѓ( 4@$ `"@``@ `4@ ` @ .2@ `"@ `"@ ` @  *OK`9` #@ 2? 㿠2@N `:@ "@l N:@ @b 7?    N@* ; @A@-@ɐ?ɮ@ *ON $@1   :@ @`"@2 4@/    2@( *Oɢ`.2@ 4@ h* =` 2H  `@ d@ 7` 3p? . = 㿠;b @ +b @/Ms@3`Ȓ@8`'` 㿠;b `2@` `#  &`%@y #vLcs @9 @8x`@  `@8l``&O``@8d㿠;b `@7 `@9" H;5c0c0;h@tے* h>@ ;h* h=H `` 4   `30?7;h@  `5` 2p?#`O?`@ `5 2?``@ ;h` 3?h `S@h` 6` 3p?`@  ;h@ @7 h;h @- O  '耤h@ ' O @ ' '䀥 @ '@ cP '#`ܐ#d `1d@Z܀H`@h Xܴ@܀@$@7l  `@ @  -a,d@ @< `@+ @)O `@: ! 8 `@   @@6w @`P@6q $O@@T@6g \@6d `@ے`2@ H@%@ѥ@Ѳ @7  㿠 `H##)"@ "@" * =`2@ @@ * ?`7 3p?.>` !at!@ќ#Y)㿠@U `@( J `"@ @I@@ @N@N@ @&?6O  "@   2OJ  㿐;b @ޒ5@@` HԐ2O;9b '" @C#㿠@c* ?` @ * >6` 3p?  d@ 㻠@ڐ @א $@ @)% @Δ /@Ȕ@@Ő@@% @з /@@@б@@@Ю㻠@У @П @$@@П@%` @А.@Ћ @ @@І@ @~ 2@ 㿠?w@@@6 @6 6`K @ 㿠?w@@@6`@6`6K @㿠`@ `@ @ w4 30? &` /*⪪u@@`@z7`@&`4`6K @r@[㿠@X  `2@`&`& " " '``" &`" 㿠 `@#`@2@ @&`&& &`@"H& &` 2H& @`2O 㿠@&  &@@ @G2H  2O  㿠  @@?K` l@ #@ aHծ` g"Hw`? l@ q@??K` x@)`:@v?@1N* < "@o? N A@?.@6?ɥ.@>@2@N* = 2ON":@P?@* =` "HI? .N@.д@@@N* 8O."@1?2H?N"@*?2H?'`2@!?:@'`N ;2H'`'`@@"`@ @?@VN* :``@?Nt@? >@:@'`M`;2@'``'`N`t@?'` >`@"` @?@(N* ;` @?Nt@? <:@'`M ;2@'`'`N t@?'` <@`@-@N* <`@&Nm@"N p@ &:@'`M ;2@'`'`N m@Np@ &'`@?"H.N @?@N* =`@?Np@?N o@?Ns@? ':@`'`N `;2@\'` '`p@?No@?N`s@?'` '`@+` @?@N* 8`@?Nu@?No@?N t@?@ "O `;@ Nu@?No@?N`t@? "'`㿘 @.@@&@N`* =`@ `@@@N`* 8`2O`@N* 9 @ &@ @N* < `2O&@ ' @ '  & @  - @ - &O- "@ N @ @)&  & @ @ &  & .    @@T ,=@.N` &@?"@/``@L/`` '@ @ @ `/```'@`'@*ON`  $'@ N`&@͒?"@/``@M`/``'@/```'@*ON`  '@ H'@ `& @ -@-&O-"@ N `@@&  & @ @c & &  .   & / [ &  @ -  @-  &O- "@ N @ @z&  & @e  @5 & & .   @,  & `@ -@-&O-"@ N @ @M&  & @8 @  &  & .   `& * @ K @ @/  O OВb@(! e'@\\4 T|㿠@  N   b!&@;  z @* @ !@ N` `     '@ <@ <@ >@$?ߐ    '@ -@    @ @ "@?ߐ   ' @ H?N``y ?߀`^@ ' <@ /@  m   i  -@?ߐ  b ^@ ' <@ /"@ N``V   R  '@ "HT?|/  N`=`` E 2@N`  > `; @J N` `3  -@L N` `+  -@ N` `#     -2@N`   `  -@8 N` `  -@ N` `    OI&@  d@/ ?@A" N``=   ??@6"N` ` 怢 ?@,"N` ` ܀  $ 0@""N` ` Ҁ "? @< H`>@`-"HH-H -2@)H`-2H% -2H @ H-"O>2H @H -"OH >2@H-"@  *OH  㿘@&  *  #`@ˆ.V2 3p?0@w8#p  '  #\!`'$ #l/,'0@'4 #h #`#d\#x#t  <`@;'($@@Β@@|N !@ u2O'(qO,/@ #| @i ### #N ?߀`^@ " <@ /@ *GN TO, "O'(K$@@˕@F @CN !@d @N  -@ N `-@ ,f@*2O'(&O, /@ #| @ ### #N ?߀^@ " <@ /@ *ON  O, "O'(@@#* =@  @@5N * :` 2O  @ <8@" " "  lN `>@`<2@B|l* <@ #  #  a N @* ; @  @@N * ?  2O N `/@`<@`>@N ?߀^@ " <`@ /@ *ON O,@@@#* 8@  @@N * 9 2O N ߀`^@"`<@  `/@`<@`>H `= ##p@԰ @m@N * ; @  @b@N * ?  2O N "@*'@(@* <`@N `<@`>@ @D@N * 8@N <@>2O @# #- @*N @ `@ @   N <G>G @N O퀣`# @  x # d@`G:t<* :` G2@@&- @- &O- "@\`@ - ")`@- '@@ב+ .".@ɥ#\(  % ^(% W% "% N  @@N * ;`@  @@N * >``2O N <@>"H|  <@!8@  8`@8$`@ '''$H'  |''wm  "H  O <mO,''@E' #@ `@%#` j  0 @" " " @O" " "@   @ " "$O|' ''w2H 8' |8''w@  `@<|''8ĔphN <G| Oz `@  @O * 8`2O  + #@ *@  !@R "  *  * $@Ő@4 `@=<@Ņ@8D{ @2L@z2@N . @& T@ܐ\@ې@d%@^"H.M ,@N@a ,@ N@@N`OߒT㿠9",`@ŀ``@5`@2X@` @ `@@& '؃㿈@o@ @Ŀ@ ` @*+ Ics "@ :`@2p bh@*b'耧`'@'''',/`@/M) "( %#\#d@ Lcs @3Ob@*6@O.쀧`@@c@o㿘@o\@5@e@r 7 ☐ @)ДNs @ s>`@Q2p b@*@@@x  %@ĩ  d@@(@M* 9 @ @@M* :``2O@O* :@'`@@ @vO* ;` 2O'`H@@@jg@ @_֒@@X@@ @Yk @@[ 9" @)]@ؐ@֐@ @@А @( @" $@ O@oK㿠;b,b,`"@W @Q  d@ 㻠@Ø @Õ $@ @)% @Ì /@Æ@@Ã@Â@% @u /@@@o@@@l㻠@a @] @$@@]@%` @N.@I @ @@D@ @< 2@ 㿠?w@@@6 @d6 6`K @O 㿠?w@@@6`@V6`6K @Q㿠`@ `@ @ w4 30? &` /*⪪u@@`@87`@&`4`6K @0@㿠  @G " @ `' ' '  㿠 `@`@`"H  `@`H @Ɂ @Ɓ@  @㿠@ @@6@° `@   @ @    &O   ' ' '  @@ , , & $,`@ &  `& /`%- % % % 㿘@ :@#%* #`@i.@M* =` @ @L* ? 2O@ѐ 㿠 `@%   @®@ `   &O a @ %@? .&@-@  &   㿘'@ @   @@   @ @ @ @ ` @ &O  *  #`@  @@,@`@  @- В@  @&`      :   @` @ϔ-*@``@Ĕ-* &O - #- -@H) -Ms`@ D@'v/ @ + p@'! @  @ۖH? (@ǔ!i-㿠  "@ @ `@    @  &O   @@n@l㿠9#O#ဧ @ L "@, % @''d'+bX @  L-X鉒@ L@@7@' L@ @1@'#@(;cv 㿠;bX @P 3&bXY@@9"X7Ք Ns@ @\;`@&ԁ㿐;6Ocs. @ s`,@&[`s``H@4@[`s`@ʐ[`@u `r 5;0 @:shs`@{[`[h@a!@s`/: sh f ڐ@O[`[hs`sh@@[`[h>s`sh@[`[h@<&osh-sh@?s`@C[`[h@)!@s`/: sh @ d  @[`[h? s`sh@e[`[h@oshs`@Ő[`[h@?s`sh@[`[h`@y " ?h)-Ms`"@ 3@&&` ?' Lh@!-㿠@>#';p  @  @@&@&@`&`@d&`@@O` 2@`O` @ O` 2H``"@``@*OO`O` @ O` @ ``,@"@K㿠 @c " N `@     `@a =#;p '@ .># : @ 'O.@+@&`"N @ @ N ` @@@:@ N @N G򀠠 2Gô`6@. > "@ : !@ .<"@ 9p @!O.@.@֓.&`." . .㿠 `@W?` @R@ d -@ `"@H?'@$@ M :@@є@  `2O?@@@&@N`* < @ `@@@N`* <`2O`@O* = @ '`@@ @O* =`2O'`&' ?㿠 ?7` 3p?㿀* ?` @ @=&@ > #@;0  @ . 㿘і* ?` 2@ @ee㿠 @ `"@ 9@h &`  @?'&@?;`@R 2@?@@I'O` /@2`@@A'@ O`* 8`@ `@@5@O`* 9 2O`O``.@`@@''@O`* :`@ `@@@O`* ; 2O`@ O`* ;`@ `@@ @O`* <` 2O`'&@W?@O`* >"@P?@O`* =` "@I?@O`* ="HB?O``O`O`С+ О$ Л+)` @*) @0`@'@N* <@ @@N* =` 2O@O?* =@' @ @O?* ?`2O' @d&`㿠  @@1@/㿘&  * 5#`@ . @ @#㿠 `@!``@ ``@@N 2@N&@@N& d@Δ  @`2O`㿈;`@L @N   :@N  @J* <` @  @BN * <2O N @ @N * =``@ @N * =@ (N  *pЄs`@N [`* ?` O(N -2@R s`@N * ;` @I[`v` @N * <` @ +M @ )0О@sh@M [h* <O+M `/2@- sh@M * ="H% [hvM  *@?v@ * > @ N`*pИ@ `+0 sp@N`[p* ?` 2ON`v  H6.p @@ `/ `.< s`@I . @*M @ bsh@zA2p @"[hb `sh"/ :@l[hM =``@"@ sh@"[h`4oM M  `!"@IO@@ : s`@[` h"@I?@@M `"@K @" `M "@ bs`sp@y2p @"[p[`b `s`"9`/ R@[`=` 2` M s`@I "@ [`@s`M [`Gs`@"[` M @ `@98",@"s 㿠  '@@ *  '@ *@ @   &  ' d@&  㿠`@   '͒ '@ & 㿠. @N?`* ? @ @N* =`2ON 2@&`&  N @!@* 8`@N=@@N @@* 9` @N=@2O`&`@ @N* ;` @ @N* < `2ON@@=@ @N* <@ `@yL`* =` 2O`L`"@7`&L``"@u `"@ M "@m "2O&@\M* 8`@ `@TL`* 82O`L` @ @?`L` @O`8& @4`2& &L`@@@`L`@2O`@@@&@#L* ;` @$&@ @L?* = 2OL``d@& "@   @ N@d@&  㿠@ @ ``&@ & ``@v%  -㿐'DD'HD&` ;* ?` @L#`@:;a@ @3`@0  /  \`@ "@2 6`# : &@ `'@ '@H `@@a%  ;* =2OH H 3p?㿠;Ocs; @bD 7@ Ґ .    @ @ 㿠.7NT?`@T?@@ %?- @d%?3Ncs%?-?-? @9!H@ 㿈%LT @. TM?<"@? @"@? @-@& "@?  * =@ 2 @ . ɐ* 櫐>@ E?* ?` @  㿠 "@ $@ $ "@ (@ ( "@ @  "@ L@z L "@ T@t T "@ 0@n 0 "@& @h& & $& (㿠@;at@ސ ``&`@e0* >@`&`㿈. 'X7ę7 @   |@]sp2@[p =sp|@, @q"H[p@o >@^ ;Ocq@``  sp@ @W^ [p dP`` _X dP dPOc v  8 @v 8#\#dfP #`#l2 f@ #h@C?3p & @ "@, 't>x1p #\#`#d d#hhlp@^a* <`2@ ' <@?@ ?@? @ >J@6&  'H'''Ȩ>L>''X/M  @/ 5'̊? Ի0?7` 630? `20?*< 'v`v`&`&`&` &`$&`(&`0#ܟ5'̔? /20?5` 62? 0? ,`<'v`v`&`&`&` &`$&`(&`0! @! @@`@Q2Ȓo`H  @   ^``"` !>@vS2p @_,$ !>`@H}8D@_8u  `!>O``@T!>j `he Ȓ`('`,'`@*і "@  @  @'  @  @''Ȁ2@'`(`@ I#ဢ2@' s* ='@M 1` 2?@> :2 y a|/`3?@,  @_}   @ !܀@  ! Д ! @ ;!@ !`@ 1ȒӖ ! @@2 w@`!2`*0 2`w@!@@ $ @ +2 @uy @D _'ԇ7  ' '+p '0? 'ؔ?'?"Q'?'''w''M!j "@ ww   T} __ €@  @   ww` _@_`2Ow܀ "@, †"@  怣`"@    ( , @ ܀`@  w@ wܔ__ww,'9 __@ @a'nww   * :_`_"HIOww L __'@ww@ p@F __ w@ @: __Js@ww@u__L @ 'wwO_ _&@wخ ' &@ w؀@ ?  f@ 'ww`z` ?@__@؀@-w@[(w@_'_@! #w'Ԓw. __wL @ @Dɐ =ww$@_!_ @2M!5@ ;!ww@c__w/ w!?@x__@4w@ 2` *0 !w@^_: _ "h"ܢ?^L!@` "@ ww@2`_*0 @w!2 w__@A܀ @www @k  "__@*ww@W{@W_ܔ#\`@Z1p * _:`_2HwL@ @e1 '`@8 HLwwwp+ _?__@&w%ww* #@-   |_?__2O@%www`` a_@__`@̀ @|w3 w"* _9`_2@,nLa@u؀"@hLw5wXwTȮ_ܒ  #t3 #d#l#\#h#`#x#p#| __@ww@=__'@``@ @GL"@ w@ww__;,w̐_?_3,L@ @ @@ΐ@L "@ w@ww__?w_?_,O`@"@  "@ܬ ww☐G ?__@ˬww@ M* _8`_@ww/_?_2Ow@q  w&w  * #@@.__`@wwa@ __@ww@|N* =2@ N__2Hw w@LQȮ@ Զ" #\@ @h__ww @ __2@ww@|N_* 9`_@ N2@Ȕ '&w (`@!ww@ __@ww@|N__* : 2@wN @ ww`__ww@!_`_@ww@__wwܐ@@__M!j@  }@@Ɛ@ 2d@耡`@ (bQ`L@0M!'@%w"* _8`@we* ;_ @M!5@w@_w@N<&`L_ N`Pw@N4 &`L_N`P@D w@[`L_* 9``@:M "@M  @4 `LEl@"@" &@ &@M!6 @M @  `@ !:@ w`L@[ǒ `L_"@&`Lw@z_&`L .`PM!6`@8N`Q @4w@e`LM!7 * _#@w`L@ZL@V @_2@w `L@ג_@`L@ w@&`T_0v`X@&``_w&`,_J @ w9@"<&`(_@&`(_`@w@!_w_@"w@ ;_@@w@{vO?_* =@' @ w@{iO?_* ; 2O' / w&` &`$㬐–"* _8`@ ww* ;`@_ w__! ww 8_ d_@'a,`` ``@ /@a,H ` @  ` H w@` _ @wwb\@  v`v`&`_@G 3 #`#d #l#\#h#p#t#x#|6 '@``@@FL`@ @[<`8`L @ @K``@@T@R@̀`@ 3 * =@`L`@ @$`ݐ`@@-@+a3"@ 8a-"H!a."H! `"@ !@耐"@  8 "@ !@u"H  8`"@7ww @@___ "@ww @(@R__ @ # w "ww @ڐL@@<__ @ @% M!c "%M!c@@ Xww @ _ _ a@@ `ww @ _ _a@M!6 @`^`` `@```6hqw```"@ `^`@``"@L@L@ @r+@~ ,`?v`?@r @sww @' M ܒ䀦f@@  __ K` v`?`@Y`@Zw(ww @  _(0p @n]@ _(_d_ ` 0p ww @^L@ __ ``!`w3 @nAw _3 @^7丐 @__  `3 @n.w @ __ `@w w @@ __  w @ __ 2H,M!42@(v`v`&`؀ @+̀@n`@ 3 * <`@sL @ @gc@i9v`v`&`؀`"@IȘܴԗ3  #h#p#d#\#l#`#t#x#|l '@``@`@9L@ @.J*L@ @:@`@@@L @ @g @s`"@ '@n '#@7ww @H`Lxx_`_ "@ ^`ww @@`L_ _^` ` `Lww @c̨__  N‡`@?Nq@d@@   * > `f@ -@  @ w<Tw@(___wLL(ttttttttttttttttttttttttLLXttLttttLttLL(tTLp/#d%Ħ @ 0p?d` "@ ?d "H&?@?H`-@?H`@ d@?d&&M 䀤 "@M 1@M 1`@ @X * 9` @@  @ h? @'@`'M!`"@M!(`#|#h\( f@@HM '@U* ;@ `#|#h\ M?@ `#|#h\  ?`@ ` #|#h\'`M?M!?0` 3p? / ; @ M %2` 10?@, 8@ J쀢f@@H M @ M @ @Ux* ?  @M!@ @y #x3<#tԐaX#l? #p `@=p@ې @TM?`@ @@ ?l@@J `@D@P @ט` @Ж@K @ 2@`` '`` '`@_w J逢@|@@@ t x @_8w `@_ww@`4@`+Mc`2H```'`'`hM@i @TR @@o& dž%`c=@b(@?t@<ِ?tl@ @0@@ p @^8`@ @V 0`@ @N (`@ @F  `@x @> `@@9 `h@k @@@ l @)` @@   " ```@A?l@  `@I0  @ ``@ Ė#!@ ?tM? @hO` @ @@I @>{@  @A Ē @@ @ "@W @M @  @ @  `HI @?@<@ ` 0` 3?-=`@ tM!)M @4쀢 @)`@&@$@@_`__` _@i%2p @  @[t @ g` @  @  /M?@ >M!)M? @ M?{@` @ @  #| `'` ?t` @b ``@@Z    @T Ȁ@@ $!$"`  @C`M!)`@&@$__ `@_2`'@<ː`@@ `@ I @@S?f@@S<_@72p cx__@9cx``@a_`__@`_@h2p  @?t@;_r?t__h ƀ``@*?@?I` -@ ?J` @5h_@_@h[2p  @ɘ_@hQ2p #\  @lp ^_Ц %  v` @O  `J  `_`_@h,2p 0 @?t@;?t@h2p #_@h2p X #\@?t@:?tG?t@O` )U```@5?@?J-@ ?K @8d_@-`_@g2p _@g2p #\ @S_@gۑ2p _@gב2p #` #\ @Blp[`_Т`%s``` @Ӑ   `ΐ  ` C`@ d@@d& @ϔ+{?@`@?t㿠@ @rN * <`@  @rN * = 2O N `@!`G@`+N M2@ N T6 2?`. =@`-@ @rN * ?`7 3p? x @* "@ /@;  @/9@59"D7y@ ܪ ጐ @5 $-`@@* >`@`` O?OvO`@@ 㿘@5@`H@* #`@RUU=`K 2 =`@=$,`  * #`@hbP@Pؔ  b bl  `:`J ) H ) :`J ) H ) :`J ) H ) :`J ) H O))`)``'D%/'H'L 'P'T'X0 O-@DD$0D'` '`'`'``'D ,* ;`@+yy! .$@y@`@@ O.@O$ ,* > 2O` @` ` @jt@` |@Ր ` "@'` @L'` ```@`@U@`@P@ `@ ` "@'` @2'` `@}`@xH@uL @rT`@oP @l` `@iD@qD@HH@r{ؔ@rw @``@rqܔ@rm @LL@rg@q44` @0`@@+@f<#'@ @q}@rJ @rF @8#b8@r?@r; @ː@r5@q44@q\@PP@r'@r# @TT@r@q4ђ4` @Q` @@` @@GO@ @e#5 @Ԡ @q*@q @q @``@q @q $@q 0@q @q@q۔4@qג @g` ` @qє8@q͒ @qɒ @qC4@p@q <@q @J``@q@@q @q @q&4`4``@ @2``@ @+`@(H@%`@"`@T@` @@ `f@ @ @=` @` @ D@T`Ȧ#\L`#`#dH@ `TȔH`#\#``@`@ `$@``@ @```"H ``$@` @``"@ `@```@@``"@` @`` "@`@` ` @1@`@``"@`@``"@` @`` "@ `@` ` @` @  ;@`` `@ :X&  ;X #㿠@@*&@ @'+`0@ؔ @ "@ @oN * =2@  @3`8@Ŕ @ "@  @oN * ?`7 3p?. .> 㿠@oN B@ D@    /`5/`\@B㿠;b\b\`@1&`#@ N`@`9 #.`b\`@"\㿠;bHbH`"@@  @>㿘 L@l .@ @@ /@ @V@C@Q@>@ L`@@ L& L@( I"Z`@+"ZJ@'J @$J`@!f@ @@N L* <@ 9 @ L @ @N L* =O` &  d@ 㻠@ @ $@ @)% @ /@@@@@% @s /@@@m@@@j㻠@_ @[ @$@@[@%` @L.@G @ @@B@ @: 2@ 㿠?w@@@6 @b6 6`K @M 㿠?w@@@6`@T6`6K @O㿠`@ `@ @ w4 30? &` /*⪪u@@`@67`@&`4`6K @.@㿠  7@$>.`%-@@H@@@`@O@?@ @$㿠; b۴ U?@Δ!&U  &]1&q.}.`.`.`.`).`*.`@y"̐@ @L(&`9.-%&a$ .` 2 .a.`+.`..`}.`v`&`&`&i.`&&v..&`.`&`.a&a &a .a& >`M>`u㿠;bhbh`@7@Cغ@&@b@c"@  `"H `@& &@&9y@f!㿠;@"bຐ@O`@ @M?* >` H9@Ł 75#@Ö@7 @㿠@;c@K@4`"@ @M* ? @@(  㿠@O` @ց㿈;wc$@P@o @@Z w@쀢 @ @ "@9d @ H$]@* 9 @& `cD@V#cd@K@+)'c ㈘@;􀥠"@@@`@@:4Ow@@4 3p? .>@@ 3cc(@ @㿠9 @I亐@@Lj* 9 @h* : *`9` @9@LWl* ;`@  S* < ,`<  H-+;@@h@ @/-㴐@Ȓ 4* >.`>  H@; @@' +`)@"@ @ @$J @_@ -"@`+ ` K``K`O_+ 㿘@N @@lj* = @ N @@l^* =`2O HN (@ @lPL?* ? @ $ @ @lEL?* 8`2O$ N @v#@t@6@kN * 9` 2H `N _"H` -@`@@%@kO`* :`2G`O` _G -"O`@l* ; @`@@ @@l O`* ;`2O`O`@"H; O``=2@7 `@@kL* =` @@ @kL* =2O$@I&` @Iے&`* #`@g.Ix?2@&   㿠@`@/`#$Lcs, @ 75)$!t`@ ,`( aX@r#/`㿠. -&@,Ҕ-)@"* @? Ԃ8@9 @6N~@2N /@.@)`(@@@K?/@ @#`@+`K/O#`N /@ J`/@5J/"O5@Iޖ $`㿘@ܐ  -* #`* *  @"`H/u* ? `H -ጒ@#R@ 㿐@W* >`H @@@ @};9c 7@@ 㿠@kN` o@ @kN` n@N`"@L @k N` y@@kN` e@ @kN` s@N`"H9 @jN` 1@ N` @ ..@jN` o@@jN` f@ @jN` f@N``"H @jN` n@ @jN` o@N`"H  @jN` 0@ N`H . @};9c7 @ 㿠@ @@ * ?` @@ @}a753b@ 㿠;b$@k@& ց㿠 @@@~k& 㿠 @@@@~ &N` @ @jo`/`N` O`/` 㿠 @@@~D& 㿠* ?` 2@ @@M /@ %.`@@&`N`/"O.` 㿠N``@ @H@MT& @M8& 㿠N``@#@H@ @@ @@N /"H.@ O@M)& @M & @A0ABp?㿐@W9"(@j@Ԥ@@iL* ; @$@ @iL* ;`2O$@ @iL m@ g@ k"@ $( m@ t"H$( $$ *@;`3@5;`@izN `* <` @ @#;`@imN `* = 2O ;`@idL`* =`@$@;`@iWL`* >2O$;`@ ;`@A* ?` "@ )@  `D>` v` 㿐f* ?` 2@@| 7/-,@2 @> 㿐L* ?` 2@@{7/-L@ @> ?@N@ @A"u㿐@@@@@@hL* 9 @$@@ @@hL* ; 2O$@j@hL՚( s@ d@ h"H$ m"@$耢 s@ w"H$$@ @@$`@`@*@;`3@@@3;`@hN``* <` @`@@#;`@hN``* = 2O`;`@hL`* =`@$@@@;`@hL`* >2O$;`@H ;`@p* ?` 2H`@{O` bl@x  D> 㿠;]bP* ?` @7 NP16 3p?`."Q 㿠N` @)@Ks#'$ @* =`@7@{53/`@= @K;'c 㿠N` @)@KL"'$܁ @}* =`@7@z53/`@ @K;'b܁ 㿠;c* ?``@7Nㆀ@9/#.`> 㿘* ?` 2@ @ /?-?N`@  ..5?.F&  㿘 ';bx@\ * ? @ 5@z/-+㴐b@–.> &܁㿠@* ?` 2@1@z-+)`#@ #@5@#@{7& 㿠;b?* ?` 2@N @N`@ . 㿘;'b@ * ?`@ 9@zC/-+㴐c,@l.> '"㿠;7̸cHO` O``@J ,@%@А@%@ @I @C 4M @  @> @8 )M @ @3@  M @*@ ( M @!@  M @ 4@ @ M `@ M O'`/`/`'` @yԐ/-㴘 <@ 㿠;5c@ސ2 3p?`.? @.@y/-+㴐c@)M#,> 㿘є* ?` @  7 (>(>>㿠@ @9@y5/- @ #|@;@1c|@z;'c| 㿘* ?` @ O7 &0㿠@o@f~N* <@ :@e @fsN* =` 2ON-@+@"@T -0` 3p?`/ >`@":@H @f)N* 8"@A  ,`N*Ј@ &@7 @,@fN* ;`O,` :@( @f N* <` "@!   0N,`-`%4@ @ @eN* ?` O 0 2@ &  ?@$㿈@j ؤbb;`;h@eN`h* 9 @@W;`;h@eN`h* > `2ON-@ +@   -4 3p? + :H0  N;`;h@e* `=h@ @ #pJpL#p DpХH `.2@ 2@ *ON`@ҥ`D> 㿠N @* :@(@e* =`@!N @ :@@e* >`"ON :@@ @w 2 3p?`/ > 㿠@ `@X@&O-@ &  㿠;bĀ`@@@m@7@ 9@#?@ 9@^  d@ 㻠@ @ $@ @)% @ /@@@@@% @ /@@@@@@㻠@ @{ @$@@{@%` @l.@g @ @@b@ @Z 2@ 㿠?w@@@6 @y6 6`K @xm 㿠?w@@@6`@yt6`6K @xo㿠`@ `@ @ w4 30? &` /*⪪u@@`@yV7`@&`4`6K @xN@x7㿠. 5@/`'.@ "@%@%%㿠@@s;Obb%y`@$`@'````. ( @.@ @@B@% % FN@͔-% >N` *@ + " *`` @@`@w $`@`,`$` N@`@@wΐ`$`@`@`.`$` N@@,@$`N "@,  , ` '`6H'`㿠N `@@ @ @ozO `OKc`@ #f@ Kc`@ #f@ #c㿠@@<% 0@ @ "H L` "@ `H' @"L``H`H@k @1@eN#@7yNȀ@ @\;/c ;Oc @ `@@:1y @  @ޖ?@ . @w& &  @   @w & &  -M`@J@`@@ @1y@1yN!Ȁ@ @5. 㿠CO`@@m @;@h/c㿠9yO!Ȼ. ?`@@`@-y-ȁ1N#@ 5y.ȁKc+c㿐'L'P'T@.'X;Oc`@7- 0@ @ "H L "@ `H%@ L H`H @X LH* > O@R H@/ 㿐'H'L'P'T'X;Ocs`@@/M㲀@ @- H* ? `O㿠@.`=)'`"Ⱃf@@I#@$c75@&@@ ;/c@@  3/c1( @d @ׁ㿠;cc`@/@"@&@& . .  O.9y?'!́㿠;yYaea@f@d Ib @b``f @& ,`+#@+ @  @`@`f@O,`O `@>, .`%-@ @5@ݒ1 ,`@+ "*@ @`@Β @˒`f@O,`O @, (`&.`@ @@ *` ,`$ )`@@"@ 㿠N  @  @a * `? O`d@ O㿠.@?`"@)N KN @D  @a|* > "@.`.``M=` `=` `0.` 0.`0.``MO.` @  1/"̶⸐@aT* ;`"@.`.`` O <  M@.`L.``O  O.`@.`㿠.`9?`@"tH>-@6- * 2@(*  @@Ð  `@ @H  @t' ' vUU:K 2  =`:$,`$"&4L@۔" \  % 㿠 ;bt.@ @@@O.㿘;`h;@@Ғ c@'c'%@s@t@m.91 5@ߒ"/- `f@@g@t @ϔ..yaЀ`@ y#!žyaЀ`@Jc`@ y"#"p  d@ 㻠@ @ $@ @)% @ /@ @@ @@% @ /@@@@@@㻠@ @ @$@@@%` @Ԕ.@ϔ @ @@ʐ@ @ 2@ 㿠?w@@@6 @t6 6`K @sՁ 㿠?w@@@6`@t6`6K @sׁ㿠`@ `@ @ w4 30? &` /*⪪u@@`@t7`@&`4`6K @s@s㿠;|3`;|c@c` H o n. -.%|.@$@Y n㿠; `<y3    aب, :b(@ @6@M,`!@@%` @ `%@,: ` :) @ "@ %` @%`,,``%`%`%` H%` @2@, Oć,a@ ,@8!M%`!@0   `bf@ @e㿠;}a8;*@א`4H H5| 3`.@!HO. @@  @  @ ?㿐'D;tn'HSbxDHDF#hh>K 2 >>* -`% ),,`&>I@10 |8 >&@*'@ + + &;`I@10 @=;`%@@ #/ *&@/` h#@@Ϙ@ /  5*(x#@ @ @ / $!*, #@@#`#d`@Vd*@㿠;b @ 9@q53*@`;* 7*@;*`@y㿠;*aHHDp`HFHHȐ@r@@?@̐@! ?@@  @ &@?@&@?@&@@ O@@?@ @)#L`@$#M@#N㿠9}1!83*"a@ΐH}@- +}?aa  @ H @H@&@@  `O - - @ Hz Oހ @ $Hu (@?ԀHs7@O` @ *a@Hh@H@ *@vH^@z L@lHX}a< @ }<?4 HHP#}a@ @ %}@?( HHH `@NHF) d @HC @HA!h@H?!@H= @-@+ c}@'t@#@  (@ @ @ @ }@  #}@  `@  d@  @ !h@ !@  @lX@Xl  㾘' qaXc `@M!!<@q'r?`@L / @ `!#   "@1?`?  @ O?@##H   ", ?  @@.*``$O,  , ?'@ $㈠H-, ?D?!' < @w?-, @1+!yc!خ `@?. {((@@@?Y* :` +p8;08@ _? @w?2O @+?;?)`<%a?' %!@wg?@c;y aش $'? c@?"H5?' ap+` ;.*@(€ ?`1?`@ ?` &? $  `f@? ???` ' ??/`?`@N @ p@ H@ c"H"? d"H?? p@! v@$?,?0<@LP\ ?`l@IN OȀ pD?`@/`I 1@ @\"? y@`?@\I` o2@ ?`@\J n6 3p?. . ;`d@ @ ?? d@?  ??~??'<`@v{?2O!L~- @ &L䀤 @?@,~~`@?$~L~Ԁ@L`@L`@L~@L~$~ @ ,~ ~L` ,~`@L~"H$~~?@ L~`2@ $~ $~ L~@L~`2H8?LԀ@L~2H;?L`:`@L`; 2H>? `@1L䀤 @ @?L``@2O`N`#@ŀ@À"@~N``@`"@ `\2@`s`N``@`"O`\jN`@Ue* 9` @N`\2@`[`N` @@US* 8`"ON`N` @.``X @:-  € `"@%@iG#. @i> `% 􀠠"@@i4   @ `@ @ @g#D@ @ =N`@@ 5N`@@ɒ,N`@@ #N`@@ N`@@ N`@@  N`㴒`@ߚN` @ O-@ @jߔO@M@ @E'`@'` &` '@ '  &` 􀦠''2O` 㿠@   "@ @  "@ @ @@@`2O   d@ 㻠@ @ $@ @)% @ /@@@@@% @Ӕ /@@@͔@@@ʐ㻠@ @ @$@@@%` @.@ @ @@@ @ 2@ 㿠?w@@@6 @h6 6`K @g 㿠?w@@@6`@h6`6K @g㿠`@ `@ @ w4 30? &` /*⪪u@@`@h7`@&`4`6K @g@gw㿠;|@ :c,@" @< @@``*O  㿠9- !8;|d@c,@ :@&@ @ @@``*O@``15&"&f@@ŀ #b㿐. ;6`b.0 6  @ b @3-s`sha<[`[h&1p 10 bK`㿠6;b.p  @30  b`x.0 6`6 s.  sx@g  ([r [xr Z `7 _?8`H#`@ ` `` 8? @ dp# h J  : ; 26 `:p sp s`sh@7̑2p [p@G2p < " : - &cl`!@ [`[h[ps`+-shaX@Gv2p   [`[h@. %@ @ = %@dp$ = `.H3 ^@%@s`sh [`[hs` &sh  `& [`[h6O  6Hsh& k & s`,@` [`[h& @Y@X@#p =A?@$9'H!-#_#`.!'L?`= K =`K@= HH@ @) ^ > "`=ss;sxsLIޕ_#e  \`= H ? [x>`[^ ^ `ss;sx s NԁX#B  :`[^ i@@` ` ` 9p?@#@dp""@i@K!@"@ ;sx#p#tpt@"2p  @    ҕb#h3|#lc\ ;sxNhl@"> ^ ``[x!@s^ s Y݅ )h^  U#@  ݁ p  LZ#@ ΁#` #d`@Idā㿀;'Pc_c6'T.p <` sxJ Psh;p [x - :`& p[h@Z! `2@  ;p<shK@: 306 :p @F!2p   p[h $@ @ <`<`@%dp@% <``@.H3 ^@$@@;psh [hp;psh  & p@[h@ & `& #`#d;psh`d [hp  & @6O  -㿘;'H#-c_c'L? K@s`    @a [`:J@8 1p68 @E2p (  @$ " @ @ ? % dp@% ? ` .H3 ^@ '@@  < &O HLg 0 ڐ @r㿠;@cN `@'- @@'-@Ɛ@ $v  2&&@@ v  0&&@@ @v  0&&@@ v  &&@cy;` @㿐.0 6`6s`.  sh @dn![`;[hb@r fr  @bH?@E:@ P%` %:  -  -8p @&%`%?& 7-@d c& $D죐   @ @A $?ə㿈'P'T6^ .p ^ @ Pv `^ 4hv #h2 #l;ph@hl p"`@*" @D;pp@ P$   :  -"  -:p @ $$  @ /& c;p@c $& $$  pȁa  $  ;a H#`#d;p`d@ @ $p> 㿠'H'L^  `^ ^ @ 4hv H;-L@ @ $bH! @e $@c?333333@?㿠'P65'T.p ! ^! Pv! P8 `+Oa`@`0%/a !H.`\!P(`` @ @@"  `@"ha(```(@(O(@ @(```@ $O(` ](``L;x (@ @ `@ =  dp&@ = .H Y@%%@   [.d `@" @ > =  <@@(`@@( `2@((``@O뀡@ ]( (& (;xs@@%  x"@[@%@`  & @k!+  +?+?O+?@+  6O+ /HxpCx\P`?'!H^!\P;xs@ 2p P#p#tp@tx [@ 9  9 ߕbO# @*`|`  |*`#p#h#ls;xh@l@ x[ ;xܐs`@A x [2@D;x^ `h^ `5`2 ` !`@  !ׇp  ss(ZIށJ@0HTV#&!>!@ @a@v 2@  +@E@@8&@x'P0PR#@ @/ #`#d`@Ead@0@E  $ ' " @  /  $  '"@&O/ / s~~@#x[`ds,D@#x[<sdt@#x[6 [㿠 ;-cp* T >  P㿠;-ct@R @@@  '+`%b@$1/`@;1@e @f@ `@@~7Ⰰ"H ;b @. #bc @N㿠.`7?`5/| 〖tpf@@}|"c - d@#@s#cp@> %H1p >`> %*%@ - &@{`\#@">  S?ŚH3p  > >&? JH1p b=? %@0p ,%> ,#'@V`7 @$> SUUŞ~H1p tn9 >  ? K@H30 ">? %1p -`%- <`'$@/`tn#b> K 2 = > $@ `(b  d@ 㻠@ @ $@ @)% @ /@@@@@% @ /@@@@@@㻠@{ @w @$@@w@%` @h.@c @ @@^@ @V 2@ 㿠?w@@@6 @`~6 6`K @_i 㿠?w@@@6`@`p6`6K @_k㿠`@ `@ @ w4 30? &` /*⪪u@@`@`R7`@&`4`6K @_J@_3Ae?PbM㿘; b;b7, ⨤@?@@@&H  @@@@   O,  @$@@ 9-1#\ !H &`>`+)a8!@&` ơJ>` N@/H>`bȂ@Ae㿘 7`›'#\ `&#`\` ƁJb㿠 ;@^ Ob`@9 /"@ @㿠;b@v v Ae㿐;5b@x '#\ %#`  \`ęHLPP& > & > R b  d@ 㻠@1 @. $@ @)% @% /@@@@@% @ /@@@@@@㻠@ @ @$@@@%` @.@ @ @@ݐ@ @Ր 2@ 㿠?w@@@6 @^6 6`K @] 㿠?w@@@6`@^6`6K @]㿠`@ `@ @ w4 30? &` /*⪪u@@`@^7`@&`4`6K @]Ɂ@]  @]@~㿠@] /`" ?`" " * " O_" *   `& = < # ;0 $& Js`@-  @\/-- Ms`@7.  `@Hs`@``@@\  x @\ . $ `2H!` &  "H& 㿠 @1& @& &`&&' M /`M\,` ?& Kcs @ 9.7@[ɒ  @Ns@;. `\ @  '.5#l@ @'@ @]]$ `@ @]U$L /` O+ؐ l/@]E   #\ 4H D3 9@,ِ#h#c#p#"#t!; #xcs#|#'_?`_?ZaX$hh#\ԔЖ̘Țu* >2H#7h`@#\b* =  @1# "@Gw @@7I @\O '@5.|6Oꀢ@`@ 3c@,@  `O뀥@  ` c`@  `c@,x@  }`  ) ; w`wܐ @  #d#`#\@ !O뀥 @#h @  5h@  .䀎 @  '  d@ @@  h@  䀎 H @@Oꀦ@    @`@l@* 8`2@@ '@+@'@@\C'@0`@>ـ@ />ـ@ /O /`@>ـ @>ٞ @2HO /۪  @#O?#O?倦@ Oۀ`"@@ @ @ "@J#( 2?# @ @  @m@l`@4a@ @)l@/* 9 @@[@[А5  ` *8:08#\5  `)p8;p8̔`@+_2O1@@(l@* ;  @@[`@[5 `5)08;8#\(p8;p8@+/2O@@ @o@b O @> @GO -@O?`2@O @(* =@:O @O - @O?`@`"@t|O "@tx䜒O -`@O? @ptI @@ |@~@~ p< |p nX@~ "@@~G@~'#\ԔЖ̘Țr* ;  2H @*א_? "`P ZXhH #\ԔЖ̘ȚU* :``@+@~v̀`@@~p̺#\ԔЖ̘Ț>* < `2O@*_?``9_!X 4` 3h@  ϐ@*/]h``XX`  3 В@~v!㿘/ Mss/. @ؐ?@*W"@ L@@Ò L @@Ye`ߐ?@~L "@1 א L@ * <``2@L @LI`@L`"@   L@  @ L"@  㲐 @L\* :``2@ LL "@ 㣐 pL@4@W * ; @, @~0@&  2@L/  2@L/@ @2@ @'@ * 9 @ L"@ʰ   n L`@ `@@' * :@ L`"@   UL@&* > 2@  $L "@  ELJ @%@(N* ;`@ـ@٪@L/`2@ @& $* 8@ L "@z  $!gL @`* :``@L̀@`@} @ L"@`  !<`MLL倣 @P`@N @< @0@\* ;`@!!@L-`@L`@!x⚐ @}T@ @}@}, !⍐ @} @̒   @͔ @* >`@L@!⻒@) L`"@  Ⲑ! L @ ⪐!́㿠1/ 8H&?  @W H#?А @Y( " * @)@|> @;Ocs @?@|"ڐ?@|"ݐ   d@ 㻠@| @| $@ @)% @| /@|@@|@|@% @|s /@@@|m@@@|j㻠@|_ @|[ @$@@|[@%` @|L.@|G @ @@|B@ @|: 2@ 㿠?w@@@6 @Yb6 6`K @XM 㿠?w@@@6`@YT6`6K @XO㿠`@ `@ @ w4 30? &` /*⪪u@@`@Y67`@&`4`6K @X.@X㿠`2@ N *@ ..&@@;/`\@|6 2 3p?`....㿘.@?`/ @>N``/d@@"$#`+d+e  `&  @ @ & - & @W-&  `,&d&㿠 @5    @$L&`L {Tm` @? zM yTM xTM {TOM? %@{@ I`` @xTO@W- @     J @ "`"``  &O H 7/ @{F& & & ;/d`p@{x  㿈/ / @W @/  `#s$@@{  f@ :@@CM* >@ @@CzM* ; 2OM`#@‥@@"@O`@CjO* ;`"@ `O``#"@ @``#@?`@ O쀧@@ߐ?@CTO* >`@'`@@@CIO* ? 2O'`@BM* 82HM -@@@BM* > 2GM -"O@C'* 9` @@@CM* :``2O@M:@{@!@C N* ; @@@CN* ;`2O>3?`3`# ` && @ 8@zݔ @F@O`2HO&O4 0?@-`8B@ D@z @)O`"@5O -@ L@z @O`"@ @O7  2?`-8:8p5Ns@  X M@ O$@`"@   @+ @VM  & & ?@zH!M㿠@%2@`;/@z@z a } `@%~㿠 `@    @y@ &O   @@y@yځ㿠N "@g N`"@c %@+%@BJN * 8`@$%@BCN * 9 @%N  A@?N @BI?N  A@?/`@B@?ɛ/`@ + :`/f@ f@ %@+@BN`* < @$@BN`* <`@N` A@?N`@B?N` A@?,@B?ɻ,@`/ =`/f@f@2@  N`N  `O 㿠2@ @-  * ;` @  `@&O/`'LsL`@, 71 Ȯ#f@@T`9/!(?` 㿈@y+ :>`w2 +@&q @ * #`@y,@`_@&2 b̀ @> %$̖ @ @)"@Ut3b㿐@x :>`w2 -@&3 @ * #`@xޔ.@`_@&U2 ̀`@) "㿐;/@aH97#t5/.LO#tTL?1y &`!@, ,?@; @@ې/! .@x,? , @x`+#\a@#`#d  @ @,?, @x "@  ` "@ @x&` 6` 3p?-> 㿠;/a@U@W* @xp> 㿐;b̀ @#@ @x^m2O;9b'"́  d@ 㻠@x< @x9 $@ @)% @x0 /@x*@@x'@x&@% @x /@@@x@@@x㻠@x @x @$@@x@%` @w.@w @ @@w@ @w 2@ 㿠?w@@@6 @U6 6`K @S 㿠?w@@@6`@T6`6K @S㿠`@ `@ @ w4 30? &` /*⪪u@@`@T7`@&`4`6K @Sԁ@Sb  @w?ə@@?㿀6`.0 ;sxb2\7[x` t  Ȼ ΁J@RH)#(_ P#(5Ns`@J\#x9/;p!#|@4j2p p`x| [#h#lhl/Ms@\;p1/@4U2p p!` Y#`#d`dp;p;xp@5=txp`ؽ<``< t`ȇ)x<tА<㿠@ `2@_  > `` w "@N  @w@_`>  w`@w,_ > h w  `w "@0  @w#`"H_` @w_`> @w`@w@w@wP2@?@wK@ ?> @w`@w@w?@ ??ffffff(#p6#t. \ %`7`h/0 )s+sЦ`#`#\d#`@R4`w [2p?w[@ ~w @ _`_`@ @~Ѐ@ _`h/ ;ss[[_`@;2 s3p sj 뎸_`* `[[`>;ss[ [@_`2h ; 2@;@ ;ss_`[`[`_`&``@`. >  ` ?` ->`l=`Ȁ`@l``f@ ;s;ss@Tp["@w?[[@1;;sss@u @v?@vה : s@u[[[`[h8@ s@*p["@M?s @uؐ @v[ s;sss@v : s@uʐ[[[`[h@ s@p["@%?s @u[? d @   d    @b  L@#;;ssssI[[[[@ P ʅ 9h p @us" ?[?p##s;sss^[[[[@; ;sss@ups [@[ [[@_` `"H ; ssssՐ[[[[w_`##sp;sss^[[ [[@ @_` `H> ssssѐ[> @[[[s ;sstss[@j`[[[@3[@ `0;ssss@9p["@\?[[[@;ssss@tސ @u$[[[;[ssss@tӐ[[[[_``> ;3 ssss;[[[[ @;ssssf#x> #|0 x|[[[[G&o ????d@ ?> ?# : %@@ s>#h#lhl[@s1=["@`s`[ @`^v\@\_Y`q`@tc㿠@P-/ @8H~ "&/ ^ @k@@#@m`@@@ @`@Pj  ]@G@@:/H/  ]@3@@&/@O@@.>>#@;0 @P5@s@t  " .@P&`@@s@s "  "@  @sܐ @sא @t ! @t@㿠@t<  f@b< ]@X@#p =`6`.0 ;@12p b p  '# b ' •bL@*-|91|9*#@#`7/"#d5`@sd@@@?x'L;'P6`Oc.0 1`LPB@#p)/ Ҧ"'X:;``&hD;` P` ;`sp N`[p;`;h@0|2p 2`h*0 ` s‡ pL' V @  ' LV P  ' L Į ' Lsp̒;h;x@s["[p`hx`sp;h;x@sN"`h[pxx#d#h  #l  #pO_#t`@ '@Oopd@d `h@h tc 2H'#t''@@3`@Y .aL @V @}``@J`@@4"@E#\H)` @ N5}@`} `@4 `@1`@* 8@*```'`%`@, @ )`1/ #@ @r"@K 1& 1&&FOg#\#`tL`@@ ې@8"H`@8M @.@- @ ʐp @ @N @@M/c@N` #li'N`"@ @M / c`2H=hFh2H7h@h􀢠@;`"@/h`aLN@ @ `@r5p@`ap`@@a`@"@hah`@`2@  @ `@ h@q h`@ h#@ @ S @ l @ d@d& @q d`@d%@qՐ@&&&Og`H/"@@q@ @q'N"- "@%@q%@2 @: @q@N`' 4@)/@q@8@ 8GG& &&'#l  @ @@ @q}@q{"@: "& "&&5Og@/` @@ ɐ@q`@q^@q\@&&&Og+/@yb ͖@qH@qF@ 1&&&Og @@3\/c0#D@qo#>k㿀'&a@/@* .`> ?`@G@ @@@9/  #֒@q ?62@#`@M|$?6#` #d#\  @ ] @ހ@ @ L @/ @p'  L @/ @p' `H   s`@@p@ +0' ; `4'`@\?` \?ZaX$h` 3` @, L>]@L? @`` `2@0L>@W"H L>]`L>`@% ,>#``H #\#`#d`u @ ` #\#d#` f `@ u,>ڶ@ː`l,>ڶ`@0L?`"@(@=* 8@L? @ɐ @p"@ @pN@p[ ռ  '쀢@ @ 쀥 "@ `@p%"@`@p```&2O\'@r00  @`P d@ Ğ?x;|Oc`@#|,c)'#P8X`##P @# p ?##p#tpt@-@-9!8HP L@*-8P#HL@ 4@@-;3a@L#H @ L50#h\#l;xh~lx#`#d`d@-@-㿠@  "@ @  @@o@o`2O @o;cx?`3 @˶ h* #`* #`@o@%< @ H&3/0cx-@ܒ?@o?@o@oO?@o @o㿠)M#`@#  @Q`* <"@  `@`"H`, ``@-0` @o @10` @oڐ  "@ N "@ @@ ;b7@o$9/"㿠@ 2 3p? @  b`@ J`@"" " 㿠@@C* >@ ;|Oc @;|/c    d@ 㻠@n @n $@ @)% @n /@n@@n@n@% @n /@@@n}@@@nz㻠@no @nk @$@@nk@%` @n\.@nW @ @@nR@ @nJ 2@ 㿠?w@@@6 @Kr6 6`K @J] 㿠?w@@@6`@Kd6`6K @J_㿠`@ `@ @ w4 30? &` /*⪪u@@`@KF7`@&`4`6K @J>@J'c`@#@;㿠w* ?` @ 1#@7 5&@㿐;0a<;c @| V@!`@  I9#y@ < wOk @m P  d@ 㻠@m @m $@ @)% @m /@m@@m@m@% @mr /@@@ml@@@mi㻠@m^ @mZ @$@@mZ@%` @mK.@mF @ @@mA@ @m9 2@ 㿠?w@@@6 @Ja6 6`K @IL 㿠?w@@@6`@JS6`6K @IN㿠`@ `@ @ w4 30? &` /*⪪u@@`@J57`@&`4`6K @I-@I㿠N @@%@1O` @-O``@)@5Y* <@"@5RO`* =` @O` A@?O`@5X?O` A@?-@5O?ɹ-.>` 2H.O`.```O`Oƀ%.㿠N .` ?`@+ b L@={TO @H.@H$ @H`N@/-)ⴒ % ( @@ / 9` `K/ K/  N/  NO'H/ 10'0!\t@l /       㿠N %@@4O`* :``"@ @4O`* = 4 2?,`< ; b `6 30?-=`㿠N  `@#9L "`%@ `@4L * =`"@@4L * >`2H  `2H  L 2OL @$. @HN @453N /Pb %<%@ @4ZN * 9` "@N @4SN * :`H N /` @ 2H/` /` = M@/`L/``N N  `2ON '@/`H10)0!!@k!㿠9|#`@# #@k@k@ O .@ d@ 㿠N @<@3* <`@O`-@+H/O` @"`@3}* =`2H  M -"H  +@ : M @ :@3j* > 2G M -G +O  :7` 3p?.>` 㿠 7` 3p?* |c * |c  " 㿠70@k@ O @@ 㿠@ &@@k :@ @`@n&&@e& 㿠O @%0 @kG@ "@(;0O`:2@$;0O` /@`O``/@` -0@kА@@N /@"@;090'@!@ /.;0a@v㿠@k@ @k 㿠N  @ @3 * ?` "@@3+N .N O* |c`@ &`` ;* & '@` ?)  @ #)  )  $㿈.#d#\8wϐ @  \ * <``f@d@N 2H. \`#`@,`@\#`'|@jQ@`%#hN [@hh@j2@'h@j !h@j ]@ D`˒* ? @ 9`N  @j@ 0`@+ߐO :@) @jl@@j| @@ 5?' M @2>* :` "@  -`@M .Ъ@@4@  (OM O `/@`  ;| @j=@@jM N;|c@`@   `;@    @j @@j0 ` N@  `?@    @j@@j ` N`@  ``#@  ` @i@@i N `H 0h @h#g* :`@  ` @Eϒ 0" @ג' ' ' (' ,@Β' @Ɛ*   ; @ʔ $ *  :@iĒ %@%-c M‥@@  @ `@A !@  @ `@ H @'  H`@' `H%@' %L‥`@@  @`@@`\2@`@E}\' ' @ ' `\@@h` `@`\@@h`d@d'  0"Ē@i#WTh㿠;0@<c` H/d`@'.`@ECD* =H'Đ@i0 :@* @i!@@p @C5|@h@h;|c@E@hݔ#р`@hؔ#ِd@hҔ#.`㿠@h /@ 90@E#&`@D &@&`@D`&`㿠  @  @hk   "@ @hd   @@h\ @㿠 @ @hQ /,@hK `"@ @hB ;,@h< `@ @h3 ?,@h0㿠@DS ˒/J @#*`;  xH %; dK@K`@ K` 2@)`)```)``K`` O퀡 %)`㿠 N @͒ /㿠@g    $9 L`@@DP& @gΐ /@gʐ@C@gĔ-@g-@&  "@ $@g $@@g@g @R & 㿠@g @D& 㿠@g $@D& $㿠@g @g @g   "@ @g  "@ @g  "@ (@g ( "@ ,@g| , @@gv@gt @gr $@gp@ggN`/@@"@9 "`J`/@@O"` @ @gh@/<+ @3@gL Ncs @70 @g@ؐ@ @gH@gU 90#Ԑ ̴@g/㿠  @@  /`?`";p  $@@ /`=" : @ $@&O/`@& @CG &   -` @"` Ҟ㿠. ?`@&  `@  .>";p @ $@ .= " : $&O.@& @C &   .  & 㿠@fȐ"@*``@  .=";p $@@ .= " : $@O.@&`@B`&```@f`&`v㿘' ̢̔ L`.= d@ `f@`@&@  * #`@f.@@fz@&@@N .@ 70N ܔ` .d@ d@&@d@@-&`;KѠ cр`"@ MM@.i `* ; "@  M @"H (OM` ,  @@ "@a  *  @@V&`  =#;p $@@ /`:#90 @$@O/`@' @B[ '  @9 @/ /N 㴠 %`M`@ @.* N 8`@ 2@/`/``  /`:  J@ /`I/``(ON   '@ "@ `,'0 @eߔ `%` @ @@@@` @@.\O`/``@.]O`/``  @@ *O`' 1@e% `  {/`㿠 ; /bT@f /@@"@``@ `@fO뀐h;wcxw>w@1`>>>`@>O>؀@QO>ဥ@`@ q /  O>؀@CO>ဥ`"HO>  |)`#O>@1`@ W / @( 1@e[ (@1 t`,o  @< 3 @ T + :f@,p8:080Yv`@ $ N``f@@/`ഀf@@  @e@ q@d@@ j@d[  @%  @@d耢@@d1`4g 1\c  1 t)@\ @dא@֐ /@dO>‣ @O?q`@O?@ O>؀ @?H`@ H@ * = @@ * ? `@ @  @@d㿠@e @@[L .@3L/"@M"@J.@%L /@H@$(@:L`/"@6$(@2L/2O$,2H)@ ,"@ ,H /"@ @L/O@ ,@ L /2O,,*OL2H,7` 3p?㿠 d@ @d@ @d㿠* =@@@@dN`@?@'@@2`@d@c.#@@di #@"@c"@@@ @c@c./@L'N``/@'@dS /"@N`/2@&@?@@cƔ@c”. @d6 /@2@N/2@  '@d( /O􀦠d@'@?ΐ` @@c@c.G /@ " @ @`O`:@`O/@ $@@? `@@cu /-?`"@@? `@@cd@c`.@?Ձ㿠 /|9|㬴#/`ې1`̀HȐ? ( @  `@   , @`  @!   @  :@c :2 2?@c@c@ `f@ `@8`30 @Y @1@c `@@@b @?(@b@b@b@b`@  :(``@b@b @(``@?@bҐ@bД@ [.@bƐ@bÔ ]-   @b@b @@  :. :@(2 N.#@H#?쀤@ ` (@`@b`@ `@ ,@"@ @b @@b?@b'8 (@b(>݀ 3` 2?*`: 㿠1@EaN @A`HEN %2@8.`@*N * < `@. %@*N * <`@' %N `2@N  A@?`A@*N ?ɀ`A@- @*Ӑ?ɷ- 1.`" "@   %.` .`  Ԓ@be(b`@b`(cN 㿘@:`@9%1N @(N`@#@@@*O@*O@ @N 2ON` N N N @ N`7` 3p? . > %1#10a<@b(N   d@ 㻠@aƐ @aÐ $@ @)% @a /@a@@a@a@% @a /@@@a@@@a㻠@a @a @$@@a@%` @a|.@aw @ @@ar@ @aj 2@ 㿠?w@@@6 @>6 6`K @=} 㿠?w@@@6`@>6`6K @=㿠`@ `@ @ w4 30? &` /*⪪u@@`@>f7`@&`4`6K @=^@=G㿘'@a 㿠@a 2 3p?` c @aI㿠;Oc`@ @`@97.O#㿠;Oc`@1 @a#/]Ѐ`5@>3^bЛ2`*0 @ `91@ 91ΐ!X7N㿠@ ;;191ad!h;Och  ;1@a @>2`91*0 @7@2 alܒ!|  @a @-`M`M`@ $@a-@} @M``@  $@aOM`-`M`㿠;1a;c Oc㿈@;1@a㿠@ ;;1aOc㽀. 7   s`/ @`B H2@[` s``@-`[` ` s`@-[`   ;sx @s`"sh2sps@`[2 [p[h [`[x`T@ `ss`shspsx@`[[`[h[p[xOۛ;s`sh@`[[`[h@@_ `#3shs`s@-[` `[h` [#@ :0?* #80`@-@-|@-w s`@-q[` `@-k@_ sxs`shsp@.%[`[h[p [xgg"@sx :0?s`* sh @sp80@-[`[h[p[xu 㿠@_ &  @$r !;1a@_ / %p;Obـ`@#@`>`3 5@ݐ11!@_p`@ ѐ91!@_d㿘@_Ȑ@`n;1aԐ@`k h@`i;1@`hȒa@_㿈@_H 0;3'c ߐ@_@`X@_;1aI l i ( @fc c L \`@@%}@_@_ #8 l`@_ @_ @_KX ܒԠX`f@  @_ !c@_|? @!( @   ! @_p? @O! !(@_g]?0r/M@!,_ @^ڐ@^ؐ@_9O#㿠;bĀ`@.  !1#<`# @c@_@^@^)'&@^"@^ Ā`@&Ȗ@_/]Ѐ`Ԙ@^@^@9 @^Ґ@ &@9א`   =* > 2@ @@^`$ 㿘;9@^ib31"11 * /#`@^`c@^\ #@^@% -1+@^ђ@_c 㿘?&`&&;1c@_c@!@^P @ @_X @ J a"@ &`k"H&u"H& @_D 2OJ `?"@  @ ?6 3p?.> 㿈;1'cw@_&@g @ @ @ @ @^N'   @_  O耦`@6@3"@1@]@% @]쀥 @耥`@@]ΐ  /" " @] P{@]@]@]@]"@@] "@@]`@@]㿈;b;2`@]ג@? '''''@<?@2?@.@2􀤿@61/ -#%P@;?@ T@;?2O93!P܀ d@Ԑ ϐ 2@DȐ ?@ @]<@] 㿠;aP`@ 9!P"@ @]82@ 㿠 +c"Ā`@3"`@ cx* < H*@' H/%2O`@ ?@' H,)2?'?' * =`H)12O``@ z* >H%92@8/`#2aa @\А 4Z @\ɐ O`!dS @\  !K @\ O`! C @\P;_bЀ` a3-@]yc)2?!#`#d4#\  @ @RH+@@]c1#h5@]?#`#dl#\  @  @;c ?#`ഐ #d #\7@Ԙ & -  @\d Ԑ㿠;c `"@ @\c@\"@@\ @@\  8;b;2 db@7 ?@ @@ @ @\x@92 "@]T㿠@'X;2/b+ _\$Y4XTÐ Oh\\@\TMcH@\ `@[ `@[ ` @[ `@[ `@[ 2 cL f@@/@[H`2`P@2@[֐2H\2T\`+0 -% #2@ G #\cX#h !h#l#`#d#p@\:@\# X\/2'_В|@)| /ݒ ڐ$8גLԒ\ђlΒ˒,8Ē  ΐ@[Ɛ@[|L/'X;3Mـ@` D _Xsp@\x[pؐ30 @ 5 [psp$@'[psp֐ [p `sp@\<[p30 @\n ?@ #\* :@[4آא%  @\. @9 `2`*0  sx/@RLXOLh|IF?<9I@[AO@+Mbڀ @[x#`#d`#hdh3 #\ܘ@Z@ZߐO㿘/3\`@ 0#`| d@3c ȐVbh;*<@ZOc㿐#\\_`73#`#h3 #d,* > 㿐#\\_`73#`#h3 #d8* >   d@ 㻠@Zj @Zg $@ @)% @Z^ /@ZX@@ZU@ZT@% @ZG /@@@ZA@@@Z>㻠@Z3 @Z/ @$@@Z/@%` @Z .@Z @ @@Z@ @Z 2@ 㿠?w@@@6 @766 6`K @6! 㿠?w@@@6`@7(6`6K @6#㿠`@ `@ @ w4 30? &` /*⪪u@@`@7 7`@&`4`6K @6@5㿠> ;c@  93"D: @Y;3b 1@Y㿠@6 J @ @"-/``O` O㿠&@@5`@Y/㿠@? N` @: ,   @ @5ݒ&``&@!N`* =`"@`@!N`* > 2O`N``N` O݀ ,,/`@5@&& 㿠'H  'L5'P73'T'X;@5a H@+?@@@ `@5`6@ ,@5S @Y@5Gؖ㿈'H'L'P'T@0'XH  @X@,%@ O@5   H@/  @@Xސ@X۔O .@4 * 㿠'D'H@Y{DH9H#$ @YՖH ;c$@X9@X;c$3b3cܞ㿠+93b`@##b`LԀ @L@|@ @@X@Y@(@@Y~@3@Yy#@Y@@@Yn@Y7Ԓ@Y1/@Y @Y@Yc@XV @XR 㿘'@X '@Y?@ @X^@Xk ;3c ʔh@X͐"@ -<)( @@3 Ncs@53@Xi@@3q@X2@X? ;3cА @Xh2 `/ > @Xh"@ ;<;6 3p?㿘;3@X:c@?   @X @5א2`*0 @s`@X.[` 30 㿐@Wؐ * # .`@WД .w@D2 * _=O@47㿠* .`? ?`@@@4%́㿠 .`?`@,@@W @@Wْ @@@W O@ "@&&@W@W{㿠%@X!@` ;9! a$f@@X㿘@W_ * #`@WN /6 3p?`O@`@ /`/@ @L@`/O/@/* =@@Xw!/@`O@`O耤`//@* =` @ @Xf!㿠@W /@@3@W'@   /@3A@W-@W[㿘@W * #`@V * #`N @ @ -`N O`-`N` @ @x`.N` O.@W㿠9"" @ `@V@ @W; /  f@ `@@@# * <`@  @ * =`5 2?, = @ @@ * ?`6 3p?.`>  㿠;b`@ @* = 2@ 􀥠@* >6 3p?`. = 㿠N `@! L" @`@C N``@>@@< N @)`N`@%"O "N @/ N` @+ @ؐ@N`@@ N @`N`@ @@N`"O N @ N``"@  `/7 3p?. .?`㿠;7v Ob5Ȯ( f@"@) J /4 2?@ܐ* :``@  @  * =`@   2OJ  3p?.`> 㿠N 9"`/ d@@ "* = 2@ `@* >6` 3p? -= 㿠@U@U.?`@` @ @UŒ2 2? -=@V2 3p?.>`㿠 @W.?`9@+"@eL* <`@@  ~ @0 @V @(   * =` 2@1   O* @<L* >@@ U  @U H  @ @Ue @U "@   O 㿠@U .@  @U /2@  㿠;3@Uc2 3p?㿠@/4 @U@14  @U{2@N `@  ;4@Uo` 2 3p?`/ >N `-@&N @"1@U#&@{ @1 h@U@ 1&    & #\@V ?@b&  "& @V  @ @0 h@UĐ@ &    & #\@U ?@?& &  @0ސ""& 6 =@.@0 & &@TԐ: ``;`  @& 6``2@ @T̐  @`"@& @0 & & @@T@T @T @T & 㿠 `@ @U @Tm@Tk @Ti㿠@ @ `@TZ` O`@TT㿠@`2@`2@ @T? @  ` @````O` `@  `O@ /`-@0R.@T@T㿠@  `"@   `"@   O  /`@0(.@0c'?&㿠|@ @0U;4`||㿐}}@ &``}2O㿐}p}v@ @S}o2O{L㿐}[}a@ @S@S}X2O㿠;cHN`2@#@7X &`@S~&4 @$&L@ `M` ,@&&&& .& &``6`.0  s`'3?ɒ@SR[` $   M  7. f@ & #`@ ` `` ;? # dp `0k I@ #`0;{0`` . g;>J 2 ;=!@k `"`@G؀`@  J`& `. O`f@f@Ͱ& &s``sh @S O`[h`[`f@f@&  @ -.?& ?P@$㿐6`.0 $` '9 %4〔(@~ #c 90 26 :0 d` @    O90  sh;#9#ap3} !xa/M-4〔, +#\hD#`#d ȗa`@~dc2` *0   :``z\ f10` "g:`8`H 2 ::`!@ `j` `` ;`{\ 2`` "g;`; J 2p 9`;` `k` `2o 2*p ` '  ( ` `  -h J 8 x;`;`2"``  08"gJ 2p 9 8# -h  - (`` ``0(`]d`8x1p` 8"gJ 2p 9 8" `0h `0(``h I `0)`@`28x2p`` 8zaI@30 :8#@0hd0(``hdJ d 9`y\2` 9`"gJ 0p ;`9`  0i`  0*``i` H !@  `0)  #`G8x1p` 8aӔI@2 :`8"  0h 0(``hK# ;`{\ 0 ` ;`zK 2 8;`"`0k`d`0) k`dHd#@:z 20``  :"gH 0p ;`:!@`0j `0) j K` " 0) Àab `a8x20` 86cJ1p :` 8! 0 #h 0 (``chJ 9`y\2p ` 9`ӔJ 2 8`9`# 0ic0) icJ!@9`y\30`  za9`J0p :`9` 0i`d0) i`dH`d!@ 9`y\0`  9`"gH@ 2p 89`" `0i` `0)  i` H !@ `0) _Ж"@ `{8x3p`` 8>-aI@ 2 ;` 8!0 a"h 0 a(``bh H@ 9`y\20` 9`6cH@ 2 9`;` 0 #i@ 0 ) i@ K !@9`y\3p`  !ӓ9`J@ 30 8`9`#@ 0ic0) icK#!@9`y\3p`  z9`K 0p :9`  0i`d 0) i`dH`d!@ 9`y\0 `  9`bgH@ 2 89`" 0i` 0) i` H !@ `0)   ဠ&%" `8x2 ` 8⃐I@ 20 :8!  0 И"@h  0(``Жb@h K@ 9`y\0`` 9`>-aH 3p : 9`"@  0abi@  0a) "i@H!@ 9`y\20`  69`cH 0p : 9`" 0 #i@ 0 ) i@ K !@9`y\2``  !ӓ9`J@ 30 89`"`0ic`0) icK#!@9`y\2``  z9`K 0 8`9`#@  0i`d 0) i`dHd!@9`y\3p `  9`bgH 0p :9`" 0i` 0) i` J !@ `0)   I}xa`8x2`` 8kI@ 20 :8!  0 &%"h  0 &%(``bh J 9`y\0`` 9`⃐H 20 :9` @  0Иb@i@  0) "@i@ K@ !@9`y\2``  >-9`aJ 3p 8 9`"`0ai@ `0a) bi@K!@ 9`y\0 `  69`H@ 30 9`:  0 ci@ 0 ) #i@ J@ !@9`y\2`  aӕ9`J2p 8`9`" 0ic0) icJc!@9`y\2`  z!9`J@ 0p ; 9` `0i`d`0) i`dH`d!@ 9`y\0``  9`gH@ 30 89`#@  0i`  0)  i` H !@ `0)  沈`Ɋ8x1p ` 8y#I@ 3p : 8! `0 }x!h `0 }x(``ah K@ 9`y\0` 9`"kH 3p 8`9`"`0&%i@ `0&%) bi@ H !@ 9`y\0p `  9`H 30 :9` @  0Аb@i@ 0) "@i@ J@ !@9`y\2``  >-9`aJ2p 8 9`" `0a⠛i@ `0a) bi@J!@ 9`y\0 `  69`㭐H@ 20 9`:  0 ci@  0 ) #i@ K@ !@9`y\2`  aӗ9`J 3p 8`9`"0ic0) icKc!@9`y\2`  z!9`K@ 0p : 9` `0i`d`0) i`dH`d!@9`y\0``  9`gH@ 20 89`"@  0i`  0)  i` H !@ `0)  ˀ %@)0 `]!8x10 ` 8. #I@ 2p ; 8! `0 沚"h `0 (``bhJ 9`y\0` 9`y#H2 :`9`" `0}xi@ `0}x) ai@H!@9`y\2p `  9`kH 20 8`9`"@  0&%bi@  0&%) "i@ H !@ 9`y\0p`  9`bH 2 ;`9` @0Дb@i@ 0) @i@ K !@9`y\3p `  >-9`aJ@ 30 8 9`#@  0abi@ 0a) "i@J!@ 9`y\0`  69`cH@2 9`:` 0 #i@ 0 ) i@ J !@9`y\2p`  !ӛ9`K@ 20 8`9`"@ 0ic0) icJ#!@9`y\2p`  z9`J 0p :9`  0i`d 0) i`dH`d!@ 9`y\0 `  9`bgH@2 89`# 0i` 0)  i` H !@ `0)  〠#n+p h ``)0$h  0(`"`@` `` 8?#dp@":`h J :`z\ 0p` :`. #H2 ; :`! `0 沚"j@ `0)`` 沂bj@H"@ 9`y\30` 9`y#H2 :`9`" `0}xi@ `0}x) ai@H!@9`y\2p `  9`kH 20 8`9`"@  0&%bi@  0&%) "i@ H !@ 9`y\0p`  9`bH 2 ;`9` @0Дb@i@ 0) @i@ H !@ 9`y\3p `  >-9`aH 2p ; 9`#@  0abi@ 0a) "i@H!@ 9`y\30`  69`cH0p : 9`# 0 #i@ 0 ) i@ H !@9`y\2``  !Ӈ9`H 3p : 9`"`0ic`0) icKc!@9`y\2``  z!9`K@ 20 8`9`"@ 0i`d0) i`dJ d!@9`y\2p`  9`gJ 0p :9`  0i`  0+  i` J` !@ `0)  䀠 5)D)p ``#n*0 h 0(`#`@` `` 8? dp#@)0h J )0j 0 `)`@ ` ``` :? @ dp"@:jJ" :z 0 ` :. #K3p 8`:! `0 沒"j `0)`` 沐bjH" 9`y\0p` 9`ycH30 ;`9`"0}xi@ 0}x) i@ H !@9`y\3p``  9`kH 2p : 9`#@ `0&%bi@`0&%) bi@ H !@ 9`y\20 `  9`bH2 :9`"  0И"@i@  0) "@i@ H !@9`y\2``  >-9`!H 3p 8` 9`" `0a⠓i@ `0a) bi@H!@ 9`y\0p`  69`㭐H 20 ; 9` @ 0 ci@ 0 ) i@ H !@ 9`y\30``  aӇ9`H 2 :`9`#`0ic`0) icJ!@ 9`y\30``  za9`J 2p : 9`#@ 0i`d0) i`dJ`d!@9`y\3p`  9`gJ@ 20 ; 9` `0i` `0)  i` K` !@ `0) ̀$a9c*)p `,+ph 0"`(`@ ```` 8? @ dp " #nh K #n*0 hk 0"`)`@ ` ``` ;0?#@ dp@")0k K@ # )0dk@0" )`` ` ` ;p?@#@dp": k@J#@: z2p` : . cH 2 ; : ! 0 沔"j 0)`` 沒bj H " 9`y\30`` 9`ycH 2 : 9`#@ 0}xai@ 0}x) i@H!@ 9`y\20 `  9`bkH 0p :`9`"  0&%"i@  0&%) "i@ H !@ 9`y\2p`  9`"H 3p :9`"@0Жb@i@ 0) @i@H!@ 9`y\2``  >-9`aH 20 ; 9`" `0ai@`0a) bi@ H !@ 9`y\30``  69`H2p : 9`#`0 #i@ `0 ) ci@ H !@9`y\2 `  !Ӈ9`H 2 8`9`"  0ic 0) icJ!@9`y\2 `  z!9`J 0p :`9`" 0i`d0) i`dH`d!@ 9`y\20`  9`bgH@ 2p :9`  0i`  0+  i` H !@ `0)  Z)p `4$a9c*)p `h K  0(` ( k`0 )` ` `` ;0?" dp@"#nkH@##n*0 h@  0"`)`@ ` ``` 8p?@#@ dp @)0h@ J @ )0j@`0" )`` ` ` :p?@ "@ dp " :j@J"@:z 0`` :. #K@0p :`:!0 沖"j 0)`` 沘bj H " 9`y\2p ` 9`y㉚H 3p 8`9`" 0}x!i@ 0}x) i@ H !@ 9`y\0p``  9`"kH 2 ; 9` @ `0&%bi@ `0&%) bi@H!@ 9`y\30``  9`bH 20 :9`# `0К"@i@ `0) b@i@H!@ 9`y\2`  >-9`!H 0p :` 9`"0ai@ 0a) ⠇i@ H !@ 9`y\2p `  69`H 30 ;` 9`"@ 0 ci@ 0 ) #i@ H !@ 9`y\3p``  aӇ9`H2 :9`#@ `0ic`0) icJ!@ 9`y\3p``  za9`J2 ; 9` @ 0i`d0) i`dJd!@ 9`y\0p`  9`"gJ 30 ;`9`  0i`  0*``i` K` !@ 0) c~)1+0 `$*  h`0(``!`@` `` 8? @dp"$a9hK@ $a9*+0 5)DjK@" *`0)  ]!i@K@n`0* !@ (%@i@K@*!@  i@K!@ )  9``0) y\ 0 2(` ` `. 9`㡚H 3p 8`9`"@0沔bi@ 0) i@ H !@ 9`y\0p `  y9`cH 2 ; 9` @  0}xai@ 0}x) !i@ H !@ 9`y\30``  9`bkH2p :9`# `0&%"i@ `0&%) bi@H!@9`y\2`  9`"H 0p : 9`" 0Ж@i@ 0) @i@ H !@ 9`y\20``  >-9`H 30 ;` 9`"`0a"i@ `0a) bi@ H !@ 9`y\3p``  69`#H 2 : 9`#@ `0 ci@`0 ) ci@H!@ 9`y\2 `  aӇ9`H20 :`9`"  0ic 0) icJ#!@ 9`y\2 `  za9`J2p :9`# 0i`d0) i`dJ`d!@ 9`y\30`  9`bgJ@2 :9` `0i` `0)  i` J !@ `0) : #@)p `<a~)1)0 ` h  0(`#`@` `` 8? @dp@!h J +0 @ j 0" )` ` ` ` :?"@ dp@"$a9jH@"$a9#*+p 5)Di@J*0) @ !@ i@J]!0n!@ +0 %@h i@J*!@ ) $ i@K@!@ 0) 9``0y\ 30* ``  . 9`#H 2 : 9`"@0沔bi@ 0) i@ H !@ 9`y\20``  y9`cH 30 ;`9`" `0}x!i@`0}x) ai@ H !@ 9`y\3p`  9`"kH2p :9`#@ 0&%bi@ 0&%)  i@H!@9`y\2 `  9`bH 20 8`9`"  0И@i@  0) "@i@ H !@ 9`y\0p``  >-9`H 3p : 9` @`0abi@ `0a) bi@ H !@ 9`y\2 `  69`cH 2 ; 9`"  0 i@ 0 ) #i@H!@ 9`y\30``  Ӈ9`H0p :`9`# `0ic`0) icHc!@ 9`y\30``  z9`H@2p :9`#@ 0i`d0) i`dJ`d!@ 9`y\3p`  9`"gJ@2 ; 9` 0i` 0)  i` K !@`0) ,h b+0@ `E @#a~+0@ `hK@*p `0(` )1 k@  0"`)`@` ``` ;p?@#@dp @k@ K #@+p  k `0")` ` `` ;0? @ dp@"@$a9k J #$a9c*+0 5)Di@J*p 0)  !@ i@J]! 0cn!@ +p %@( i@J*p!@ ) d i@K!@  0) 9` 0y\ 3p* ` . 9`cH 20 :9`"`0沒i@ `0) bi@ H !@ 9`y\2``  y9`H 3p ; 9`"`0}xi@`0}x) ai@ H !@ 9`y\30 `  9`kH2 :`9`#  0&%"i@ 0&%) "i@ H !@9`y\2p``  9`"H2 8`9`"@ `0Кb@i@ `0) b@i@ H !@9`y\0p`  >-9`aH 30 : 9` @ 0abi@ 0a) i@ H !@ 9`y\20`  69`cH 2p ;` 9`" 0 #i@ 0 ) i@H!@ 9`y\3p `  !Ӈ9`H 0p :9`#@  0ic 0) icHc!@ 9`y\3p `  z!9`H@ 2 :`9`# 0i`d0) i`dJd!@ 9`y\30`  9`gJ2p ;`9`  0i`  0)  i` K` !@`0) x-)ⳛ)p  `Oa~,h b+p@ #hK 0 (`)0@ `jJ0)`)1*p "  `j `0# )`` ` ` :0?#dp!j K@ "*  k@ 0"`)`@` ``` ;p?@"@dp@ @$a9k@ K #@$a9c** 5)Di@J(p 0)  !@ i@J]! 0cn!@ +p %@ i@J(p!@ ) d i@J!@  0) 9`0y\ 3p+ `  . 9`cH 20 ; 9`"@ `0沂bi@`0) bi@ H !@ 9`y\30`  y9`cH3p :9`#0}x!i@ 0}x) i@ H !@9`y\2 `  9`"kH 2p 8`9`"  0&%i@ 0&%) "i@ H !@ 9`y\0p``  9`H30 :9` @ `0Кb@i@ `0) b@i@ J !@9`y\2``  >-9`aJ 20 8 9`" `0a⠓i@ `0a) bi@K@!@ 9`y\0 `  69`㭚H@ 3p 9`:  0 #i@  0 ) #i@ J@ !@9`y\2`  !ӗ9`J 2p 8`9`" 0ic0) icJc!@9`y\2`  z!9`J@ 0p ;`9`  0i`d 0) i`dH`d!@ 9`y\0 `  9`gH@ 3p 89`"  0i`  0) i` H !@ `0)  Z x-)b`+p h K  0,h(` b+0 @j H@ `0#)`(p"  `jI 0)`)1*p " `k 0"`)`@` ``` ;0?"dp"@k K@ #+0  k@`0)`` `@` `` ;p?@"@@dp@"$a9k@J#@ $a9c*+0 5)Di@J*00)  !@i@J]!0#n!@+p %@( i@J*0!@) d i@K!@0) 9` 0y\ 3p* ` . 9`cH 2 :9` @  0沐bi@ 0) "i@ H !@ 9`y\2``  y9`cH3p ; 9`" `0}xi@ `0}x) ai@H!@9`y\30`  9`kH 0p : 9`# 0&%"i@ 0&%)  i@ H !@ 9`y\20``  9`"H 2 :`9`"`0К"@i@ `0) b@i@ H !@ 9`y\2p``  >-9`!H 30 : 9`"@ `0abi@`0a) bi@H!@ 9`y\2`  69`cH20 ;` 9`" 0 i@ 0 ) i@ H@ !@9`y\3p `  ӓ9`J@ 0p 89`#@ 0ic 0) icHc!@9`y\3p `  z9`H@ 0 : 9`# 0i`d0) i`dHd!@9`y\30`  9`bgH20 ;`9`"  0i`  0*i` K !@  `0) @*  * 㿠;c6`c.0 .'.`^2 UU9 J@ 20 9 = $, $@!&*0 J2` *pf@2p 㿘;b``@9 @C `h@C6@ 㿠-@`@ @C @C@C %$@@C& @ @ : &dp%: `.H; _@"㿠;`@`@ @B @CǸ@CȐ 7&@@CɁ㿠 H?;c@C9474 4D@B'k;A.x'D 'H;3DH;`@Bd `cB#l'lĕ FJ#hh@ '' @C 㿐 @BF  @C 㿘'D4'H'L'PDH B;`P 3LP+\K\c@C #@Co @  @C  +\K\`dL@P@B  @B @B" +\K\AeP'D;4'HaxDHB'ĕ FJ'@C>@@A @''@C/@@A "O   @ഄ `* `";` : K20 @; ;`" `@m i`Ni h  `` @; K@)?  ;` *  K)?  :  *  K)?  ?K)? : K)?  :  *  K)?  :  *  K)?  ?K)?i c : K)?  :  *  K)?  :  *  K)?  ?K)? : K)?  :  *  K)?  :  *  K)?  ?KO)?@@ `8`J) ` `;` +`J)  ` `;` +`J)  ``@ `?H@)  (O `UU:`>K@ 0 @:`8`#(#@"@`@`"H `%) `8`H ) ` )`K@  =) ) )  ) 8`J ) ` `;`*` =J )  ` `+`H ) ) )  ! 㿠9 N ` @ S* ;  G@w=@s@qN @mN ` @ >* <`2ON "@b?=@Z@XL`@T- (` 5/``N  @ "* :``2ON "@F?@)=M@%="H&N *4`/``N  @ * =2ON `"@*? =G 2@%?M&@!?@/``N 2@?N  @* ;` 2ON "@ ? ="ON ???'@㿠@ @8 @ 34@8K @@8C@9 ``@@Ȗ@@H 㿠  @Nc @ @9 " @8  @U5@8@p34` @@ 㿠@r#\7 @>\@*7 6K 46I4`@H@@@@?@`O@#7 4`6 H@?Ҕ`O݉464``J 4K @@?Ĕ@(O`8H\7 64`JJ@@ @?@O@\56K@ @?O㿘@6`6&`K /`  * #`v@#fffff?ffffff?PbM?@bM㿀'D;694'Hc@7c@ DH™B p #x#| x@kp| @ #p#t p@kct P #h#l h@kVl ` #`#d `@kId @?㿠;4@`В嗐3@?3a(@?4" M f@@@z@)@?( @M @@?!@@?v /@- "G- /`@>@?  "@ @? @>  d@ 㻠@>ܐ @>ِ $@ @)% @>Д /@>ʔ@@>ǐ@>@% @> /@@@>@@@>㻠@> @> @$@@>@%` @>.@> @ @@>@ @> 2@ 㿠?w@@@6 @6 6`K @ 㿠?w@@@6`@6`6K @㿠`@ `@ @ w4 30? &` /*⪪u@@`@|7`@&`4`6K @t@]      HHHHH00@@@H@ H@@@HHH88HH@ @@HH  H@@HHH@0HH(H8H8 ; @* @ @         㿠@ 7} @@@9}'! }a   d@   d@ 㻠@= @= $@ @)% @= /@=@@=@=@% @= /@@@=@@@=㻠@=~ @=z @$@@=z@%` @=k.@=f @ @@=a@ @=Y 2@ 㿠?w@@@6 @6 6`K @l 㿠?w@@@6`@s6`6K @n㿠`@ `@ @ w4 30? &` /*⪪u@@`@U7`@&`4`6K @M@6  d@ 㻠@< @< $@ @)% @< /@<@@<@<@% @<ה /@@@<є@@@<ΐ㻠@<Ð @< @$@@<@%` @<.@< @ @@<@ @< 2@ 㿠?w@@@6 @6 6`K @ 㿠?w@@@6`@6`6K @㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K @@{:`  `!@ @ ; +  "@  @ +`  #@ *`?2; 㿀.   @<; @<+   ה  ?O .888-}(`/ʔ * D@@< N @ N @ N   `d@ .  * @; M``@ @M` @ @M`  d@ @ -@  * @;֔ L `@ L @ L   `d@ , !o * @@; M`@ @M` @ @M`  `d@@ -@  ,Q * @; M@ M`@ M  `d@ - 73 * 9@;{ ,O#s@@Ð;4<b d@d@;e@ϐ@;_@ɐT@BTTL\@'TLX`@'X@;M  @?@@ @(T\'TX`@'X@;4 ?O9 D 㿠@Ѐ@N  t9 O@@.9`!t@N  ސ *?  `I@@,  Ґ `=  H@.`@m`N Ő  + = J@@. @QN   *`= H@- `< L@x. @+N   *`? H@f- `M@@^.@ZN  | > M.O`o ,`at J 6e + t O@#[ %+t K@Q /`t`K @#,  =@,   =@. =@- =@- =@ - =`@-.@.㿠`3337`͖K 2 7 .`@& @:;@&'`㿠.08;:08 aN 4H.`> " 㿠 `2@`& `&`@&@ @:{ `@  &` &@&O @   & - `@(OO &`  &㿠`*@  N * =` "@ N * ; "H  @a  L@H) 8/``$&N  =@ N `=@N =@N `=@N =@ &N `=4 2p? .>& d* ; "@&N \* ;`"@&"@N T Q NN@ ML@**`8@/``% &N  =@N =2@&N  =@ &N  =4 3p? .> #* = 2@& `"@N   MJ@*9`/`` `&N =@N `=@ &N =6 2?`, <` * ;`"@G&N * = "@?&`"@N  ߐ ܐO N@I@+ *@ 9 /``%&N  =@Ő* ;`2@& @ O N@. /``% &&   㿘'D6 P'H 'L3p?L'P`H'T '@   LD 10?-8 @*@"HLʖ* <@H`'HL# 'L* = 2OHL @dHL"H PHL @@VP%`!@ 'P@M'HL)DHK` @`@ H'HL `'LP%'"@ 'PHL"LP%#'P@'HLLHLD@1L@L@2HL'LL[* = @H%'L'LT` &`L 3p? -> 㿘66@@8'@& A* =` @ @8& @'  2 #`3p? ?ߚ?Л3`2#` 30?"`1p?(:  ?ߘ3 "2?  3`2 30? 1p? (`:  ? 3`2 30? 1p? (`: ?Й3`# 2??3`# 2??ߙ3`# ^2??3`# _2??Ж ?ߛ3`?ߘ#` 0`30?#`^230?"`1p? 2p?`0 0p?`+ : "  +@ 1   0p? 1p? @+ : ?3`# 2? ?ߚ?Л3`2#` 30?"`1p?(: ?` e ?`?e " H;j" &.  c" #" `v" " " 㿠'DH'H@7Q 㿠 ;?c7 /` / 7 @ 3  , @+ 3   ސ` 0`@0`)`(`@Ґ` 7 - / 7 @Ɛ` 㿠    8& e@@& & 7?*  3 -* 3@ & ,`#"`+$   * 1`7`@/`7`( "@6b.@ 5 @6ߐ H@d ld  &@7p@ @ @7O @7C@ @6 @@@6 @hո :dd@d㿠 @! $46`#@;0 @ @6&`@@ @?  ?&@6t&@`@ @ @`@@&`@@6g @ @ @@&`@O `@`?`H@@6M`@ @  @'`@@ \@6B&㿈'L#d6`#\ #`&4` 0?@&):/5ک :1x#p##h#V#l-? \.`,p4@@@ 4 `@* 2  .* @6 l @ @6 )` 1`@(+ 0@ @  0 ۊ @ * 2  10os.* @6 @"6  @+`3`  .@( 6  @6 @ #=_c(0.@. @6 @@ 6  '** 2 @.( 6 @ 6@+* b@ . 6  @*`*2` @ 2`@ /?Q@  * 2 @ -`+5`   5` @@ `&`ت -`5` $ @ -`+5` @@ 5`  '"= (@ . 6 ,+ @4@@  4 ?֦㱘@ ,+ 3  , (4  4@@"W5@. 6   0 ,(4   4 @ a"(0 @  4@(`. 0`0`  @?fᓰ. 6  @  8@+(`0` @ 0` )P#@. 6   < @@ +. @3@ 3@ @1m !. 6   =@b@+3@ @ 10,#@. 6   @1 "Q+3  @1:m#. 6   5Ě@]@+3@ @ 1 S. 6   @6(y⁞+3  @19#Ȱ. 6    @1xs!@+3@ @ 10#ְ. 6   @=5Cᇞ+3  @1V . 6   *x@@+3@ @ 1?;#. 6   @ٞ+3  @1#J . 6    1?@!B@. 6 @ @  1!}". 6    1gX!". 6    1?yN . 6    1)/@"D@. 6 @ @  1#. 6    1=Ҙ#`. 6    1/ p. 6    1 &ߚ@"ư@. 6 @ @  1:I#. 6    15;̘ . 6    1"!. 6     16u4@ 9@. 6 @ @  19!. 6    1蟘 . 6    11+"e. 6  2 @= HbD+`3`@ 6@  ʿ㗞@+ 3 2 @ *#+`3` 3?$9 7Vֱ+ 3 â@4@  @@@ .6@4@#3@. 6 @ 6 ?}@ . 6 @ 2 @#!aaі*2 @@ 4@'O-`5`4 @@5?9- 5@6(P@+`3`3@@#a@+3   4@@@'=߂ₘ+ 3 4 @@5/N50(   @`5@@#`@@ 3`+` 2h@ \@ @ #\2 *  d*Ov L\"""`" " H;j" &.  0c" #" " `v" " " 㿠'DH'H@2l 㿠 ` ` `  ` 㿠    `8  & e@ @&& -&2 * % @  ,# !,#` @27"ԓ.@Ɂ 5 @22 H@` `  &@2Ö@ @ @2O @2@ @2  @@@2 @hո o``@`㿠 @! $ 46`#@;0 @ @1ٔ&`@@ @?  ?&@1ǐ&@`@ @ @`@@ &`@@1 @ @ @@&`@O `@`?`H @@1`@ @  @'`@@ `@1&'6`' ''' ''@&3 !3p?&@' 2z-#?a'a֨c#\ܮ #``@'  @'!@`* @@@# ``@m`m` `%%%O%@ `%`$O`̠`  `  $??$??$??O$?̚2 ę*ȘК԰@ ܔ@`.63+@ @ @*2 0(@ @ + 31  ) @ @  ( 0.6@ @)  1 2 *@. 60( *@2@ 6 .@ؚ@@(0. 6 @ .63 +@.  6 1 )  +@ 3@6  . @  @)  1 3+@@.  6 1  ) @  @+ 30(@  @)  1 3 + @@( 0@@(0  3+  @ + 3   @) 1  6. @    +3@* 2 3 +    @  . 6@+3@6 .     @ @3 + @@3`+`@ 3+ @  @ؙ.  6 @. 6  +`3`  + 33@++ 3 @  +`3`@ ؒ@@@. 6 @2`*` @   + 3 @ +33`+` @   *`2` +32* @   +` 3` @@+3@2* @  * 2@ @+3@3 +   @ *@ 2 @+@3@@2`*`  @  +  3  @+3@@0( @ @   *`2`@ +33`+`    ( 03+2*@  +`3` @@+3@3 +  @  *@ 2@ +32`*`    + 3  +@32* @   *` 2` @@3+@6.   @*@2@ @+3@6.  @  . 6@@+3@3 +  @  . 6 @+33`+` + 3  3+2*@  +`3`@ +3@#h  @.6@h@*2@  * 2  @. 6 .@6+ 3 @ *2@@@ h. @6 @6  . @ @+ 3 @@*2@  *2  @. 6 + 3  6 .  *2. 6 @@ 6 @.  #d+`3`*2 *2@  @ (`0` h+` 3` @ 3`+`@  + 3  (`0` @ 3+ (0 + 3 @   6 @. @ ) @1 @ @@(0@. 6  @ @+ 3   @) @1 @@ 6 .  @*2@ + 3 @@ .  6 @@ @*2@ h d*@2 @ 6  .  @ @(0@@*@2@ 2* +`3`(@@@0 1`@)` @@@@*2@@+`3`@ 3`+` @@* 2@@*@2@ 2*  @+`3`*2@  @2@ * @@@*2+`@3`@ d@@+`3`@*2@*  @2@ @. 6 (` 0` d*2 +30(@@(`@0`@ . 6 2*@(@0 @. 6 '5-*2 @. 6  '0( -@@5 * 2 'ı0`(`@(@0@@ . 6  'ȱ5-@ (`0` @ @. 6 @'̱0(@@@-5 . 6  'б0`(` @(@0 @ . 6 'Ա5-@(`0`(`0`@@ 'ر5--5@  . 6 @'ܱ7 / @@@@-@5@ @-@5@@'5`-`@@@/ 7 . 6 /`'7`@-`5`5@-@/ @'7 @/`@7`@@-@5-'5@ / 7 @+`3`, @4 @ ' -5@@ ) 1 ( 0@'+`@3`@@ 7  / @ (`0`@'\') %1 @@'%@ '%@ '%  '% O  㿠?w@@@6 @6 6`K @z 㿠?w@@@6`@6`6K @|㿠`@ `@ @ w4 30? &` /*⪪u@@`@c7`@&`4`6K @[@D  d@ 㻠@+ @+ $@ @)% @* /@*@@*@*@% @* /@@@*ߔ@@@*ܐ㻠@*ѐ @*͐ @$@@*@%` @*.@* @ @@*@ @* 2@㿠@*; adf@@  0@*"  adf@` adf@#` ad `f@ ` 2` ?0`@+ ! add@  # 㿠 ad d@`@ & @& (& ,@*e& (pԺcX ,@ O& H'А@+ 0@*Q'Н㿠@fg;49@ebx@!,N  ``d@/4@e}@ N  `d@`  d@T@4ppp                         t    D D t         㾸)#l  #h#L'X`#p`#h1`'T 10?`-`< #x@*/   'T#t ^  'T #t r##t  #|##p#t #|##iX  `5 0p?@ #t44'`'dt`@  `O` @  `l@h.J 2Ol d##|@) #5X` 1p?@#t   l@ "h.  4# b#|#X 5 2p? @#t  #l`@ 'h+# '4#| #@ pL @e\## L@]\L##t`#T0 #1p? X5@5 30? 10? ' 'Ԯ \ 0#0` "# aa#3? '#@@'Т'ؤ?0'̄ 0?' ?p?#Ѐ@ %O @ @ @(p@@@ O |@(@ O t`@ O  ~`@Ӄ-`@@%t@l @@h.:@ 0pO@Ѐ` 8@ 0l@h.l@ h/ 0܀2H@ "H t @ @@|pO@?@xp/LL"`!@q*@t @ `l@h.l@ @`h)@ l @ h*l@ @`h/@L a  b f n` r` t` v @ ؀2@Hl`@e@' 4t@pM`"H@ @`@K`@ t`@Bl@h.l @h. l:@h,x@   @ W 3?\ @'  @ @'~p&p%@@ @?@<@)`@@ pI@ ``@ "`[@`^@```@`|@` *Op@( d@@(耐"O@ N @ @ pMO 8H @ @t @`@ l@ h.@l@h.pO@` 뀦`t@J @/l @h. l @h? `0.l@ @? h 0+@@`l @ h0.pO@` l 0 Ol`@ l@ h. @Al@h.pO@` 뀦`@U`@@ l @ h.@&l@h.pO@` 뀦` @ 7  32@t`@ t`@)l@h.l@h.@ #pO@@`2Op@@2OЀ@T2@|t#`"H|X`d#`#d#\hlp|@t@|K @l @h.|`#|M`2Oll@h,@X##|# `4 20?#t@&= T㿘; adf@@&=` #\`(#``,#d``@&."   @㿘;adf@@&``(   `#``,#\#d`d@ ߐ`(#``,#\#d`r@%@" % &㿠;aDaD` `@  /``@%``@ O/`) d@`-@%ͮ!&`d&`@ @%Ő`&` &`㿘@%̺9 `!PH^!P?@)`?1@#0 0p?+@;`@`@ -@ؐ ?% " ?" ?@ΐ% ?*% @ *@% %?/`(@#`,#\#d@ +`d@$@%oP$(#`,#\#d@%m" @%_?ad?ad    pА#@0w?pА#@0j        p.8;:p8adԮ ,O& А E*` ?: : :ޞ?@padԮ ,@O&rА          ڞaT   ? ;<@%6h2  2?; 6 3p?` -`> 㿠/ @?`N @ 4@$2 #;p 944b 94`@"@P@ ̐* 8`@ "@  * 9 @# @`* :``@` `@$m`,@ `4* :@`<@$\ " ?@$A@$N`/@ `@ @  @$43@H@$= " ? @$$3aD@$w 㿠?w@@@6 @M6 6`K @8 㿠?w@@@6`@?6`6K @:㿠`@ `@ @ w4 30? &` /*⪪u@@`@!7`@&`4`6K @@㿠@#ڐ@ @@㿠@ H@# @$e@$b@@ 㿠Ԑ @# 㿠?w @ @%@`@@㿠@#㿠@#  㿠?w@@@6 @6 6`K  㿠?w@@@6`@6`6K 㿠`@ `@ @ w4 30? &` /*⪪u@@`@7`@&`4`6K i  d@ 㻠@#- @#* $@ @)% @#! /@#@@#@#@% @#  /@@@#@@@#㻠@" @" @$@@"@%` @".@"ޔ @ @@"ِ@ @"ѐ 2@㿠;94a;4"b@T @"Ł㿠 @$% 4H㿠;@#`@ @;`@#o㿠@" 4b974d@ @#㿠;7`@#{　``@&  @'   ' -@#D @ @# @"c㿠'P'T'X;c`@-@ P97!</4@"גP㿠'X;c`@@ ` @,`@"S@''`'`c @!# '%<#4@"c$/-XP) f@@"X㿠 `@@#@"  @#~ 2`*0 `  @   @  '@?  2 @#d  d@ 㻠@!ߐ @!ܐ $@ @)% @!Ӕ /@!͔@@!ʐ@!@% @! /@@@!@@@!㻠@! @! @$@@!@%` @!.@! @ @@!@ @! 2@@"  @_   d@ 㻠@!\ @!Y $@ @)% @!P /@!J@@!G@!F@% @!9 /@@@!3@@@!0㻠@!% @!! @$@@!!@%` @!.@!  @ @@!@ @! 2@㿠`$`` @}@{-.&%@=`@1!`.` @#`lm    %?$?%?$?%?$?%?O$ @    %  $$O &&Oʀ``$` 8& @-?` @'`l`l ``$$$$$$$O$@ ` $$``$O O.``$` &&`$&` 㿠&& &$@ /4@!((2 2?&N `-@ & `+@5&  3p?`&㿐 @?\#\74#`8$ @` @\J -@ +H :\ #\K  : $\`#\ $J :d@"@ $J @2Hd$ $@ $$  $@$  `@@ @ @2H$ @@+`H -2@`H`@`$@O+`$$@@ϧ+`@@2@$  $@@@Ӓ$$$ $$$ @-@J-2@J @@O -1 0p? @$,@H -@!`@AH@\@ 2@9?#d J@ =2H @   ?#d J @  =@ L`@`=2O @~ `$  H@ݔ2@ @` @c`@#d @^ "  "   2O,@2@! @C @F`2@ #d `@  `@ ` "@ @3 "  "   2O@/`@'' *@ `@` 4@2O@ @$`$$ ?@ #d@ 2O`@``$L"@%`` @@$ `@(`@L -@`` <@XL l`@Q@$` $ ?`@ @H ``$*`@$ @ ``@6@ : ?@$` $\M`:d@ @@$`@`d% `"@` ` $ @`)`@H-@ `L@\2@#`@!/`@N -@` @!N  !@$!\$$ ?$`$J`\@ΒN @ $@1%:`@/`J J `W@ ;@@N "@$ $$@`@! `@$ ? :\N`:d@$,@$ $N @=@  N @ =2O  @ ` @ `@.   @y& 2@@&@M2@@2@  @ 2@   "@  2O  @M& 2@@& @!2@  2O@`@!L` @:@$@$ ?@MN `"@ @` 0$ @!p`@@$ ?`2@ $ @ ``$(`@$ @!`@@y ? :$\N :d@@l$`@`'  "@_  &  $ W :@UJ :2@N N `"@ $ $ $$$`"@$ `$$@@`@ :`!̐@$ ?\O` :d@ $$.@$$ `@!`@$ ?`2@?/``$@$   $@2H$?㿘7መ;a;\a#\/+'a%$#`%$ %c㿠 #\  ٚ 㿠#\Κ 㿘#\#` 㿠#\ 㿘#\#`h @@X;5a0;5@ߒa<@3-c@  @@ ܀@ ܘ  `O#  ?'@l`@܉2  0?(`=@@6Ȓ  @l ``@ @`,``L @ @ , @$   `$ .`@@2`@` @㿠;@a &  &  &  &  &  &  &  $&  & J ). $J *. %J .. &J +. 'J ,. (J /. )J -. * & ,J (. 0J *. 1J .. 2J +. 3J ,. 4J /. 5J -. 6㿘@!5d@ @U !@ 2@.  3bd@@H@#(@1? ?? @["@%?@ ` O? @&  d@@@"?@  @& `d@   @W2`   `+  "2`   `+ * "2` `  2 )`:   @? @ @z   ; " :" ;`"   ; " :   9`" 8" 8" " "  : " &@$```    `@#`  #``#` ` `` #`  #`@#`  #`` #` ``` #` @#` @ #` #`  ```@#` @ #` #` ` #`"  : " &@$``  ` @`  #`  #``#` ` `` #`  #` @#`  #`` #` ` #` @#` `` ` @ #` #`  @#` ``` @ #`  #`  #` ``@   ,`@@  +`@` @ O+`  ``2@   *`  㿠\4\/`>e@6#@: @ @@q@`& T X2` . ^ [@ @& \ 4@ & , & ,& 0 㿠 @k d/ >`@r@ @@"@ [ [`@  @!& `\@@I@) 0@$ ,`\ 4@- @O@ `\@@X  "@ 4@ΐ & ,& 0 㿠 ``@7@.`  @2@&   "@  [@2@&   [`"@ & 4 @2@&  & 4 + "9`"P2*X0 "< "@10?20? *[`\"` `X1 *Y `X"H3` *Z"D@ @ 46`, 8p @ö`???&`'`'`'`'` '`$'`P`"@%`(```$@$(@!  `(``P ` @+(``6@ ` O` @ @ @2@-`4`@ :H`(&`&`&`&`&` &`$g&`,`(`'`P@  '&`&`&`&`&` &`$ `".#@B%@`&H`5`4`6#@30?"H`@@ `.  *O`)@&?>#@=@ "@2?% `  @ .@ ` #O@ `#$O` OJ&&`,&`0( @ 4 Z5# ,;0 @ @ P@ \@쀤@!  (??#? @@@%@@8@%@ ( @S *   -!@ ' ' ' ' ' $' ( @ @l@3@  (   @ @'@S2@ @ % -" @"`&H 265#@ 30? "H @  - %*O i@f?= $="@ %2?`     -@  # O@  # $O A@%@ 4 @@ @ ( @  `*-  @)' ' ' ' ' ' $' , (   `-- "@' ' ' ' ' ' $*O& (' ,' 0  0:@8' ,5 #` #\???%@ ' ' ' ' ' $' P`"@! ( ` $@ (@   ( @ P (` ` 6@ ` O @ `@@<@ @ \@4@RÒ@ @ \"@  4 @ 2@  \@*`' 2H \ @<@8 @.44" 2?`"@) @-?   `@ #  #@  @  O"   @  %@  $O  \  -`"@`@*O \/ \ @= ,  !@ @d#@ @N6 4!@2p?`"@I  @X?  &@-0$ 6  ) ! {@  &@ 0"x @%@  ` 3 "{L  @#   O" @06 #xL) "  $O0& 0&6 #@ )  {"  # O0& @ D@' @@2 H' H 4"@ ;p @ ' ' ' ' ' ' $' ,@@ \ @M@K@564#@2p? "@0 @@  `@ #+ " % `    !@  "@ O @ +     `O+  , `@@ "` (``@`"  O(` , &"@" &H 2 44 "@ `2?@"H @  , &*O {@x??%&@ >`< #@ 3?` @, @   #@O@   #@$O S@.@ 4 @ @ (  P@ `@  @),  \ @ & #@2' ' ' ' ' ' $'' , (  P@ @ @  (,  \ @ " "' ' ' ' ' ' $ Oؔ%@' ,' 0 㿀 ( 0 @?<& < ? #' ' ' ' ' $' "@ @ @@     & & & & & & $*O <&㿠 @ 46# ;0 @  ,@@5a (  P  2H  `"@ @ -`-`@*O (& ,& 0 @ 4 ! ,: @ @ @e#@`&H (3`0"@  0?@ "H (@@  ( @ P   @ * *O (H" ,@E?"@@89 @ 1p?`   ! ``@% (!  @  P  @ *  (  P  ` *@ ( @  P @   @@ O* @@ (@   P   @)@  $O (" ," 0x (@&@` ``@   @ٔ ' ( ' ,`f@' 0' L/ \ < D' @ [' H@  ' `@ 0@:@ , \@  , 5- @@*Oe@ %@N ,' L@@*@(-  @#,` !@@b(`  ,@]& , 0' ,%@r' 0  * ,  !@& ,*O c [ <$@ D ' @ ' H@/ \, @ @$,@"O@  -@@  O-@ ' ,' 06 [ -' ,"@.' 0@ ?)   & , @ )   "@ , O)  @*  ,' 0 [$`@ϔ `' L@,`  , %@* [`"@ , , #@ , 0%@' ,$' 0 [ \@ $@/ \ < D' @' H `' ,@ƈ?' Y@w  ( `4 $@@@$3`" : $ @f @% :O [ @ P@'@`@37`!`8  @+%@k~k~# `#` P + ` P + ` P @+ ` PO+@  ` P#` +#6O `ܒ @ ؖܠ$@?? @ ?  @ &' ,'?2H ^"' ,?@%`@' L , ^`@ @2@  _@  ' L @ ]@ ' L ' L ,@@ ?- % , @ -  @ , O- [@ @6  ,' 0! [  P'` @ ' 0 @ T * :@  ' L @ ]@ ' L ' L [`2@' ( ' ' ( @ H `$' @&@' H $@ [ X@ @!' 8`"@' , X"@ Pj' 8@' 8  [`2@ 8 8 @   `@@  +`?@ ` ,@ (?2@ \  @ \@+`  (  @   @  (   㿠 [`2@  \ 8 & 8"@+ 8 8 ,@@*` 2@   8 & 8   ( @ @  8 & 8  8& 8` ( & 8@㿠@[ @Y  [`@ @R㿠*@ @ L@ @  f@ ` @..` @?&`@@.`@O&` ^ L ^@ ` @2@) `_@ ` @   ] @    Tv* >@  @ ]`@  㿠&  & @.`&  d@㿠 & & @ @& & &  "  㿠 & @א @&  @@ & '`6 & 6`#@;0  '`& &  㿠`& ` @& @.@& & &  `.@` @  㿠`@@   @@- @32@&   & `!  ,` ?-``* @ *@ "%`-`@ *O %  O*  @ :@%@ $`@ @ ,`8O$`"H%`%-%`& @ @" *O  `!@%  @%& ' @!*?@ (  @*&"" **O -(`@ `- & O@ -(`@  㿠@g@c`"@_` @Z& @-`@&  @+ `@'    `@@@,`'`, @d@ ,`' ,`d@ .@ `  *O@ `@,``,% $@@-`@&  %.+,`@$@@&  `@` @ @  㿠"@ `@-`  @@- @' - 2@&   & @ -` & /`@j %` @= @+,`?.` @@ @ :@&`'`$`/`@#@,`*O  -!"$`@@,`&`@*O.` ? / @" ? `@/`@@,.` ." !@"@' & -`?, @ @ @ *%`$@"-`2O  $, $@ O /`@(  㿠 @ 2 3p?/ = 2@  `& @ .&.@2@& `@@Q @h H $6  H$ @$-@. '@O$R. >  ?1p??  @. @& -`?@, '@? #@'@?O@ & *`@'@?O& . & *@@. . '@ "*@@ . '@  "*@ 8O. . '@`& 㿠  @ -`& -`@ 2@&    /  & & @ @ ``@ ?:@ `?`* @@ 2@  "  O*    # *@   `@  2 *2`#xx O ) @  d@  @ @@ @@ "  `)` +`"  @ *O 㿠  @ @5-`)UU!U@,?# *@2@& ? ,@{ @w @s @o`"@[?"@X?"@U? "@R?& & & & &  +` ?`& #-%@`$ `$  , $@*`@(@ 3 \ >`# 2?  7   3p?`/  ?'@/` .-,   ,#  + #@ *@  @    )`") @w  &    @G @51 #" 0?`"@/ ? ` @`# ```` j@ @@O  @@ ` ` $O` `*`@`@@ *``@@ O*`㿠`@&   `D` + #@ *@@@  , @@ * =@ *O@@ & 㿠`@&  u`D` )`"@) @@ ,` 2@`45` 4 2@ `(z* =@`@*O@Ӗ@ & 㿠&```"@` @ /``   *`!@ ) ` 2@ `-* ;` "@$ ``@ O/` D -`%- @@ , @. 2@& &  &/ &㿠@ b @ ` $ ( @@ Y @ W (@ U @ S 0@ Q ,@ O㿠 8@ @ "@'`(@ < `@L %?,` -`%,`  2@`4 @@60``4 ``44 5 *5`@+  @/`4!  5`  ``44 3 `)` *` @/`4`4/`4 @ `4`/`4 "@`4 "@`4 /`4` O,?@ 㿠 8@C @  @.@ ̐  4 `% (,  - 4`@  @s@@] `,` @ +%@(@  @#2 42 4 5` *5+` @ - 4 4``- 42H (3`@` 4`- 42H ()``@%2 4 ` 450` . (  (@- 4@`@ w@F% (@> 4``- 4@$@```@*O`M,`` @-#* @5`@C5 4  42`*5@ -- 4 ( 45  4 0+ ( `@@- 4 4- 4 ` @` 4` - 4"@` (@@`@ @% (^@ 4`- 4@$@``@ O,`@\ `,` *`! -`@`@#3` 4`3` 4 `2  +` @(`@ - 4 4`- 42H (2``@` 4- 42H ((``@$3` 4  45` ( * - 4 (@@`@ Ð@% (@ 4`- 4@$@``@*O``,` * .``@"2` 42` 4 `1 `+`- @ - 4 4``- 42H (7`@` 4- 42H (-``@)2` 4 ` 45` (0 +6( `- 4@`@ h@7% (@/ 4`- 4@`"@`$@N``@*O`;@d `,` @(!(`@`@"5 4`5 4 0`+ @- ` @ - 4 4 - 42H (:``@ 4 - 42H (0`@,5 4 4 (0 `-@ - @ - 4@@ @% (H@Ф 4`- 4@ @`@$@@"@`$@``@*O`א`@f `,` @ . *`` @"0 4 0 4 0+*` `@@ - 4 4`- 42H (=` @` 4 - 42H (3``@/0 4 45 (1  `( +  - 4@`@ @s% (@k 4` - 4@`2@ $@`@@$@`@"@`$@``@*O`p`,`  +%+` `@"6 4`6 43  -`) @ - 4 4`- 42H (H``@` 4- 42H (>``@:6 4  46 (3 `( )` @- 4@`@ @@% (@ 4- 4 ` Ȑ @`2@ $@`@$@`@`@"@`$@``@*O`f@ 㿠%;7` . 3p?.`. .@@*  # `@ c#c㿠   @ !$@)$( @@"$, @@$0 @@ `.  㿠.` ?`@.@ F .#\   \@\ # 7` 0? @= #`-?#l?`-#d ?#h%`\)  @ ."@.`@`@H` *h`"@ @ . @@ \@ @/  @- &@)` @ d @@  ,  O- @ Y ܪ$ R@@ ܒ@Dd@*`@9 h @    @ +@@,@ .`O ` `$O `   @ .@ @@`+``O ` `$O ``@` \$@'$`@  @@ "H/׬א @   l@(׈`/׀ Ob`@^ h `@+ @Ҕ- @@C@@ S*. @"@  \$@ @ J@Cє@+  Oې0` @- @@C@-@ @"@  \ $@ @ #@C@*  Oݐ `@`@`H `\`#` *O` @r!  .  @i!㿠7@@& /쀧 & Ƭ& f@@T!@&   f@@ `.  + . 6  & 3p?-`, . @'@ @  @A@ & 㿠 H; . `1@#@@  @&. @@. 㿠 `@ @  /` %`,@@ @ O/`@  `@"  @.'.`@ `@.!(@@` `@.#*@ @`  *O @ @ @ @  @ D @ ,`%@- @   -: *O @  D` @O,`@;  <a@@@@ @㿠 `"@ & @D@@ `& & @r & @o & (' & & /`.  & ` -.  - .  ,.  , `. *@    @ @v &  & & @r@e'@D@  @ْ @ Y'@U  7` 10?š@'& @ @' 4@h'"H X@0@D@@ & &  @ `@  @@Ɛ@('@`@@D^@@ & & & &  㿠 @ٔ  & @;b@` & ,`$@ő,& ` @  .@ .(O. @&& '& D h& \@L 1J `U@`u2@  XJ `T@`t2@ XJ F@f2@ XJ  /5-0` 3?@D@ X . X X \*. X`@3 X @ @& <,   @ݒ @& <     @ ?@ <,@$@"@  X`. X ` O` `O  @ @  X`* X X @  *`" `! " d c" h@C" l  *`  `aa  @  ! 8 #@8  @0?0?@ `@_2H )@ "` $O ` ``@_2H )@ "` $O ``*``Ö@ p  @㿠 8 @  @ 2O &4 &@&8@&㿐 4 `  -`& H%-  @' L`@E`@B  -+`% + @2`@ ,`@-'-` 2@`@@`@ O,`@@  ` g@/` #@+  @< *O  @& $`4!@@ } & (w & ,q  (& 0`@ ,@H& (& ,& 0@D ,,,,,,㿠 @d  9q,`  ` !(@ & @j-@ƀ  ; " 2p?* 9`"` @@ @ H`Q @@ H`J `  ``@@``$O`@ Oɉ,`@@" @  /` (` @ ` &@ `` * .`  `2@`&` `@ O/`  X L& \- . X 3p?6 2?, @ X,`@ . X@ ¢`㿠 @/ & @-&- %@@,&,`$@,  &@ @ @`@}  @+ @.& `@ +& @ +$@  O+9r4"@  @  ,@ O,2@4@^&45r`@L"@43sa(@C"@4s;sa@g4b@c@@a"@ @   @ X@ 2HL@+ #@ @#*@& @ 㿠 `H` H`"@  `G` G`@@ @ @G`O  㿠@@"`"@` 2@``@ `G O @"O``@ `@*`*@"`  P*@" P @` @ `@  "``@)  ``  * @   P+@+ " P 㿘'`@  @@&`2H" `@ `@@ &`2H" 㿠`9@@`2@`  @? `+ `P H9  @   @ @@ @ @ @`@ "@ $ '` . , `-`/` &  㿐``2@&` ` &`  &` ``#``#d`#h?@&`  ` @ *  '@/ `.`. ? ?4 `` @`"@```   `! ``"` "@``"` @`#  phhh㿠`957s!\h% @U.@@`` `  ," `@  , $ , X` . X` "@` ` ` `"@` `  H1 ?H3 X, '/``  `* !@) t` ` @ ? ` H ``  ,%@  8@|%π? p@w%͹,@r% @m%`㿠?.` #*``@# -.` $-#`@Ŕ"@  @-&@  * =` 2O۲  @@~@2-"@* @@"`"H  * >`@m  @`4 #@"@_  Ғ* ?``2O -  (@ `@I@@h"@>  * :``"@4 y"H  @* ; "@   @ @?"@  * =`"@  W.` .`-    #`+`# * @`@  +`@@3 @#`+`" (` @`O+`? 㿐.` `'@/`@#` #d #hT?@$*  $@-  .+? `? 4  @@  ` 61   ?5/ -`?3    ,  &㿠 `@9 .`!@  ) `@  @ O.``@)  , #@+ @@ /` -`%- * <`@` @ @ O/`   O,   㿐    @@`"@!   ,` %@-  2G`@@ 2G`@` 㿈.`%-@ .?`"@`? `)?`@@"` "H/ #+`@ @ @4T "@ `f@L` @ D`@`@ < `? -`@ *!@ ) @"@  H '''﯒@7` 2@@2`@`*O`+* 8@ @ `2@``!  `"" " &  & & 㿠@_`8@&`8PlTTTTTTTTTt 4 <㿐`8`H@ @ &   ` /`. .  - . ` @`\8,@@-` @ `\  & .  `\@Ħ 8@@ @ $&   왒 . & ` @ 8䳐@_ 3`2 / 2?3?7` 1p?-  . 7v`_ a@ 5` ,`2? `5 30?4 1p?,7v. &`'`V@x-`ŀ!@q o& @k & g& @d &  `& @] &  Y& @V & !R& @O & "K& @H F&  @C !A&  @> "<&  @9 #7&  @4 &  @0& @- &  )& /@% #& @ & @ &  @ & !" b@   & " @ &  & `$@ 8@< _ 22 -`1p?2? 0` 3p?- @. #9 !a @ _5` 3p?`,`(#@. `?@`*@`(@` @-`$Hu`(@K`)HO-`*@+`+H,`.HL z`{@ `?@&`["HA `^HB n`{@!`|H !`}H#bd@a _&   @@Z X&  U& @S Q& @N L& b@G E& @A ?& ;@; 9& @6 4& 2& 0& @ 8@ @& @ * 9` @ &  & @ 8@ @@&8[8?&8$ `@ &  &   `8 H @  "    @ *  `@`\ 8 ,@@ (` @`\ "   `\@@<`- 8 @`@ @5 # 8  @  " *  `[@+`- 8 @`@   `.@ * `="H  `:"H   "    "  @ "    *  "  `-@ `]H  `^"@     "   "  "  "   㿐`; % m @. @`@   @ Ֆ    @ ͖ `H@ Ė @`@  & 㿠`@j`@2@ ` @[ @+ +  @@@I` @@- @ "@3 ` Oސ)  @@ @@``@H  @ T"@  Oܐ'` 㿠`@_`@2@ ` @w`@u @- @G`@  @[2@ @ "@@ "@29` @L`Oڐ` @E@``@ @# 2H ! @'"@@ "@9 Q 7 K '`  @ @ Oː"@  ;`5  L X  $ 0d 00p |   4 T T T< 4 T T T T T T T T T T T T T T @          4ht 4 4 t , 4 4 4 4 48 4 4D 4 4 4 4 4 4 4PP\\  D  P \ h tt88    T <     <<,  <p       ||DD 㿠/5 8@u@( za$ #@U, @````N`ޚ `\ P` P`  '` @ @#-z$p #@++  @ `W`Ɛ``$` `2 P` P`y zb $`#@ *`€`6``` ` P` P`[ ` '` )@@)zb$ #@)  @ `h P`{``ِ`i ` P``. 2H+ Q !zz!@@,$#@(@``P`c``> ` P`+ P`  '` $`#@-`@ŀ` @``@%`@# ` P#0` 3p?`@*`@`@  `  @2@\ '` `@ X`@-X`@ X@@@H  &  @ &  @@" '`  &  @ &  @@ `@ @ "@   '` `@ݘ`@`@ ` ` P!4  2? @`@`@ `  @R2@\ '`  @j 8 H @e ,@@a+` @@\  @1@" @2O 8 '` ` T.@@ '` P @%P @ @ '`  XL @%L-X"t @/` @] ` &  @@ '` U @@@HL9@@"@`@`"@:  @ @G쀤O '` @d`@`"@ ` G`G`G쀤`O'`   '`  㿠`- ``&`` @ ``@%  @ `@ ' ͔ '` `@T .@$T  @F 2@'  '` 㿘#\#`#d @p`8@?@ 2@  `,@  '` @@#@@  ,@@ɔ?@(@8@ @ #*@ @`H '` @H '` b@09#2@ &`8@ '`  '` \ &`&d&& @    ?3` 2?4H @  @  @ @@ @M@KO@@  @#`L@  @s "@, #` @j @"@@͒@\ @@ @T @ O`"@  @G '` 㿠 @ "@ ``@`@ @ `@  8@ ``@  H @` (@  ` "@  @    `@ ` `@ `@ 2@ ` @ ` @ @  `@``@`@`@"@@ "@= @ @@ @$   @+``-@@"@! "@ &&& +` &  & - &@@ی  O  㿠@ "@ y w w@}  (@y @Y @V @  E' @#`   `@- O  8& 8 @*  #` @  &5  "L'#\@*@ 耣@G耠`@C@<@= 8@& 8̔@-2H  8  & 8&* #\'@@`\耣fʒ@' T'  '  ' 耢@ @."H1 "@Ȑ@"HC@' .@/@' % P@0@' ڨ@ (` @-@z% `$*`  @q OZ 8@& 8`"@`\ڮ`\$@ `<  @) @% `@! @`\@  $ @#  @@y '' @ "H4 `X  @.`X''@q @# `@  &O @ސ '' @Y @ @I @   '  ' '  ' @@/ @@ '  @,t㿐`8ݐ @  & `8& `8&`8 `8&`8`@`@`@`@O_ @ `@ & .  @㿠`8`H@> `8`2@`͐ `8$```8 `H@ (@+ @2@  ` ]2H  &`8 -`@ `H  `"H    &  &  &  -`` &O  㿠@) "@ ل 㿠9/5@@ܒ@,@@'2@$$@ (,@ 2@&  &$`&$@ -`&@  @!!a @ `@ E $O  @6$O @@ @  @ !   $O   @$O @@ @ `@ ` `$O  @  $O @@ @ `@ ِ   $O  @ʒ``$O @w@ @ @ ص $O   @ئ$O @S@ @ `@ ؑ   $O   @؂``$O @/@ @ `W@ m $O  W@^$O @ @ @ @ I   $O   @:$O @@" @ ` @` 2H   #``O`   @ 2HO  @@ @ `@    $O  @  $O @@ @ @ ې` `$O   @̒$O @yH! @ @ ׶` `$O   @ק$O  㿐' @  (@ / `=@n@l@ ,  @N`@  "H N@@'` `@dN`O"@ \ׄ \@  <'' @v @ \`H ''  X`@. X@d @ @U @I@А@C '`  '` 㿠`@-???) @(`,@$@Ѐ @@2@/ "0-@5`5 #@;0 @ `Oۀ?㿠@ @ @㿐'@㿠 @`2@ @@y#@  8" & @& 8 @& @`-?-` 8 '`'`'`'`'`'` '`'`'` `, /``+`/`@&`2H&` @  `@@ `+` 㿠 `@ 7 @ `@ ; @ @"㿠` 㿘    @/'& ` -`@ 2@@  GO  l %2O& 㿘?@  @ @ɐ @/>@/@p` @ #\#`#d@8  #\#`#d@- @/@7`@S`7` 3p?㿘#\ #` @r 㿘#\#`@f 㿐#\\#` `#d@#h㿐\d#\#d`#`@#h㿘 @3 @1d @. @+ @ `@ `@L"@?@?@;`Ok#\\#`@@/?㿘 @@@@ @ H  @ *H   *@ @@ @.} @!@    `d@f@ @@ 9 `@/@9 9@J\@G5 `@@ @@ݐ @^ #\#`#d@L2@=?BOc@ȑ/ @I#\#`#d@8@( 5  4 @J *  `+`` .  @ @%?@ @$ #\#`#d@"@ Oc? ?d@`@ Oc`"@H55'@@}?@-@@ ?35c@!㿠@-`@a@'` @Z@'`'` 1@N` @`@@ $`-`@2@` @@ '`'`'`@. '5 xH` H @e@S6#!0?"@M   @   `@0&`$`#@m `"`"`!` `%`%`$ `#@ O@`&@`"@$O` ,,` % `% O,` ` @?,`%@`%`@ ,`%`$` O,@۔"$y`@֔"&x  "@  )`` * "`"`"`+``* "`"`"`h#h#d  \@# @@ hd@' @2@    h @p '̬? %@g#` `"@G  $"@C  ("@?  ,"@;  0"@7 `@`% $ @`%  @ @  @`%  h`@`%  #dd 2@ `#d%#h @%9 L#\ h2p?#l   @5`  1p?r@d''  `/ Lh/`@͒@# X#\%h    3p?S@d'h'  / L(`@@ @  #l X 2@'h #lc8@  @ʑ,`@' hd ?  'd@  4`e@ 2`f@'"  \: `0 3?/`;`@#pp`@  @ 2@ @ h hd`e`f@@@  @hd4 h - 2 #x#1`?#| ?#: - !@ @ 3p?#t*@S `@ %`@i`"HA@`@%`@h"@ @ h}@9d"@@ @ Jl J@n@@ @'d@O"@# @@+@J@ J@[`@@'dJ@ @H`"O`Oh@@J@ J`@F`@@ 'dJ@ J"O`;h@@7@ @ J@ 2H J`@+h @@ @  J@ H@@"`'d@O@Ѯ  @:@JJ@ J@ "`'d@O  h@p`@  @p@d@ddhh'we@nl@|@"@ ' @ 8@ L`@K܉)`h@'6 L)`h@@' 2@ L X L`@3ܗ)`h @'  @2`t 2?  "@ L Xx @ L`@ @khH` ` `@ @]h@ @I> @D` @Z @,4 c 3?"@&  @3? ?@&la$` ` $ $$$$$O$@ $` $``$O$`& ?+  @#@ #@+  @%`#@ O+ &'& @@  X/ @@h L 0?,p8;08@I@ && @  /`4 20?@0 /`?@%Ā`@d @&t/  &@ @&t.`@&d &d&`@ Oׇ/`1` @-? @" @d@ @2@t' .`' 2@t' . @' d@ ' d '  $O ``@P`@7`6`"@10?"@0 `@A ?@#@+`$hh   䀧 O  @ +` %``%`O+`  , ?  ` `` @  /  @ $$` O/  @' @%  *  @@*@,`@&@ -&`@ O*  @hd@@'dO@  @ L @@6hٻh㿀 l;c@`d``p-@ @ {  L @ @ @^@ @g @\a @@Z  @@͘@?@ @?F;`@0@+$`@@%,``t@`"G$``4"O$``@-@뵒 @@@ "O @̖@두 @  @`t&`l  &`p&`t@념@냐 㿠`d9@`$4@ &* h @`(@``$@ `"@`$`0(w"@`$`,㿘.` 8/@> d' d$`4@- h'  @(`@`$`@`"@$0` (G`"@$,`2@ t "@ ?95`"@95 t`@6 2?&`4/ '@L@6 3p?`4`@ x @'`4+@  `4@ #@' `4)@ ? 8@ @ @֔@ ? 8`@ y 8 H @k+)@ 4 *@ , @ @  , @  @@ @;@L'@c t@@@ 2@H? t`@;@`@7@"@2`@@`4@f@d@ 8@@@y 8"@ H `@   H@ O @ ? H5?@@&35#c?@ꐔ$c5̒c?@ꈔ$*` #@ + @ ` @7`0`c@` @  `  0? 0? 1p?@  ` `@@ `  `  `0p? 20? 30? 0? 1p? 3p?   * : 㿠 h׻``@ - `  d* =@ ` O- ` @ 㿠 d/ %-` `@@ t+ ِ* 9` @??(@ ?,ڜ@@@  O,ڍ"@\ "@@"H{? -@ @@*\H`HD\ )`@H  "@Y?"@U?@  @"@ ? / *&h* =`2@?@ t(``-"@@O* :``H? / @ &"@'` l8@? t*@`"@ ?`2@'`?㿠   &    @*`" )`@2@  + & & - %@- %. @$@  @$  @` @ @ ` <㿠 '`& H!6- '@-.&`  @ݐ@  @  ' ' '   6`@%ݻ-㿀/  `'`/ `?`'@',%+@'"@°  H  H @诔 .o@ * #`@藔'@@ ?@@菐@@胔'@H ?@䀠2@D#\`p@?@4@ * @@@ @  O* @d#\f @2@D'@C`@@>@U@8`"@H @3 #\B @@ @*䀣@(O@`H@ `"@ @ @`@@@ @@@ @  㿠@`@ .'`.@@ `@`` O.@` 㿠 .&@.`@ `@'* '@?$ @`@+ @@$/`@碁+"@ $@@/`@疁$㿐`` թ@@@4@1 ,`  ={D@@,'$ t,@ @@@Ĕ@8O`  @a @V  @P㿠 t.@`@P` d - ``;,@/ #*@@@ ` @Ɩ2@`@@-* ="@(`@@"/  @ ` @ / @ @c* :`2@ * ;` "@ `*O` 㿠 4 x@*@ , @ @ ` ,@ @ @@ `@c@@ , t`&@/ @ے & x 㿐@& ,@ @@@$@@ ի@'ؒ$@ @ O, 㿘 d.' t @ `@@ `H `$ 2H' t @0@6@1'`@ ` @y@#'N`% @ t-`4@"H @65`&㿘'*`"@ @  `F2@ '` @ /`` -`%- ՙ2@  '``@ O/`~㿐.` '- @ @` @\ ??`- @@3*  !(`@+ ``@`ǒ@’2@ %@ֹ@ִ"@   @6@ `*O`@ .`֛@֕" ֵ` O.@@ 㿠 d@,@(`@' - ` *` + *" * @m`@d2@ `  O߫-  㿐 d.!``(@ @F#\ @ \`@R` ?#h/ -=`) #d*  1`,`-!(` @5`"Hh`"H* / @+d`@  @ @@` `@?@  6 N  `2O   "@"@? *O \ -@=-?#`/  @3 *, #l)``"@)` @ H1 "H68`"@4`@l @@``@f?@@S 5M2O "@  @"@  *O \/ \`,? "HH  ,`-&(``@ H) "H.`0"@-`2@M`  @O?@F2HM `2O "@ ` @P"@Q  *O H\,`- (@` @4H"H) ."@,`@2@M` `@ ј?2H M? ?f@`2O  "@`"@? *O \?\2 30?  *` )  @ :@ ?@  @@ 3` 1`10? 0p?`(H 㿠@Ѩ ?- c?, @* @(@  @*@  @2@``@@   34`# 2?`@%   (`+`$ + @ @*! , @ @ 2@ d@ d@  O((@@   -`"*@+ " *` @ `d@ 2@` d@ $O@@k@Z@:@S ` @N -@@I -`  , ")`@B2@ ;@ E@4%` O-( @$   ) !@(-` @*` @ ) @  8@ @@ ` O-  O8-  X#\ d@?@ \'@#d* #`.@#l+ `#hd\,`@ , (@ `` @{,"@ * @ `@sh ` ,2@d` @@ @`  `  @R.` `@M`ӥ@H* ;` @=䀣@  @O#@>''Ү* 8@" @-``@l@#"-`h" Ӈ .@ ` `M2O\d`#d*Opd 䀦 @@m㿠 d@ i@@-`@@ .` /@ 㿠4;@ @@&  `8` &`8 @,@"/ 0`@`d@* >2O, &  `8`h%ڐ @/ @$/ @㿐`8`x`d@/ `t!&`x>`L`t `@@"6`L`(@(@&  `8`h&Ϧ`t`@%@`L'''`8`h#`ύ`t#`L`@@@<@&  47@ @@&  `t㿠`x`8`@@``t-`&`8O`  @`"O`x 㿠``@"  d, ``*`$@ + 2@  @  `P-@@@ @ ` O,  x``@ #? d!,` .%*@@@w@@# 8 h`1 @  @g2@f @ 2@_ @ "@Z@ "@U 8@ *@L:   8;#@ @: " & #@C.'-  t@ (!(@%''' hβ t" t(@%' hΟ t#@ t`@@` O}, x``@ɤ #`,;? 8 d#\- ```@.#@+ `@\` @  hg`5`@ c @ 2@ @ 2@ @ "@ @ "@ |@@' |@z.- @) @m@ @2@j  2@ ` ``@`+`" +  @@`) !@(@ h& t.`@ `@j t# t`@ @E`(7@6'R t'@4 t`@ @+`2@@@@'L@' | O-`` OI, @ 㿐  d@ ?@* @ +  `"@ǚ I```2O` @.`#d#  *? @ #`#hd-   h (`%@+@ @>  - @ @ ,@ @ @@Ē@ @@@*"H  *@xd@x  @ @  OЉ-`g  @@[ @@W %@ $@ t , @  @@J@ @M %`O@O@@> t-``@0`h@`"@*` `@  `!@`% 2H#\ #\  @b @ @@ @ @`@(O d d#d @*ORd  㿠 #\@5"@`@ :"H`'@`@  ) `@+` (`@ 2@  @  O) ? 㿐#\` d' ` @.%@- @"`?"@@ # @.$@- @,@o`"@ / $&`&`/ @Œ ` @1 t`'  8& t& 8 hd@0 t/ @4@ @'4 @ޞ 45@M\(\ @ޒ E`& 8& t& 8 h4̓@'\@7@'@l`@@@'@[m@ `"@ t@K t/ " @q @m ' t -@ @ ͦ@'2@ @*"H/@k@"'@#@ٖ@'@\'H' @@@'  h˩@@/  t @ @ t/  #@@ (O'@ t/`@ @&`& 8 & t& 8 & t"H  Ι\2 2? 㿐 d' @ݷ `@l - %/ "*@`@?@ @5/  t-` @`@'`'H@݃́* 8@Z t"@ t@ @"H @i@d 2@  @@`* ; "H   / T* =`@   O- @B @> 㿐`D"@`@0 ?,`` @,%+ @ ̎H`@@@ ``@ Oܭ,`@@`&` &`&`㿠̒@>. "*`@@H @/* ;` @( ْ* <`"@   @@ `Θ"H  ͐Oƕ. 㿀 d@3?@*  @ -v@s  @@@+*% *@   b2H`Mʛ'B@u @Q`2@O"O +` t@ (` @  7@4 tʜ'U@* :``H@G f@ W@' t#@@2 t@ "HMM2O h@  @ &`,&`0@"  @@ `2@|  @m!&`,2 2p?` @''̦ UT!@ '̡-`; $-o@  '̐* #` -`@@ ''̵-`HФ`@ g`' ?-@.'-@ /  @ )`@ (# +` !@' *Oͼ .@'@z 4@&ͫ @'`@k@@  \ :# 30?/`:`͔ @ ' @T.''.Ѐ*O'`@> @ɒ!@?&`,  (``@* `-"@-@@ (@@(@"O `@(@$ -(-$ 1` `O߀`` ` OЉ(`P@܍"&`0H̀ @@@`@  . $ ,`@  O. @    (@ @# (` @"@- @ `.`@ .``.`"O`.`@-' @'$2   O倊 `  O׋(E * 9 @.`@" / : * :``@/   O/  @`@&(@&(̀`@@ڵ@ڳ ,̀@@ڪ@ڨ̀ @@ڠ@ڞ`@  , (`@ڔ` O,@ڏ #\``@ #l#` #h&'@\l``&#d-)`%@\-``@ ` 0 D @ `2c: @ \ \2``@ #\ <\\` @@h\ @  `@,?4  @5 \@@ \ @ @ @ h* ? `@ jh @ l@`@ \`@ \ \`@I\ `< `` 2 !``<`d3 @ !``< `h`5`` !``<`l 2 !` `<`p 3@ ``@!``<`t`7 !``<`x 2``!``<  |`1 !` 2Ho ld: # ` @1\ `` `d  h @l @!  p! @! tx|!     @@ !  !  @@! ! 2H9 ul\ `  @ d   h @ `l@ `p  @ `t `x@  `| @ 2H ElAl @`@ \`@ \`\ @I\ < `   @)@! @<d` /! < h @   *@ ! <l , ! <@p`   /! < t` -! <x   +@! <|*@ ! @`2Ho`ld? ' @1\ ` l d*@  h+@ p)@ @t x *@ * |-   (@ @*  `2H9`l\  ` +@ ` d@  * ` h ( `l / ` p@ /@ `t ```*@ `x* `|+@ ``2H `ll`@h / `@ @ * 8"@8  #< #@=<` @!@:` 10?3?@.  ``    `@' ` @'  'Ƞ`' ` `'К @    ` 'Ԃ'ؠ'܆@-`   '    @ '  ' @  '  '  ' @  '  '܆@̠ &:  <# : #"9`3p?" #@2?:` @ ;" 20? @F ` ` -(@"`   )@)' `'"`( * '` "` ()'@ "`  ``(')@"`@(') `"`  (')@`@  "`)*"`' M/ `  + '  * !`  ,' @`(@!` +@'  ` , !` @+'  `(@ !`   *' @`+!` @ *'  `(@ !` - '  `* !`  / ,' (@!`"@(@.`ْ֐.`!@/`@Ŗ@"`@K* ; @ @  O/ @3.`.`%@(H"H$``(@,? .&,@!` O.?`@.`.`%@(`@'2@?`l #l@*Ol㿠.` '@/ @  @h @ @@@ @    ?g@@  `&@ֲ  2 /@@  &@Dz  #  @@  `&@   6H @  `&@   @   ?8@  *OÒ  @`4@  @@ ` "@} @z @u ͒ @`$@  `2@  `2@^   @ $ @"@C`@  .@* O.$`@ /` @@`$@ O/` @ ) @4@  @  O)  # @`@ >` 7 @>` =# ;0 %㿠``@`@ `"@ r `@`"H k  `@) @M`* 9 @ @ @   @ @  d@2H` @  d`@ `? "@9  hj`7 `@ c "@- H @ 2@#  5  10?4 4`0? 3?@H 7 6 3p? 62p? 2?@-=`㿠; 4c@  @- 44 #@;0 @@ e@ T"@t "@ X4@-`@ &tX"@`` @SА `$@Pu @  㿠& h?@& l-33̀@@. @).`& @&. & "@  2@&  &  & &  㿠 `@& /  `@ `-``@@`@*O`@``@@@`@   Oߩ/ & |& 㿠Ґ@  @݁㿠  |@ @, +`@{ 2@& @   | (`-`/`- @ʒ   |,&  `@ $`* *` @@ )   |,`@?/`  | -@-`$ | , @+ " | *` *  ' | /`@-d@5` | ,``& |.+` *H&   |`@  @0*@ +  2`" x\ xL @ O@@@ +`  * ` 2@?? 㿠  @@ , , @ 2@&  &  @ի   -%@  - `2@$`   /  & @&  㿠  @@ .`- @ @ & &  @Ձ @   / %&& & "  "  " "  @ 㿠@ձ@ @Ժ㿘'PP'T'X'@@@ `@ @&`e@@ܔ.@ܐ7@ @ O" ?? ?@g@  㿠㿠2 2`#@ : @ " 㿠 @" "f@?DUGZ2@PA@@?UX!)Et?@@@?ꗍO;d@@@.TTTllTTTTTTTTTTTTTTTTTTTTTTTTTXllTTTTTTTTtTTTН㿠.<`$ Ac07@T- ƀ & ``@`MQ9@хS#\\`5A#\9 \`5``EI9@ɍK#\\`A#\1 \`52`" 9p "@GE  d& ` @``AJ[9@HەY#\\1`C#\) \1````UJ_9@Hߝ]#\\E#\# \1`2`!8p "@ d& ` @``MQ9@ѥS#\\4G#\ \ 4```EI9@ɭK#\\`I#\ \ `42`" :  "@ْ d` @` `(`I_I[A9@C#\\ K#\ \ `0`(`MQU9@սW#\\ M#\ \ md` gd` @`8`@`EI9@ɇK#\\`5`O#\9 \`5``8`H`I_A9@C#\\`Q#\1 \`5`2`# ;0 "@m 2d2@. - h+d@3.`  (`\  @t`d@d```UJ[9@HۗY#\\S#\) \d@ 6 7`" 9p '@/@d@d000lHt " 0#L$x%&'''H@@ @ܐ@̀@@ѿ @@@Ѹ @Ų "  Đ  /@ ' * #h??e?@ ĺ@ѝ@ ' @H    ' L;/? %' + ff'c`/a?' n 0' # ' - '/ l`'x  / /////''`@C'@7 @- e2` 2`6#8  & e@@ 6@ @ @ @ 0@8 @ ( @0 @ &`@@"@ @ ̐L`$`%2@M`(`(H JA @7 @- e3` 3`5" :  % e@@ @ @ @ѕ @ @ @  @ @ ׀`@@Ӕ.``,`'j`H `n@E ,!@+  @@ @"H"H @H&5` +``, 'B`7 ``,':`%``,'2`%``, ')`v``,' `, `s"*` @2@~``` @ '(``@ M?, ,e`2OM + &- H   d '``@@}` H`/  +`H  &@n`(`(HY  M/ / eW`2OM`(* "  +  @@ (@ `"@ @ *섐@ *@ 2O @ @@`@@@@@ @@ @ X"  `(  ) & (@N`(/  "* @ `@  @r*  < @ϼ`@1 T@ Δ@ `OT %@ @@Ϙ @@ϒ@@ϋ @@τ @ϑ X"   耥@O@Q``@M$@; @- e  @  e@ @ H @ @ @Q @ B'@'쀣`@ 9 @A @ 7`@'@3 @:@< Ha < @.V@: @- e   G@B  e@ @@ @ @ @@Ϡ @ @ @逥`@@@`H A@ <H @@@Ҕ2O@ 5 @@w `H /@ 丐@L@: @- e ޒ@ْ  e@@ @ @ @> @@Β @ @Ί @`@@|@w@*O $@ @@i`@@c@@\ @@U @b X"  耢`@À(@``@$w@: @- e h@c  e@@@ @ @# @@@  @ @ `@@ @ @``,'``'` ` 2@`''/` @* 'N(@(e'`2ON  #, HD@Ā  dd'''`` 2@` 'Ԧ '1@* # )` @, `  d d'' @'O В+ @ *eǸ '` 2OO  '.`'؀`@O*x'Ā @O.'Ā@O,'Ā@O('Ā@O+``'Ā @O*``'` `@@" ؐ@L'``@@& ؐ@A''ܔ% @*O)  'O-'L`$O+  'L`$((O((` @  ` ) #/`H' ` @*! + H/ ` $'*@: @- e @  e@@@ @ @֐ @Ǯ@t@ @ǐ @`@@̹@. %''@̿'" &`@+`@`(  +!*` `@ H6 @)6:6'4 '#@ 8 @?4 '"';0 #\ @ @,4 ' ': #\ @ #`@`(  * &([w[@ w H6 @*66_4 _#w;0 w @ @4 _"@ _9p w w@ޖ4 _# _90 w #\@w@p @ "H "@. `( +` .K64 #;0 @@ͪQ`(64 " )`"@8 * M@͕<`(64 * "@ (:  N#\@~% @ "H "@. i`(6 *# *` 4 8 @_`(4 (%6 9p *  `@J`(4 ) &+6@ # `; #\ @3 @ "H "@. "`(6 ,#-R 4 !90 @@`(.#@) R`64 "@ ;p @ @`(64 *"!@ :0 , U#\@ @ "H "@. `(4  ( 6 :p +` @@ɔp`(4 )`"6!@: * @̴[`(64 * %(@! 8  #\@̝D @ "H "@. `(6 *`# 4 " ;0 * @~%`(6-#* `4 " 8 @i`(64 )  &+:  @ #\@R @ "H "@. M`(4  ,"+ 6 9p @@3`(.#@) 4 `6#; @@`(6)`"*4 " 90 #\ @ @ "H "@. `(64  (""@ :0 .@ @`(64 * "@ ;p )`  @ @Ӗz`(64 -##@* :p  #\@˼c @ "H "@. `(6 +!*`4 @ : @˝D`(6+`# -4 !8 @ˈ/`((&) @64 #\"@ ;0 @ @q @ "H "@1 x`(4  ,"6"8 +   ]@Q30 `(64 (#".:  @ [#\@:3p `(64 *"@ )`#@9p  \ @#`#\@!0  @ "H "@1 ,`(4 6 -##@; *  X@30 `(6+!*`4  " Y`90 #\ @3p `(6,"+  4 Z " #`:0 #\@ћ1p x @ "H "@. `(6 +`# 4 9p - @ʲY`(4 )  + `6!@ ; @ʝD`(64 +  " 90 , #\@ʆ- @ "H "@. `( ("(6`4 !:0 @@g`(64 )`"+ `"@ ;p @R`(6.%* 4  "#\:p  @@; @ "H "@. R`( *"@ * 64 !@ : @@`(-#@.64 8 @`(+!64 #*`8  @#\@ @ "H "@.  `(4  ,#+` 6" ;0  @єx`(4 )  + 6" 9p @@ɼc`(6)`"4 : +  @#\@ɥL @ "H "@. `(6 4 ("(# ; @@Ɇ-`(64 * "@ 90 )`  `@q`(6.%* 4 !:0 #\ @Z`@}K`@G@̚Ԁ#\#`#d`(L`$f@5Ā:@ @-  42 "@ 8 @" G (@ 5 42 :  " G @5 53 !:  # e@@@@ @ @I @:@@2 @: @0`@@,%{&H؇64 ;0  @ I@ H=8# : %'I`@64  !@ 9p '@~ @o@L@+- @G@ @65G5 @6 61 #8  ! e@ @@ @ @ϐ @@m@ @ @`@@Ʋ%@ @@Ʃ@@ƣ@@Ɯ @ @@ƕ @Ƣ O"  @Ɲ@" ``,'$`@Ƒ @ @@y`@@s@@l @@`@e `"@L`$ `c@`s@  X@e"  . @N @ 9#? - e p @k ??e@#@ @@, `@̐`"@ ".@ @`(@@."H @@ @*@&.@ `@@@Ɯf@@@@@ "@H@ H! @@ @@ @ڨ "  @@L`$`(`n@``,`'U`@Ź` + " ( _@ů`  )`#* l@ť@Š@ŜG@Řѐ@œ` )`#*@ʼn`   (&+``   dd''@u` / "@.[@k`  (%( ``@a0@],@Y(@U$@Q @M@I@E@A@= @9@5@1@-@)@%@!@@=;# :p % ' 㿘'-@@@ `@ &`e@@.@7@ @ O" ??㿠@ @>@ ?@ " @ @ƅ@@Ѻ X" ?㿠@`=: "@ &@` @"O`&@ 85 @;6`H@Z"@O` H@ć@Ą@&O@`/@@Ă@@ @u /.@@@s`@ @f@@a@Ŗ @(l$@}@ @Ďc, ̢@d&  % ?@N G G G #@@U& % ?@; G@0@ @-@@`@ @   `@`@ĵ @ # '@@N@K@@B<@>`2@.<@/ /%@Ŭ?@Ũ?㿠@ 16 `d@9J @"@@L`*@L`@@ý @@ù M@ ON @ï`N 56d@@ø @à` @6"?`@ @@] )%! ?`" + =`@e@sp]" :  >a!l[p "@ u" ` @h9`j@ H@ "@9`H2p ` -!B C2`K@3 0"j`>"` h9`k J@ #9`K30 `` -!B3 `CH0 3 "k >"` @h9`k@ J@ #@9`H@3p ` -!BC3`H0 1 "k`>"` h9`k J@ #9`K@3 ` -!B3CK3p 2 "k>"` h9 k J #9 K3 `` -!B3`CK 30 4`"k>"` @h8i@ J !@8J@@%-"Hsh@Ksh`s`@r[`[h6H,^`@ 2@:?@"  s`@ ![`[h s`sh@![`[h @sh@s` [`[h2@?^``@ v`@ O8"@½ " ?@¸" @³ " ?s`,@ה!"@Ÿ[h[`sh㿘;b,b,`@5 @N "@&  @IH  & &`@u 㿠@T@R@P `@  x``@   x&` @ x@; ' % ?@=&`$ `@& `@ @*54#@;0 @@  @ؒ"@ ?' &`  @6? O"  .@2O ?.f@?@  " ?@Аǀ  4H\|<Pdx`@ ` 6   `!!@ ` 8@?+ @  *z  *u  2p  2k  "f  "a  "\  "W   )0 rO   )0 rG   :A  X`rX`r9  "4  "/ "`@) "' " @! "  "  "  "  "   "  "`*Ox ?  ?e@  㿠㿠2 2`#@ : @ "   D    l   , X    X | T  㿀#`#d` &`#\&`& & N`@ #h%t]5]#t#x!ff;!#l`#p ? %@T* '@`&)  +"@ '`'` '`'`'`'`'` '`(N?Ѐ` @1NЀ` @ HЀ` @HЀ O$H 'NЀ @K * +`e 1MЀ O@5@0"M '@ -``'`N '@ +`'`N '@ ` '`N瀣 '@ #``'`Nހ '@ 0`'`NՀ '@ *`` '`Ǹ '@?'` '`N?Ѐ @;NЀ` @ `M`Ѐ @`M`Ѐ O``$@(NЀ @  ((e’N?Ѐ O@ @ '` ` €  `@h'``@h #h  @1l@ ,`e@@x@ @y,`#@+ @t @@r@Ȑ@e @2@ &  + -`@&  @ `& *`!@ *   @(O - #-` @ d  3 @ 90 %#d" 0N @Q d 2 # :0 @%@#d#N @'` NЀ` @NЀ` @N?Ѐ (O` '`& d3`0!; @#@#dN.@٘ N*@&'`'`NЀ` @:NЀ` @ `I`Ѐ @`I`Ѐ O`$@'NЀ` @ +  +eNЀ` O @ @# '`  `  倢 • ߀` @h'` ` @h#h π @1l@,`e@@x@@,`") @@ @@@@ @2@ &  *# )`@א&  @@ & (!(` # @(O - "@*@`  2  "; @% #`%- @t ` 3 # 9p %#`  &'`NЀ` @NЀ` @NЀ (O'`& `21`" :p !@ #`N h@ , N L@ l N@ j N@ z N"G Z"G t@" %NS@* p-@: 6@d 2@a @ ] @ X   f@R 6@N 2@K @ G @ B   f@< 6@8 2@5  3   f- c )   f# s   6@  2@  @  @     f@`/`$"@h'`( '`(`(@h#h @1l#@,`e@x@ @y,`"*@t @@r`@Ȑ`@e @2@ &  +`# + @&  @@ `& *`! *   @ (O . #@+  @" /`$@[/`$'`` @/&`l@0/ t@,/  - @(@@%\`@@#@y@\`@2@ &``)`#*") @c&``N2O3*  "@`@X`\@@Q@^ " ?       "@`@:`\@@3@@ " ?* `%. ',`#@d&``&`  㿠 㿠;Zx0N<[y1O+)) )  )))%) ) )))   %$%########### (   ###!################  #####################!###"################################## ## (  ###########################!!######"##################################### ########################  '  ###################################!!!!######""######################################### #### '  #################################!!######""""#################################### #### &'  ##########################!!#####""############################ #### '''############!!##""####'''''###""'''''''&'&'''''&   ! "#$%&'()*+,-./012,3456,,7,8 9 , :;<=>(?@A,BCDEFG,HIJK,,L,MNO PQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ  CpPUhT QCpCpL CpRCp CpCp CpCp} 3gCpQ U{W lf }Cp H) G9@AsNy&l F XF]TCpw\mCpCp Z YF #ipPCp Lz ! Hk  vk  P    W-Sm[ >'(9 HQL< k  h c d ,I j  u lp) }D  t E < \ [e 9 2 1d M KK4<$,>\oCp{;e @ ?H 8H =\(~ (   k z  79  .c / xt  }    i  4aORy U    3UNjun  7F c t_yCp Cp  I  4  c l+ >o T G@ H G 3      3  3N " <^ T1  e}   0   M  # ( -    2  7 k &   = T Y b Y _L QCp Y 1 m  /m$a A 0  { ~  U C h ! \ D / O m ,  2   : Nl G [\  '  5 ?TP ! < \ a s s x q ^( F x$R< cCpQCp} ^% _BV{=z  t V~?+  Ko T}!|}_ Y  ` a+R<5 . 0UZV_dm TrJ#8F\sx[6-O, P '($#SO3l\ 7B-2Ea ig>C F Fbglq kw~Cpq)b FP gF qF j>03l/hQMCp   bF  > w !!:!s!!""W""##X#t#$ $I $$$m 9U0%2%k%%L&.&g&&''K'''(K n(((& p<)9)r))*5*n**++R++ ,,C, ,C(- T-E---.3u. .//G/\/|/b0;"0w0$01+1d122D223# (Y13_`x. }m334 *4R4m l455?5x566;6t6677]778888 F "8979a9 9::':Q:{: o::;#;M;w;; Cp ;<+>.>7>:>>>G>P>Y>b>k>n>w>>>>>>>>>>>>>>>????!?*?3?3333?33456789:3;33<=>3333AE3EB'HCiDbjecAdfBCiDb<H=ec$GG----------HJJJJJJJJJJE|JJJJJJ----------#%p$JJJJJ##Q$$Hq rsGGpRRRRRRRRRRqr(RRRRRRE$<%=()%RRRRRTTTTTTTTTTsTTTTTTjGm)nvoTTTTT((VmnWWWWWWWWWWghmiWWWWWWjP]$gicWWWWWJJJJJJJJJJqJJJJJJjq%]JJJJJvv]Uvvvvvvvvvvvvvvvwxxxyz{|xxvvvvxxxxxx}~vvvvvvvvvxxxxx}~vvvvvvvvvvv11ktUJl$kutIIIIE 1)1 sQ$GPP $s$p!"q#rsp%%SSSSq r  %35rI3*t+,E r5'UUtV.W$/012oVWGABC]E)xxxxx]mnvvvovvvvvmGnvvvvvvvv6789:FFFFF]]>?@^v]_h^hvvvvcSTUFFFF&ghe'(f]g eSTUFFFF) kt)ooopol#kut#F`$a]F`$4h4hf6cQ]]]]^]Q6QbcGdbccGFiKLMFNOPjaPQRNiiNQjRiKghgKMMEFFFGHIJFFHLFFFFFFZZZ[Z_HZLFFFFFXXXYX___`_FaaabaPF\]FFFF'\`QcccdceFaBlPf\C^Da'\\U`Qe_De\feeefe^ghk\tlUe\iD\ggghg9jegut \i%!k"&'\eeefe9lXkmmk\8nnooFl8mmkk]nniiijilF^V5]kggghg_]5vvvvvbx]^kyVz{\q0rbs+kkb,l-m\cnd0qorlllmlb|dmcnF..HFFFFIJdn]un)))*)-uuuuuuuuuu-uuuuuuIJuuuuu}}}}}}}}}}xxxx}}}}}}/+,0123(}}}}}xxxxooopo7;]8<9=])FM]]6N7OFWxxxxRST]qZZZ[ZWWWXWXXXYX]]]^]g___`_\aaabaY]aZ[I^mJ\bnom_\cndeo^fbQ\m] \cneghcccdc]\eeefegWWWXW]ggghgeeefe@Aggghg\isb(tkuj]c\d^_`a\ilibmkpknc\omlqnrmskopniiijipm qnrqKrLspcqr\qrs???@?\)qrlllml)h]A*vvvvvvxyzvA*{vpu                Q|/epfghi]          /z      ]]jjz qqqrq]]|xxxxc|   IIIIc\?\]]1}~x<wE;1PP$<w;23E4=>>>}~x)))*)=>%SSSS?xxxx:&:]?]55&&&&&&&&&&&&&&&&'&&&&&&&&&&&&&&&..(&UU$(xxxx ]BCKooopoBC)]xE]]]^]XXXYX]xExxxxyz{|xxxxxxxxxxxxZZZ[Zb___`_^cdxxxxx_baaaba^cG]cccdc\eeefe\ae(Gf]\\\egh\ik]\\jggghglg\ikv\lllmleeefeD(Dggghg]]mxxxxn];;]oxxxxx]mk niiiji4umlxn4k-o     H-]mIzn1H]v_P\q]r]sI]\???@?q]r1 G]j _]_     ]]GHz ]     ]]]]z ]]]]|  WWWXWWWWXW]]]|]Z']][ZX'NqqqrqMLK@.|_'     z      z      z|      |z ||zooopo |   IIIIPP$XXXYXPP%$)))*)^_]]]^]^%bcccdccdUUb$cijaaabai)___`_ZZZ[Zghgeeeefefaeggghgiiijilllmlkeeefelggghgkmnoqrsk%munlqrmknom&n???@?        z :|:WWWXWWWWXWqqqrqvvvvXXXYXZZZ[ZcccdclllmlO`]^tO_ia`^juti    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   )))*)zeeefe &&&&&&&&&&(&&&&&&k|&&&&&IIIIlkFFFFFFFFFF(FFFFFFaaabaWWWXWFFFFF&&&&&&&&&&(&&&&&&ooopoWWWXWgh&&&&&(((((((((((g((((((]]]^]___`_](((((((((((((((((((((bggghgcde(((((fbiiijiceeeefemnopggghgmnqrkspvvvvvvvvlqrkmnovvvvmnvvvv] QRiiiiijhk]   vvvvvxyz{ STTTTTSSSV |W]]]X Y ]qqqrq]( Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\ddddddddddddddddddddd]eeeeeeeeeeeeeeee???@?eeeeegiiiii(gggjm;niiiii_____jh;kklopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrxyyyyyxxx{|}]SSS]]]]]]]]]]])))*)     z ]???@?|WWWXWWWWXWqqqrq%]]]]&~    !"    #$$$$$$$$$$    $$$$$$                %$$$$$                   z |(((((((((SSS((((((]((((( Q   z Q   |    SSS       %'SSS(   & 2222231SSS4 STTTTTSSSV WX Y SSS [[[[    Z[[\Z\\\ZZ]^\\\\_``````````\\\\``````\\\\\\\\\\\\\\\\a`````\\\\\\\\\\\\\\\\\\\SSS%giiiiigggjmnSSS%%om&22222314giiiiigggjnIIIII`caopqiiiqrprrrppstrrrruvvvvvvvvvvrrrrvvvvvvrrrrrrrrrrrrrrrrwvvvvvrrrrrrrrrrrrrrrrrrrgiiiiigggjmn)%%ogiiiiigggjmn&&ogiiiiigggjmnogiiiiigggjmnomgiiiiigggjnogqqqqgggjmno Y ~z |(((((((((((((((](((((STTTTTSSSVWXSTTTTTSSSVWX Y  [    [[[[       xyyyyyxxx{|}giqiiigggjmnogqqqqgggjmno   ~z |STTTTTSSSVWXSTTTTTSSSVWX[[[[    gqqqqlglllggjmllllnllllllllllllllllllllolllllllllllllllllllxyyyyyxxx{|}                        ~[[[[                                                                        !"!#####################$$*+,,,,,,,,,,,,,,,,,,,,,-.-/////////////////////02222200036789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;AAAAAAAAAAAAAAAAAAAAA~BBBBBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDD[[[[           EEEEEEEEEE    EEEEEE                 EEEEE                   FFFFFFFFFFFFFFFFFFFFF                     LMLNNNNNNNNNNNNNNNNNNNNN!"!OOOOOOOOOOOOOOOOOOOOO$$*+,,,,,,,,,,,,,,,,,,,,,Q))RQ%SSSSSSSSSSSSSSSS&SSSSS-.-TTTTTTTTTTTTTTTTTTTTT022222000367860222220003V789:222:;9;;;99<=;;;;>??????????;;;;??????;;;;;;;;;;;;;;;;@?????;;;;;;;;;;;;;;;;;;;022222000367802222200036780222220003678022222000367860222220003V780:::W:000367XXXXXXXXXXXXXXXX8XXXXXYYYYYYYYYYYYYYYYYYYYY~ZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[[[[[    gqqqqgggjmnoLMLbbbbbbbbbbbbbbbbbbbbb!"!cccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeexyyyyyxxx{6|}02:2220003678fffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~$$$$$$$$$$$$$$$$$$$$$555555555555555555555########&&&((((((((++FFFFIIIIIIIIPPPPPPPPPSSSSSSSSUUUUUUUUUYYYYYYYYY\\\wwwwwww~~~~~~~~~        ~~~~~~~~~#########(((((((((         wwwwwwUUUUUUUUUbbbbbbbbbggggggggglllllllllzzzzzzzzzSSSSSSSSS         UUUUUUUUUbbbbbbbbb         xxxxxxxxxggggggggglllllllll\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzzlllllllllwwwwww\\\\\SSSSSSSSSUUUUUUUUU         xxxxxxxxxzzzzzzzzz         wwwwww$$$$$$$$$)))))))))000000000555555555GGGGGGGGG        $$$$$$$$$)))))))))000000000555555555         lllllllll\\\\\\\\\^^^^^^^^^bbbbbbbbbGGGGGGGGGxxxxxxxxxzzzzzzzzziiiiiiiiitttttttttzzzzzzzzz{{{{{{{{{ "(54#A4+7U":57C45 F A:7 B:=( C+#BUK==K 88 Z FZ 8{DIOz969}66DO}96++}6P-I----------et1111111111QP<eeQ%%%s<<<<%%%%%%%%%%<`<V%%%%%%HV6Qa`6aa`kk%%%%%''''''''''aHlk''''''iH;Vt;aH{;{''''')));tx;txxxx{{))))))))))~~a))))))juj~juu`))))),,,,,,,,,,jju,,,,,,zzzzzzzB^Bjju\,,,,,??G4????????????????????????????????????????????????????????????????????????????GGGGGGGGGG30GGGGGGHHdddddGGGGGJJJJJdJ8 8dJJJJJJJJJJdJJJJJJdhhhhhxJJJJJJRRRRRR|h||||||hRRRRRRRRRRhyRRRRRRhxRRRRRRTTTTT:y:TTTTTTTTTTTTTTTTTTTTTTWWWWWW pWWWWWWWWWWWWWWWWfffffWWWWWW[  [[[[pff[[[[ [[[[ff[[[[[[[[]]]]]]]]]]]]]]]]MM"#]]]]]__________"#'______({l_lol/xoooo'_____(l&_l&s&/ossssolloXsok1sysXyyyyyyyjXsyygs1swwwwwbyYyYwwwwwwwwwwIsIswwwwwwaa_I_Iwwwwwwas_VSsel eR    ellqZZqrZr      !*!*!*zzz$$$$$>>>.d....%%%%%ccbAAAc     dd3333344444d bb 55555 b;;;;;`[[`m`[[`mf-----mm'66666YgfgF'gFFFFf--gfg<<<<<-YYY=====]]]]gkg]kkkkiGiGGGGGGGGGDDDDD\GG\\\\D\HHHHHHH\DD\JJJJJJJ77UUUUUutU!qoUU!*"0"0'2I*2IX?'J??EEEEEEEEEEJNOEEEEEEnhXrLLLLLNOEEEEEKKKKKMMMMMhNNNNNfKLKKKKaLOOOOOr_LLKLM[hKNMhMNZRhKNRRMQSOhWQNMhNOOPPPPP^////OSQQQQQORRRRRDVVVVVCWWWWWPPL^LTQP^Q^=VPPQj^RViTQR<^Q%R^9%W%VViWiRiVWiRSSSSSj8^W3`iWijjj71jF7c7n`Scnnnnfj;jSf;F;nSFS|S||S-S,nSnSTTTTTh)ThTTTT'vvvvvTv3&3vvmmvmTTuuuuuuuuuu]]]]uuuuuuvuuuuuwwwwww44ww{{{{{w{{{{eeee{w#####{|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}$$$$$@}}}}}}}}}}}}}}}}@}}}}}@@(((((4444455555~oCB@?9720,+)@@66666  @:::::AAA      1H (1H(.....JJKKKKK>>>>>          .(      LLLLLU.>]Uj.]j          > > m  m PPPPPvrqpQQQQQnmig UUUUUEEEEEVVVVVcb^\YSEbbbbbcccccNM@EEdddddjjjjj>30.*&!kkkkklllllppppp|| \\\\\\\yyyyyyyy\vvvvvyyvvv{{{{{{}}}}}{{{{}}}~~~~~xxxxxxxxxxxxxxxx~xxxxx~~*****------5555555BBBBBBCCCCCC            ((((()))))*****             ...../////()*00000       .      ./.MMMMMTTTTT0TTTM                                                                                  1111199999199988888:::::88:iiiii_____8ii8:_i:_;;;;;<<<<<=====>>>>>?????DDDDDEEEEE;<=>?DDEFFFFFDGGGGGHHHHHIIIIIJJJJJNNNNNFOOOOO           G NHIJNNO !!!!!!!!!!!!WWWWWyyyyyWWWyyy!"""""""""""W""#############$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&&&&&&&&&&&&&&&&&&&&&&&&&&+++++++++++++++++++++++++++222222222222222222222UUUUUUUUUUUUUXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYZZZZZZZZZZZZZ[[[[[[[[[[[[[\\\\\\\\\\\\$$$$$\]]]]]]]]]]]$]]^^^^^^^^^^^^^____________!!!!"""!""_``````````````````````!``````"``````aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaddddddddddddddddddddddddddddeeeeeeeeeeeeeeee%%%eeeeee%%%eeeeeellllllllllll)))%+++))++---+...--..lmmmmmmmmmmm)m+22222KKKK-22.K2LLLLLmnnnnnnnnnnnnIIIIIKIIILnoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooppppppppppppMMMMPPPMPPQQQRRRQQRRpqqqqqqqqqqqMqPQRqrrrrrrrrrrrrrssssssssssssstttttttttttttuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvzzzzzzzzzzzzz|||||||||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~                                                                                                                                                                                                                         #############################&&&&&&&&&&&&&&&&&&&&&&&&&,,,,,,,,,,,,,,,,,,,,,,,,,,,,,/////////////////////////////5555555555555666666666666677777777777778888888888888888888888888888888888888888888888888888888888888888888888888888888889999999999999:::::::::::::;;;;;;;;;;;;;<<<<<<<<<<<<<=============>>>>>>>>>>>>>??????????????????????????????????AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEEEEFFFFFFFFFFFFFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOOOOOOOOOSSSSSSSSSSSSSSSSSSSSSTTTTTTTTTTTTTTTTTTTTTVVVVVVVVVVVVVWWWWWWWWWWWWWXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[[[[[[[[[[[[[bbbbbbbbbbbbbbbbbbbbbcccccccccccccccccccccdddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeefffffffffffffffffffffggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooopppppppppppppppppppppqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrrruuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyy}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~~~~~~~~~~~~~                                             HH );Ok[WQ  /?"!,i9Ka~֝jבe  7CA f!*7ΑH^P}zdK5 _U^/%=kO[G)6F\I (QۚK5ަ5)n>5#F[umhH fxRhP fQlh\ fXOhh gOhx fOh fOh gOh f=Oh guOh gxPh gQlh gQlh gQlh gQlh gOh fhRi g8W8i gOi, grOi< fOiH gOiX gOi` fTPih gsOip fpQli| gOi f\R8iYi fOi g0W8i fRi gV@i gPi gPi gQli fSj fRj fOj fRj, flOj8 fQljD fQljP g Qlj\ fQljd fOjlYjt gOj[$j gOj fQlj fQlj gQlj gQlj fQlj fOj f>Oj fRk fSk gOk$ gOk0 fdRk8 gOk< gOkP g`V@k\ gRkh gQlkx f`Rk fQlk fDPk gQk[tk fOk fZOk fIOk gRk f8Q8k fRk gOk fOl fQll fQll gQll$ gRl0[l@ gOlT g\hl` fYOlt g$Qll g$Qll g Qll f4Ol ghVl g@Ol g(W8l fLQ8l\l gQll f]Hl f|Rl fQlm fHOm gQlm$ gOm4 g_hm@]mT fOmd f<Omx gXOm gRm gqOm gpOm gOm f@Om ftOm gOm_m gtOm f8Q8n gOn f[On gOn( fQln0`4n< gOnP`nX gHW8n` gPW8nl fOnt fRn fOn fRnZn fOn fV@n fR8rrrs$ eta %sABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZ234567 4<DTX`hpSuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \),Hex D_abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789(NULL)%s: unable to resolve bind address %s; disabling bind. %s (%s)Connecting to %s|%s|:%d... Connecting to %s:%d... Connecting to [%s]:%d... sock >= 0../../wget-1.15/src/connect.cconnected. Created socket %d. failed: %s. %s: unable to resolve host address %s Local socket fd %d bound. binding to address %s using port %i. Accepted client at socket %d. conaddr is: %s conaddr is: %s Closed fd %d fd >= 0../../wget-1.15/src/connect.cApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %s seconds. Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete %s: %s wbCannot convert links in %s: %s Something strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d ../orig.origCannot back up %s as %s: %s %d; URL=%s?#%;/index.htmlfile != NULL../../wget-1.15/src/convert.cDeleted old cookie (to be replaced.) Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s res != 0../../wget-1.15/src/cookies.cDiscarded old cookie. domainpathexpiresmax-age%lfsecureSyntax error in Set-Cookie: %s at position %d. cdm: 1 2 3 4 5 6.com.edu.net.org.gov.mil.int 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s ocnt == count../../wget-1.15/src/cookies.cpos == result_size../../wget-1.15/src/cookies.crCannot open cookies file %s: %s TRUETRUE%lfSaving cookies to %s. wCannot open cookies file %s: %s # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. :%d %s %s %s %.0f %s %s Error writing to %s: %s Error closing %s: %s Done saving cookies. byte==> PASV ... ==> EPSV ... ==> LPSV ... ==> PORT ... ==> EPRT ... ==> LPRT ... Length: %s (%s), %s (%s) remaining, %s remaining (unauthoritative) con != NULL../../wget-1.15/src/ftp.ccon->target != NULL../../wget-1.15/src/ftp.c!((cmd & DO_LIST) && (cmd & DO_RETR))../../wget-1.15/src/ftp.c(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0../../wget-1.15/src/ftp.canonymous-wget@Logging in as %s ... Error in server response, closing control connection. Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Error in server response, closing control connection. Server error, can't determine system type. done. VMS: I know it and I will use "LIST" as standard list command UNIX MultiNet: I know it and I will use "LIST" as standard list command UNIX TYPE L8: I know it and I will use "LIST -a" as standard list command ==> PWD ... Error in server response, closing control connection. /done. ==> TYPE %c ... Error in server response, closing control connection. Write failed, closing control connection. Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' Using two-step CWD for relative path. Using extra "CWD []" step for VMS server. []==> CWD (%d) %s ... Error in server response, closing control connection. Write failed, closing control connection. No such directory %s. done. ==> CWD not required. ==> SIZE %s ... Error in server response, closing control connection. done. File has already been retrieved. Error in server response, closing control connection. Write failed, closing control connection. Cannot initiate PASV transfer. Cannot parse PASV response. trying to connect to %s port %d couldn't connect to %s port %d: %s done. Error in server response, closing control connection. Write failed, closing control connection. socket: %s Bind error (%s). Invalid PORT. done. ==> REST %s ... Error in server response, closing control connection. Write failed, closing control connection. REST failed, starting from scratch. done. File %s exists. No such file %s. ==> RETR %s ... Error in server response, closing control connection. Write failed, closing control connection. No such file %s. done. ==> LIST ... Error in server response, closing control connection. Write failed, closing control connection. No such file or directory %s. .done. Lying FTP server found, adjusting. accept: %s ab%s: %s wb%s has sprung into existence. %s: %s %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. %s (%s) - Data transfer aborted. r%s: %s %s LIST returned more data than "LIST -a": I will use "LIST" as standard list command LIST returned less data than "LIST -a": I will use "LIST -a" as standard list command LIST returned the same amount of data of "LIST -a": I will use "LIST -a" as standard list command "LIST -a" failed: I will use "LIST" as standard list command File %s already there; not retrieving. (try:%2d)--%s-- %s %s => %s %s (%s) - written to stdout %s[%s] %s (%s) - %s saved [%s] %s URL: %s [%s] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing %s as listing tmp file. unlink: %s Removed %s. Recursion depth %d exceeded max. depth %d. f != NULL../../wget-1.15/src/ftp.cRemote file no newer than local file %s -- not retrieving. Remote file is newer than local file %s -- retrieving. The sizes do not match (local %s) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory %s. %s: unknown/unsupported file type. Unrecognized permissions for %s. %s: corrupt time-stamp. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to %s as it is excluded/not-included. ../Rejecting %s. Rejecting %s. Error matching %s against %s: %s No matches on pattern %s. Wrote HTML-ized index to %s [%s]. Wrote HTML-ized index to %s. fatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()out of dynamic memory in yy_create_buffer()out of dynamic memory in yy_create_buffer()out of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s CSSEOFSCDOCDCINCLUDESDASHMATCHLBRACEPLUSGREATERCOMMASTRINGINVALIDIDENTHASHIMPORT_SYMPAGE_SYMMEDIA_SYMCHARSET_SYMIMPORTANT_SYMEMSEXSLENGTHANGLETIMEFREQDIMENSIONPERCENTAGENUMBERURIFUNCTIONurl(Found @import: [%s] at %d [%s] Found URI: [%s] at %d [%s] %s: %s Loaded %s (size %s). %s %s Detected newlines in %s "%s"; changing to %s "%s" PASS--> %s --> PASS Turtle Power! --> %s USER331 s/key 331 opiekey PASSaddr->family == AF_INET../../wget-1.15/src/ftp-basic.cbuflen >= 6 * 4../../wget-1.15/src/ftp-basic.c%d,%d,%d,%d,%d,%daddr.family == AF_INET../../wget-1.15/src/ftp-basic.cPORTbuflen >= 21 * 4../../wget-1.15/src/ftp-basic.c%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%daddr.family == AF_INET || addr.family == AF_INET6../../wget-1.15/src/ftp-basic.cLPRTbuflen >= 4 + INET6_ADDRSTRLEN + 1 + 5../../wget-1.15/src/ftp-basic.c|%d|%s|%d|EPRTaddr != NULL../../wget-1.15/src/ftp-basic.cport != NULL../../wget-1.15/src/ftp-basic.cPASVaddr != NULL../../wget-1.15/src/ftp-basic.cport != NULL../../wget-1.15/src/ftp-basic.cLPSVs != NULL../../wget-1.15/src/ftp-basic.clpsv addr is: %s tmpprt[0] is: %d tmpprt[1] is: %d *port is: %d af == 6../../wget-1.15/src/ftp-basic.clpsv addr is: %s tmpprt[0] is: %d tmpprt[1] is: %d *port is: %d ip != NULL../../wget-1.15/src/ftp-basic.cport != NULL../../wget-1.15/src/ftp-basic.cEPSVrespline != NULL../../wget-1.15/src/ftp-basic.crespline is %s TYPECWDRESTRETRLIST -aLIST(skipping "LIST -a")(skipping "LIST")SYST VMSUNIX215 UNIX Type: L8215 UNIX MultiNet Unix Emulation V5.3(93)WINDOWS_NTWINDOWS2000MACOSOS/400PWD""SIZEtype=JanFebMarAprMayJunJulAugSepOctNovDecrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; size: %s; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. %s Skipping. rb%s: %s -- Name: '%s' :MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %s bytes r%s: %s Total of file name: '%s' file name-^: '%s' .DIRDirectory (nv) .DIR;1Directory (v) File Name: '%s' Getting additional line. EOF. Leaving listing parser. Blank line. Leaving listing parser. Non-blank in column 1. Must be a new file name? Null token. Leaving listing parser. Token: >%s<: Date. Time. Date time: >%s< Owner. Prot. perms = %0o. Ignored (size?). %d-%b-%Y %H:%M:%SWGET_TIMEZONE_DIFFERENTIALTime differential = %d. Timestamp: %ld rb%s: %s Unsupported listing type, trying Unix listing parser. wb%s: %s ���Index of /%s on %s:%d���

Index of /%s on %s:%d

  JanFebMarAprMayJunJulAugSepOctNovDec%d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s
pos >= al->faulty && pos < al->count../../wget-1.15/src/host.cindex == al->faulty../../wget-1.15/src/host.cip - al->addresses == cnt../../wget-1.15/src/host.cReleasing 0x%0*lx (new refcount %d). Deleting unused 0x%0*lx. Found %s in host_name_addresses_map (%p) Caching %s => %s %s (%s)Resolving %s... failed: %s. failed: No IPv4/IPv6 addresses for host. , , ... u->host != NULL../../wget-1.15/src/host.cal->refcount == 1../../wget-1.15/src/host.cto - (pool->contents + pool->tail) <= end - beg../../wget-1.15/src/html-parse.cch == '\'' || ch == 0x22../../wget-1.15/src/html-parse.cch == quote_char../../wget-1.15/src/html-parse.cch == '-'../../wget-1.15/src/html-parse.cch == '-'../../wget-1.15/src/html-parse.caappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaobjectoverlayscripttabletdthvideoaudiosourcehrefcodehrefsrcbackgroundhrefsrcsrcsrcsrchreflowsrcsrcsrcsrcdatasrcsrcbackgroundbackgroundbackgroundsrcpostersrcpostersrcreltypehttp-equivnamecontentactionstyle11%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge(%s, %s) -> %s %s: merged link "%s" doesn't parse. appending %s to urlpos. stylefirst != -1../../wget-1.15/src/html-url.chrefactionhrefrelstylesheetshortcut icontypetext/htmlnamehttp-equivrefreshcontentcontent-typecontentrobotscontentnone , nofollowstyle%s: %s Loaded %s (size %s). no-follow in %s: %d %s: %s Loaded %s (size %s). %s: Invalid URL %s: %s HTTP/1.1 p - request_string == size../../wget-1.15/src/http.c ---request begin--- %s---request end--- Failed writing HTTP request: %s. Auth-without-challenge set, sending Basic credentials. Found %s in basic_authed_hosts. Host %s has not issued a general basic challenge. AuthorizationInserted %s into basic_authed_hosts [writing BODY file %s ... rbwritten == promised_size../../wget-1.15/src/http.cdone] HTTPNo headers, assuming HTTP/0.9HTTP%s%s bytesSkipping %s bytes of body: [] aborting (%s). %.*s] done. filenameDisabling further reuse of socket %d. Registered socket %d for persistent reuse. File %s already there; not retrieving. GETHEADRefererCache-Controlno-cache, must-revalidatePragmano-cacheRangebytes=%s-User-AgentWget/%s (%s)User-AgentAccept*/*%s[%s]%s:%d[%s]:%dHostConnectionCloseConnectionKeep-AliveConnectionCloseProxy-ConnectionKeep-AliveContent-Typeapplication/x-www-form-urlencodedBODY data file %s missing: %s Content-LengthCookieProxy-AuthorizationReusing existing connection to [%s]:%d. Reusing existing connection to %s:%d. Reusing fd %d. Authorization%s: unable to resolve host address %s [BODY data: %s] %s request sent, awaiting response... No data received. Read error (%s) in headers. ---response begin--- %s---response end--- %d %s ERROR %d: %s. Malformed status lineIgnoring response %2d %s Content-LengthConnectionCloseTransfer-Encodingchunkedwget_cookie_jar != NULL../../wget-1.15/src/http.cSet-CookieSet-CookieContent-TypeWWW-AuthenticateWWW-AuthenticateUnknown authentication scheme. BasicAuthorizationNTLMBasicContent-DispositionParsed filename from Content-Disposition: %s .origMalformed status line(no description)Content-TypeLocationLast-ModifiedContent-RangeLocation: %s%s unspecified [following]postposttext/htmltext/htmlapplication/xhtml+xmlapplication/xhtml+xmltext/csstext/css.html.css The file is already fully retrieved; nothing to do. Length: (%s), %s (%s) remaining, %s remainingignoredunspecified [%s] ab%s: %s wb%s has sprung into existence. %s: %s Saving to: %s STDOUTlocal_file == NULL || *local_file == NULL../../wget-1.15/src/http.cWarning: wildcards not supported in HTTP. Spider mode enabled. Check if remote file exists. (try:%2d)--%s-- %s %s --%s-- %s Cannot write to %s (%s). Required attribute missing from Header received. Username/Password Authentication Failed. Cannot write to WARC file. Cannot write to temporary WARC file. Unable to establish SSL connection. Cannot unlink %s (%s). ERROR: Redirection (%d) without location. %s: Remote file does not exist -- broken link!!! %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file %s -- not retrieving. The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists. %s URL: %s %2d %s %s (%s) - written to stdout %s[%s/%s] %s (%s) - %s saved [%s/%s] %s URL:%s [%s/%s] -> "%s" [%d] %s (%s) - written to stdout %s[%s] %s (%s) - %s saved [%s] %s URL:%s [%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %TC%s:%sBasic realmopaquenonceqopalgorithmauthUnsupported quality of protection '%s'. MD5MD5-sessUnsupported algorithm '%s'. ::MD5-sess%08x:::authauth-int%08x::00000001:::::authDigest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", qop=auth, nc=00000001, cnonce="%s"Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="%s", algorithm="%s"BasicDigest.%d%sacceptacceptregexaddhostdiradjustextensionalwaysrestaskpasswordauthnochallengebackgroundbackupconvertedbackupsbasebindaddressbodydatabodyfilecachechooseconfigconnecttimeoutcontentdispositioncontentonerrorcontinueconvertlinkscookiescutdirsdebugdefaultpagedeleteafterdirprefixdirstructdnscachednstimeoutdomainsdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpuserglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsproxyhttpuserignorecaseignorelengthignoretagsincludedirectoriesinet4onlyinet6onlyinputirikeepsessioncookieslimitrateloadcookieslocalencodinglogfileloginmaxredirectmethodmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppasswdpasswordpostdatapostfilepreferfamilypreservepermissionsprogressprotocoldirectoriesproxypasswdproxypasswordproxyuserquietquotarandomwaitreadtimeoutreclevelrecursiverefererregextyperejectrejectregexrelativeonlyremoteencodingremovelistingreportspeedrestrictfilenamesretrsymlinksretryconnrefusedrobotssavecookiessaveheadersserverresponseshowalldnsentriesspanhostsspiderstrictcommentstimeouttimestampingtriestrustservernamesunlinkuseproxyuseruseragentuseservertimestampsverbosewaitwaitretrywarccdxwarccdxdedupwarcdigestswarcfilewarcheaderwarckeeplogwarcmaxsizewarctempdirno_proxyHOMEWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrcr%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Syntax error in %s at line %d. %s: Unknown command %s in %s at line %d. SYSTEM_WGETRCParsing system wgetrc file (env SYSTEM_WGETRC) failed. Please check '%s', or specify a different file using --config. /usr/local/etc/wgetrc/usr/local/etc/wgetrcParsing system wgetrc file failed. Please check '%s', or specify a different file using --config. /usr/local/etc/wgetrc%s: Warning: Both system and user wgetrc point to %s. 0 <= comind && ((size_t) comind) < countof (commands)../../wget-1.15/src/init.cSetting %s (%s) to %s val != NULL../../wget-1.15/src/init.c%s: Invalid --execute command %s %s: %s: Invalid boolean %s; use `on' or `off'. %s: %s: Invalid number %s. infinf%s: %s: Invalid byte value %s %s: %s: Invalid byte value %s %s: %s: Invalid time period %s %s: %s: Invalid header %s. %s: %s: Invalid WARC header %s. IPv4IPv6none%s: %s: Invalid value %s. %s: %s: Invalid progress type %s. posix%s: %s: Invalid value %s. unixwindowslowercaseuppercasenocontrolascii%s: %s: Invalid restriction %s, use [unix|windows],[lowercase|uppercase],[nocontrol],[ascii]. bits%s: %s: Invalid value %s. %s: %s: Invalid value %s. %s: %s: %s base == 8 || base == 16../../wget-1.15/src/log.cwget-log %s received, redirecting output to %s. %s received. %s: %s; disabling logging. acceptacceptaccept-regexacceptregexadjust-extensionadjustextensionappend-outputask-passwordaskpasswordauth-no-challengeauthnochallengebackgroundbackgroundbackup-convertedbackupconvertedbackupsbackupsbasebasebind-addressbindaddressbody-databodydatabody-filebodyfilecacertificatecadirectorycachecachecertificatecertificatetypecheckcertificateclobberconfigchooseconfigconnect-timeoutconnecttimeoutcontinuecontinueconvert-linksconvertlinkscontent-dispositioncontentdispositioncontent-on-errorcontentonerrorcookiescookiescut-dirscutdirsdebugdebugdefault-pagedefaultpagedelete-afterdeleteafterdirectoriesdirstructdirectory-prefixdirprefixdns-cachednscachedns-timeoutdnstimeoutdomainsdomainsdont-remove-listingdot-styledotstyleegd-fileegdfileexclude-directoriesexcludedirectoriesexclude-domainsexcludedomainsexecutefollow-ftpfollowftpfollow-tagsfollowtagsforce-directoriesdirstructforce-htmlforcehtmlftp-passwordftppasswordftp-userftpuserglobglobheaderheaderhelphost-directoriesaddhostdirhtml-extensionadjustextensionhtmlifyhtmlifyhttp-keep-alivehttpkeepalivehttp-passwdhttppasswordhttp-passwordhttppasswordhttp-userhttpuserhttpsonlyignore-caseignorecaseignore-lengthignorelengthignore-tagsignoretagsinclude-directoriesincludedirectoriesinet4-onlyinet4onlyinet6-onlyinet6onlyinput-fileinputiriirikeep-session-cookieskeepsessioncookieslevelreclevellimit-ratelimitrateload-cookiesloadcookieslocal-encodinglocalencodingmax-redirectmaxredirectmethodmethodmirrormirrornono-clobbernoclobberno-parentnoparentoutput-documentoutputdocumentoutput-filelogfilepage-requisitespagerequisitesparentpassive-ftppassiveftppasswordpasswordpost-datapostdatapost-filepostfileprefer-familypreferfamilypreserve-permissionspreservepermissionsprivatekeyprivatekeytypeprogressprogressprotocol-directoriesprotocoldirectoriesproxyuseproxyproxy__compatuseproxyproxy-passwdproxypasswordproxy-passwordproxypasswordproxy-userproxyuserquietquietquotaquotarandom-filerandomfilerandom-waitrandomwaitread-timeoutreadtimeoutrecursiverecursiverefererrefererregex-typeregextyperejectrejectreject-regexrejectregexrelativerelativeonlyremote-encodingremoteencodingremove-listingremovelistingreport-speedreportspeedrestrict-file-namesrestrictfilenamesretr-symlinksretrsymlinksretry-connrefusedretryconnrefusedsave-cookiessavecookiessave-headerssaveheaderssecureprotocolserver-responseserverresponsespan-hostsspanhostsspiderspiderstrict-commentsstrictcommentstimeouttimeouttimestampingtimestampingtriestriesunlinkunlinktrust-server-namestrustservernamesuse-server-timestampsuseservertimestampsuseruseruser-agentuseragentverboseverboseverboseverboseversionwaitwaitwaitretrywaitretrywarc-cdxwarccdxwarc-dedupwarccdxdedupwarc-digestswarcdigestswarc-filewarcfilewarc-headerwarcheaderwarc-keep-logwarckeeplogwarc-max-sizewarcmaxsizewarc-tempdirwarctempdiropt->argtype != -1../../wget-1.15/src/main.co <= countof (long_options)../../wget-1.15/src/main.cUsage: %s [OPTION]... [URL]... Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print lots of debugging information. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --no-verbose turn off verboseness, without being quiet. --report-speed=TYPE Output bandwidth as TYPE. TYPE can be bits. -i, --input-file=FILE download URLs found in local or external FILE. -F, --force-html treat input file as HTML. -B, --base=URL resolves HTML input-file links (-i -F) relative to URL. --config=FILE Specify config file to use. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O, --output-document=FILE write documents to FILE. -nc, --no-clobber skip downloads that would download to existing files (overwriting them). -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. --no-use-server-timestamps don't set the local file's timestamp by the one on the server. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --random-wait wait from 0.5*WAIT...1.5*WAIT secs between retrievals. --no-proxy explicitly turn off proxy. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --no-dns-cache disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. --ignore-case ignore case when matching files/directories. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --user=USER set both ftp and http user to USER. --password=PASS set both ftp and http password to PASS. --ask-password prompt for passwords. --no-iri turn off IRI support. --local-encoding=ENC use ENC as the local encoding for IRIs. --remote-encoding=ENC use ENC as the default remote encoding. --unlink remove file before clobber. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. --protocol-directories use protocol name in directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-password=PASS set http password to PASS. --no-cache disallow server-cached data. --default-page=NAME Change the default page name (normally this is `index.html'.). -E, --adjust-extension save HTML/CSS documents with proper extensions. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --max-redirect maximum redirections allowed per page. --proxy-user=USER set USER as proxy username. --proxy-password=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-cookies don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --keep-session-cookies load and save session (non-permanent) cookies. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --method=HTTPMethod use method "HTTPMethod" in the header. --body-data=STRING Send STRING as data. --method MUST be set. --body-file=FILE Send contents of FILE. --method MUST be set. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --content-on-error output the received content on server errors. --auth-no-challenge send Basic HTTP authentication information without first waiting for the server's challenge. FTP options: --ftp-user=USER set ftp user to USER. --ftp-password=PASS set ftp password to PASS. --no-remove-listing don't remove `.listing' files. --no-glob turn off FTP file name globbing. --no-passive-ftp disable the "passive" transfer mode. --preserve-permissions preserve remote file permissions. --retr-symlinks when recursing, get linked-to files (not dir). WARC options: --warc-file=FILENAME save request/response data to a .warc.gz file. --warc-header=STRING insert STRING into the warcinfo record. --warc-max-size=NUMBER set maximum size of WARC files to NUMBER. --warc-cdx write CDX index files. --warc-dedup=FILENAME do not store records listed in this CDX file. --no-warc-digests do not calculate SHA1 digests. --no-warc-keep-log do not store the log file in a WARC record. --warc-tempdir=DIRECTORY location for temporary files created by the WARC writer. Recursive download: -r, --recursive specify recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links make links in downloaded HTML or CSS point to local files. --backups=N before writing file X, rotate up to N backup files. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. --accept-regex=REGEX regex matching accepted URLs. --reject-regex=REGEX regex matching rejected URLs. --regex-type=TYPE regex type (posix). -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. --trust-server-names use the name specified by the redirection url last component. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . GNU Wget %s, a non-interactive network retriever. %dd %dh %dm %ds%dh %dm %ds%dm %ds%ssPassword for user %s: Password: prefix != NULL../../wget-1.15/src/main.cline != NULL../../wget-1.15/src/main.cline_length > TABULATION../../wget-1.15/src/main.c%s %*c%s Wgetrc: Locale: Compile: Link: GNU Wget %s built on %s. %s %s %s (env) %s (user) %s (system) Copyright (C) 2011 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Originally written by Hrvoje Niksic . Please send bug reports and questions to . Memory allocation problem configExiting due to error in %s Try `%s --help' for more options. logfileverbose0addhostdir0dirstruct0noclobber1noparent1%s: illegal option -- `-n%c' Try `%s --help' for more options. removelisting0Both --no-clobber and --convert-links were specified, only --convert-links will be used. Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. %sWARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. %sWARNING: timestamping does nothing in combination with -O. See the manual for details. File `%s' already there; not retrieving. WARC output does not work with --no-clobber, --no-clobber will be disabled. WARC output does not work with timestamping, timestamping will be disabled. WARC output does not work with --spider. WARC output does not work with --continue, --continue will be disabled. Digests are disabled; WARC deduplication will not find duplicate records. dotCannot specify both --ask-password and --password. %s: missing URL Try `%s --help' for more options. You cannot specify both --post-data and --post-file. You cannot use --post-data or --post-file along with --method. --method expects data through --body-data and --body-file optionsYou must specify a method through --method=HTTPMethod to use with --body-data or --body-file. You cannot specify both --body-data and --body-file. HEADspider1spidermethodPOSTmethodbodydatabody-databodyfilebody-fileThis version does not have support for IRIs Memory allocation problem DEBUG output created by Wget %s on %s. -k can be used together with -O only if outputting to a regular file. %s: %s. Removing file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Total wall clock time: %s Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! .netrc%s/%sr%s: Cannot read %s (%s). loginpasswordmacdefaccount%s: %s:%d: warning: %s token appears before any machine name accountdefaultloginmacdefmachinepassword%s: %s:%d: unknown token "%s" dotbarbardot %*s[ skipping %sK ] %6sK ,dp->dots < opt.dots_in_line../../wget-1.15/src/progress.c%3d%% %4.*f%c %s=%s=%ss %6sK . %6sK defaultbinarymegagigaInvalid dot style specification %s; leaving unchanged. percentage <= 100../../wget-1.15/src/progress.c%2d%% 100% dlsz <= progress_size../../wget-1.15/src/progress.cinsz <= dlsz../../wget-1.15/src/progress.c %sB/sKB/sMB/sGB/sb/sKb/sMb/sGb/s %4.*f%s --.-K/s in %ss TERMforceemacsdot%ds%dm%s%ds%dh%s%dm%dd%s%dh%ddCannot get REALTIME clock frequency: %s Enqueuing %s at depth %d Queue count %d, maxcount %d. [IRI Enqueuing %s with %s Dequeuing %s at depth %d Queue count %d, maxcount %d. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. url_parsed != NULL../../wget-1.15/src/recur.cRemoving file due to %s in recursive_retrieve(): Removing %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". download_child_p: parent->url is: %s Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s is excluded/not-included through regex. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Removing %s. unlink: %s Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULL../../wget-1.15/src/recur.cnew_parsed != NULL../../wget-1.15/src/recur.cRedirection "%s" failed the test. wgetj == cnt../../wget-1.15/src/res.c!EOL (p)../../wget-1.15/src/res.cIgnoring malformed line %d user-agentallowdisallowIgnoring unknown field at line %d Cannot open %s: %s%s path %s because of rule %s. /robots.txtLoading robots.txt; please ignore errors. %s: %s. /robots.txtdeferring a %.2f ms sleep (%s/%.2f). sleeping %.2f ms for %s bytes, adjust %.2f ms !maxsize || maxsize >= bufsize../../wget-1.15/src/retr.cremain >= 0../../wget-1.15/src/retr.cB/sKB/sMB/sGB/sb/sKb/sMb/sGb/s%.*f %ssecs >= 0../../wget-1.15/src/retr.cbytes >= 0../../wget-1.15/src/retr.cError parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. mynewloc != NULL../../wget-1.15/src/retr.c%s: %s. %d redirections exceeded. [IRI fallbacking to non-utf8 for %s [Couldn't fallback to non-utf8 for %s %s: %s. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: avg=%f,sleep=%f %s%s%d%s%s%d%s%s%dhttp_proxyftp_proxyFound no broken links. num_elems > 0../../wget-1.15/src/spider.cFound %d broken link. Found %d broken links. %s httphttp://ftpftp://p2 - newstr == newlen../../wget-1.15/src/url.cp2 - newstr == newlen../../wget-1.15/src/url.c@/?#;:/0123456789ftp://%shttp://%sNo errorUnsupported scheme %sScheme missingInvalid host nameBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric address*p == 0../../wget-1.15/src/url.cerror_code >= 0 && ((size_t) error_code) < countof (parse_errors)../../wget-1.15/src/url.curl_has_scheme (url)../../wget-1.15/src/url.chttpsHTTPS support not compiled inRemoving %s because of directory danger! %s: %s%2E%2Eq - TAIL (dest) == outlen../../wget-1.15/src/url.cindex.html..%2E%2EThe name is too long, %lu chars total. Trying to shorten... New name is %s. scheme_str != NULL../../wget-1.15/src/url.cp - result == size../../wget-1.15/src/url.cstr && *str../../wget-1.15/src/url.cc../../wget-1.15/src/url.cu1 && u2../../wget-1.15/src/url.cWARC/1.0 : Content-Length WARC-DateWARC-IP-Addresssha1:WARC-Block-DigestWARC-Payload-Digest%Y-%m-%dT%H:%M:%SZWARC-TypewarcinfoContent-Typeapplication/warc-fieldsWARC-DateWARC-Record-IDWARC-Filenamesoftware: Wget/%s (%s) format: WARC File Format 1.0 conformsTo: http://bibnum.bnf.fr/WARC/WARC_ISO_28500_version1_latestdraft.pdf robots: %s wget-arguments: %s %s Error writing warcinfo record to WARC file. warc%s-meta.%s%s-%05d.%s%s.%sOpening WARC file %s. wb+Error opening WARC file %s. %s .cdxa+ CDX a b a m s k r M V g u CDX rCDX file does not list original urls. (Missing column 'a'.) CDX file does not list checksums. (Missing column 'k'.) CDX file does not list record ids. (Missing column 'u'.) Loaded %d record from CDX. Loaded %d records from CDX. Could not read CDX file %s for deduplication. Could not open temporary WARC manifest file. Could not open temporary WARC log file. Could not open WARC file. Could not open CDX file for output. metadata://gnu.org/software/wget/warc/MANIFEST.txttext/plainCould not open temporary WARC file. %s metadata://gnu.org/software/wget/warc/wget_arguments.txttext/plainmetadata://gnu.org/software/wget/warc/wget.logtext/plainwgetwb+WARC-TyperequestWARC-Target-URIContent-Typeapplication/http;msgtype=requestWARC-Record-IDWARC-Warcinfo-ID---%s %s %s %s %d %s %s - %s %s %s WARC-TyperevisitWARC-Record-IDWARC-Warcinfo-IDWARC-Concurrent-ToWARC-Refers-ToWARC-Profilehttp://netpreserve.org/warc/1.0/revisit/identical-payload-digestWARC-TruncatedlengthWARC-Target-URIContent-Typeapplication/http;msgtype=responseWARC-Block-DigestWARC-Payload-DigestFound exact match in CDX file. Saving revisit record to WARC. WARC-TyperesponseWARC-Record-IDWARC-Warcinfo-IDWARC-Concurrent-ToWARC-Target-URIWARC-Block-DigestWARC-Payload-DigestContent-Typeapplication/http;msgtype=responseapplication/octet-streamWARC-TypeWARC-Record-IDWARC-Warcinfo-IDWARC-Concurrent-ToWARC-Target-URIContent-Typeresourcemetadata%s: %s: Failed to allocate enough memory; memory exhausted. %s: %s: Failed to allocate %ld bytes; memory exhausted. %s: aprintf: text buffer is too big (%ld bytes), aborting. %H:%M:%S%Y-%m-%d %H:%M:%Swget-logforkContinuing in background, pid %d. Output will be written to %s. /dev/nullr/dev/nullw/dev/nullwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink %s: %s rb*?[]htmlhtmhtml1,.%d%.*f%csig == SIGALRM../../wget-1.15/src/utils.cInvalid regular expression %s, %s Error while matching %s: %d %.0f%.1f%.1g%.3f0/pathconf+digest-https+ipv6-iri+large-file-nls-ntlm+opie-ssl1.15cc -DHAVE_CONFIG_H -DSYSTEM_WGETRC="/usr/local/etc/wgetrc" -DLOCALEDIR="/usr/local/share/locale" -I. -I../../wget-1.15/src -I../lib -I../../wget-1.15/lib -D_REENTRANT -Occ -O -lsocket -lnsl -lrt -luuid -lrt ftp-opie.o ../lib/libgnu.awrote %s to STORE literalshellshell-alwayscc-maybeescapelocaleclocaleUTF-8GB18030"`''fileTMPDIR/var/tmp//var/tmp//var/tmp//tmp/tmp/tmp%smemory exhaustedUnknown system error: %s%s: %s:POSIXLY_CORRECT--%s: option '%s' is ambiguous; possibilities: '--%s'%s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '--%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s: option '-W %s' requires an argument %s: option requires an argument -- '%c' /dev/ttyw+8node->next == NULL../../wget-1.15/lib/regcomp.cREG_VALID_INDEX (left)../../wget-1.15/lib/regcomp.cREG_VALID_INDEX (right)../../wget-1.15/lib/regcomp.c!IS_EPSILON_NODE (node->token.type)../../wget-1.15/lib/regcomp.calnum_space0../../wget-1.15/lib/regcomp.cupperloweralphaalnumcntrllowerspacealphadigitprintupperblankgraphpunctxdigitpmatch[0].rm_so == start../../wget-1.15/lib/regexec.cregs_allocated == REGS_FIXED../../wget-1.15/lib/regexec.cregs->num_regs >= nregs../../wget-1.15/lib/regexec.cerr == REG_ESPACE../../wget-1.15/lib/regexec.cerr == REG_ESPACE../../wget-1.15/lib/regexec.cREG_VALID_INDEX (num)../../wget-1.15/lib/regexec.ccharset.aliasCHARSETALIASDIR/usr/local/libr%50s %50sASCIIXXXXXX! "invalid KIND in __gen_tempname"../../wget-1.15/lib/tempname.c(NULL) 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000000000 0|0y$0v00s<0pH0mT0j`0gl0dx0a0^0[0X0U0R0O0L0I0F0C0@0=0: 07,04801D0.P0+\0(h0%t0"00000)AVj  ;d  ooZoZZ oo +,+4+<+D+L+T+\BBB B$B(B4B@BHBPBXB`BhBpBxBBBBBBBBBBBBBCCC DD IIIIIIIIIIIINNNNNNNNNNNNRSSS`SS S(S0S4( S< SD SL SP SXS`Sh¬SpSxSSSSSSSSSSSSSSS S S S S T T TT TTTT(T4T@TDTLTPTXT\T`ThTtT|TTZ<Z@ZHZPfff$f4fX :0f` :4fh :8fp :<ft :@tAttttEu uau,u<uHu\ulbuxuKuuuuBuuuuuuvvv$v0v8v@vLv\vpvxvvvvcvvkvvvww$w4w<wDwPwXdw`whwxwwwwwPwwwwwxDxxx,x8xDxPxXXxlxxxexxxxxxxxFyyy y,y8y@yHyPyXy`h}yhy|yEyyyyyyyyzzz z,z8zDzPz`zpz|zIzz4zz6zzizzzz{{(l{0{<{H{T{d{p{{{{{{m{{n{{{{|O|| o|,|4p|D|T|\|h|t|||||||||}}}$}0}<}T}h}p}|Y}}}}}}}}q}~Q~~~~(~4~@~P~\r~h~t~|~~~R~~~~L~~~$4@ThxSH$08@P`ThpNt U ,v4<DLVTw\dp|$0@ G$0t $@t$dL48D4,h4xP0X0T\4xLP`,p0 ` p TX(x|,xH0l|\pL$pXd0d\D4d KMG $,4TX`hpt|@HP PT :/(<L`„¤PPPPPPPPPPPPPPPP`````` KMGTPE (0AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE dd H? (ANY)permanentsessionsecureinsecurenoneFALSETRUETRUEFALSE @%s 12:@@(nil)EOF receivedsolaris2.9ProxyHTTP0123456789abcdef0123456789abcdef/usr/local/etc/wgetrc/aw0123456789ABCDEF0123456789ABCDEFwget-logsolaris2.9/usr/local/etc/wgetrc01noparentnoclobber01solaris2.9abwbSIGHUPSIGUSR1WTF?!.netrc None--delete-after--spiderrecursive rejection criteriaAllowingRejecting...Found %d broken links. Found %d broken link. 0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF?@*password*solaris2.9classicoffLoaded %d records from CDX. Loaded %d record from CDX. wbw.‘’e"'/%.*sXXXXXX%s:%d: invalid KIND in __gen_tempnamecg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)inet.h 1.18 01/01/04 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.9 92/07/14 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.9 92/07/14 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)ucontext.h 1.29 04/03/27 SMI@(#)regset.h 1.25 00/09/14 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)ucontext.h 1.29 04/03/27 SMI@(#)regset.h 1.25 00/09/14 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.9 92/07/14 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.9 92/07/14 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)uuid.h 1.1 02/10/10 SMI@(#)uuid.h 1.1 02/10/10 SMI@(#)libgen.h 1.15 97/02/12 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)mman.h 1.42 02/06/18 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.39 07/05/30 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)ucontext.h 1.29 04/03/27 SMI@(#)regset.h 1.25 00/09/14 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)setjmp.h 1.36 99/08/10 SMI@(#)setjmp_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27acomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/04 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27acomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wctype.h 1.18 99/08/10 SMI@(#)wctype_iso.h 1.1 99/08/09 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)netdb.h 1.26 03/02/14 SMI@(#)in.h 1.37 07/11/05 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.99 04/06/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.22 09/05/19 SMI@(#)uio.h 1.31 09/05/12 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.16 06/08/05 SMI@(#)socket.h 1.59 04/03/24 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)unistd.h 1.60 01/07/29 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stdio_ext.h 1.2 99/06/10 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.39 07/05/30 SMI@(#)ttydev.h 1.7 92/07/14 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)limits.h 1.53 03/08/07 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)langinfo.h 1.10 94/11/21 SMI@(#)nl_types.h 1.14 00/09/16 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wctype.h 1.18 99/08/10 SMI@(#)wctype_iso.h 1.1 99/08/09 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)pthread.h 1.32 01/11/10 SMI@(#)sched.h 1.9 98/01/16 SMI@(#)alloca.h 1.15 99/03/11 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 01/08/01 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)float.h 1.18 99/05/04 SMI@(#)langinfo.h 1.10 94/11/21 SMI@(#)nl_types.h 1.14 00/09/16 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)langinfo.h 1.10 94/11/21 SMI@(#)nl_types.h 1.14 00/09/16 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stat.h 1.4 03/06/01 SMI@(#)stat_impl.h 1.3 03/06/01 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)pthread.h 1.32 01/11/10 SMI@(#)types.h 1.75 04/01/06 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)sched.h 1.9 98/01/16 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27cg: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27@(#)stddef.h 1.16 99/08/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.72 05/01/24 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)limits.h 1.53 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.29 03/10/14 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.9 SunOS_sparc Patch 124867-16 2010/08/11iropt: Sun Compiler Common 12 SunOS_sparc Patch 124861-22 2012/03/27ld: Software Generation Utilities - Solaris Link Editors: 5.9-1.401.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.dynamic.data1.symtab.strtab.debug_info.debug_line.debug_abbrev.comment.shstrtab  &";d;doZZ-BZZ  8BZZ$ BBZZ LbxbxdRX ^@f%%o G  t 2 4 } = R^