ELF@4lX4 (44dFdFdHdH;Kj8j8/usr/lib/ld.so.1  !"#')+./013589:<=?@CDEGKLNORTVXYZ\^_abcdefijkloqrstuvxyz{|}~    !$&'(*+-./02345678:;<>?BDEFJMNOPQSTVX[]^_aefhijklmnorsvwyz{|}~ $%&(*,-2467;>ABFHIJMPQSUW[]`ghmnpw  "#%),19=@ACGHIKLRUWYZ\`bcdgpqtux̀ d9 )g|38 B` U(H mB  whgdҔ0 PX iel4L hhej` dHdH` %X 5e`: Gh`OhW{ eV m |    e`D, h[ x  d   d ffP&h$  e6g? IeTOT _ o%  g(-P\ `pT (\X _H #h )T iDB h<&h! ) 9ڬ, I U)gm fyf*PgpHeh xx kl4 |h h h$L 2  "[x0 ,e 8hAQ `D p4\ vdLft  jx| )[@  iH    #H #D, /)6d<; JD W` `)ud|P,  t e<  itQ` k0X  U | ] "i)D 4E4 <C FC t Q \'D i|< uhx ~SLh i & p fDk<l < dF fiML '< e0(  (F$ /i5X Hg4O=8t [hbj  w P e  dfhh( )gPt @  f , ' 8,D QeZgL`k8lfMgx8   u  7xd =8 h : D  (P k *5 84 E H@ Pf, [i8 be j۰4 xiP ~}H *l d| D  T  g @   hL  )r4 7g ?W GE4 X0 h0 y]T` NXx e<  h0 g 4$  t  El g i   %gX ,f 7f =Rh Gf N Yf  `x xf ~e  aD f ԰, h X i t h h g@ A d R $0 ,h :e @f HZx R| `g h< qi y) T , o( %,$ c !  ! [4 k0! $ "e )C 10d ?%` Ti [ b8 3D  l0 u` *L h (X@! pL  i\ ^L ex d k $i.)6h| F Nih ci,Uhl_(4 uf\}\  it e5h h߸ lX  @ M@ &\   0D O 13x ;  J QgX)`g8 oU  P kgDD )X   D8 8 e$ (7, 5j8h8 > Q Z)edlgrd4 |H 0 XD j 6h Bi <x Ÿ P d jg\  @   meH,]Hd 8( 0f8GeO%P| ci @ mj(")@ ψD hHx l  , ΈT ܴd fthT)/<@ AK   OiZpd 7dc. yd | (H  , g $ (X@fftp_login__xnet_connectres_match_pathinet_ntopread_file_freeprint_broken_linksaddress_list_get_bounds.ld_llong__div64getenvbase64_encodefd_read_lineioctlfclosestring_set_to_arrayclock_getresvfprintf__flsbufurl_freeftp_process_type_GLOBAL_OFFSET_TABLE_setsockoptftp_pasvhas_wildcards_precv_sch_istableMD5Init__mul64url_file_namefd_readare_urls_equal_finidatetime_strlog_initunlinkspider_cleanupfilenosleep_between_retrievalssuffixrandom_numberlog_set_save_contextunique_create_getopt_internalsymlinkstrchrscheme_disablevsnprintfftp_systfwritestring_set_freeescnonprint_urihash_table_iteratelocaltimeprint_addressnonexisting_urloptindaddress_list_address_aturl_uses_proxyretrieve_treeaddress_list_set_faultymkdir.ld_floatfstat64optoptptimer_readcookie_jar_savechecking_mallocescnonprintftp_last_resplinehtml_quote_stringmemcmp_endgetaddrinfoscheme_default_portvalid_progress_implementation_pregister_htmlhome_dirftp_portversion_stringisattyfree_veclookup_hosthas_html_suffix_pprintwhatgetsocknamestrftimeretryable_socket_connect_errorprogress_finishtouch_PROCEDURE_LINKAGE_TABLE_lstat64url_set_filechecking_strdupextract_paramexec_namefd_closeinitializesrand48stable_sort_lib_versionptimer_measurehash_table_removestrdupdelimoptarg_exitres_get_specshttp_cleanupftp_type__getopt_initializedstrcmpsocket_ip_addresssearch_netrcfile_mergememcpyfork_to_backgroundlocaleconvcalc_rate_environconcat_stringsfd_register_transportread_whole_linerotate_backupscalloc.st_doublememrchr.st_llong.ld_doublematch_tailhash_pointerunique_nameMD5Finaltest_socket_openftello64make_string_hash_tablegetoptstrrchr___Argvhttp_loopmerge_vecs_etextdrand48fd_read_hunknumber_to_stringgetpeernamestring_set_containstimegmutimeretrieve_from_filemktimeres_cleanupstrspnregister_redirectionlogputsfopen_exclstrcpygen_md5_initabortqsorturi_merge_edatadownloaded_html_setgetpwuidftp_responsestring_set_addmake_directorystrtollhash_table_getmake_nocase_string_hash_tableaddress_list_releasegai_strerrorfgetc__cg92_usedstrncasecmpfile_exists_pset_progress_implementationmkalldirsres_parse_from_fileis_robots_txt_urlcookie_jar_loadres_register_specsprogress_create_sch_toloweroutput_streamurl_parseaccept_domainsave_cookiesptimer_newstrcasecmpfdopenfopen64checking_freefgetscookie_handle_set_cookieaddress_list_connected_patexitrun_commandhash_table_get_pair__fsr_init_valuefreeaddrinfofd_read_bodygetopt_longregister_downloadftp_retrurl_full_pathmemmovefd_peek.st_float_foreffprogress_updatechecking_malloc0get_urls_htmlbind_localselectcookie_jar_deletestrptimeprogress_handle_sigwinchgetopt_long_onlyurl_set_dir.st_double_foreffsetlocalerewrite_shorthand_urlftp_restfflushurl_schemechmodselect_fdstrstrurl_stringsscanfnumber_to_static_stringfputcstrlenprogress_schedule_redirectcleanup_html_urlfnmatchlog_cleanup__sysconf_xpg5get_etafseeko64ftp_parse_ls__rem64setsidatoi.ld_int___errnoretrieve_urlftp_cwdclock_gettimefputsstrpbrkfd_errstrxstrdup_lowerstrncpyftp_eprtlrand48total_downloaded_bytesfree_keys_and_valueslogflushcookie_jar_newhash_table_clearurl_escapeptimer_resolutionhash_table_putconvert_all_linksschemes_are_similar_prename.st_intcookie_headerhash_table_iter_nextgetpidxsleepsepstringsubdir_phash_table_containsaddress_list_set_connectedfork__ioburl_error__1cG__CrunMdo_exit_code6F_v_run_with_timeoutmmap64get_urls_file__assertskey_responseconvert_cleanupsetitimer__xargvdebug_logprintfaprintfmunmapMD5Updateaddress_list_containsstrncmplog_set_flushremove_linksigsetjmpftp_lprtlistenfreopen64ftp_epsvftp_indexftp_pwdvec_appendconnect_to_hosthash_table_countgen_md5_updateprint_decimalaccept_connectionres_parseptimer_destroyopterrgetuid__xargcurl_has_schemefd_transport_contextchecking_realloc__environ_lockstrcat.st_floatoutput_stream_regularfd_writeprogress_interactive_plog_request_redirect_outputhash_table_newacceptacceptablehost_cleanup_DYNAMIChash_table_destroyftp_lpsvnetrc_listmemsetfreadread_filemap_html_tagsfile_non_directory_pregister_delete_filesufmatchhttp_atotmftp_loopretr_rate__xnet_socketwith_thousand_seps__dtollfile_sizesetoptval_start_sch_toupperfree_urlposfnmatch_nocasesprintfhash_table_for_eachnanosleep_get_exit_frame_monitortotal_download_timebase64_decoderandom_floatsignalaccdirdownloaded_filegen_md5_context_sizeftp_sizedetermine_screen_widthlog_closememchrperrordl_url_file_mapres_retrieve_fileconnect_to_ipsiglongjmpnumdigitis_valid_ipv6_address__xnet_bindgen_md5_finishfree_netrchuman_readableptimer_resetstrtokftp_listreadlinklibmd5.so.1SUNW_1.1libsocket.so.1SUNW_1.4libnsl.so.1SUNW_1.7librt.so.1SUNW_1.2libc.so.1SUNW_1.18SUNWprivate_1.1libdl.so.1 =' =' ='  ='!*y4 Nq>kD!)k(Xd|ddlddYdddqdeddee Xe5e$Qe0e<eHmeT2e`elex%e#eeLe/eeueeeeeqfff f,f8pfDfP-f\0fhftfIfHffff^ff,fffgg0gg(6g4g@gLgXgd gpKg|ggggZgggJgDgghhh 6h%h$Sh0h<@hHyhTh`hl.hxhhh hhhhhYhhh7iii i,-i8iD>iPi\#ih,itxi iieiiii(i3isi`ijgj`jj(u @"aD"aZ"c<, @'Z0 $0+`-` `?-)Z#4- =--% # @@Ð#Z#@ Z#D@@@ia@@ "      **`* @*  ""  "     + **      + **     **   㿘 "    //// 77㿘 "" "   ////    ////   7777 `" 2 2 *@2 *`2 *`*`2@2`""2 2 **2 **2`*2`*2`**222`22"㿘`" 6 6 6 6 .@.`.`.`'6@6`'㿘" &"6 6 6 6 ....6`6`6`....?6`6666?&`" 2 2 2 2 *@*`*`*`2@2`"""2 2 2 2 ****2`2`2`****2`2222" @#`K` @#`   gl'?`d b?z!Z@::  8: " "@ ~#8N* * *9  `@ *` !Y@:9 " *`#@ (@ * 2 !Y @:9 "@*#@ + *! `?+` +`# *@ (?*` `  `(@) "`* *`( #@* * @ **`@?㿠```"@) @(  6 6 `&   @ 6 6 `& `& ` & `& `&  ``"`@` "` "` " "` "` "` "`  "` "` "㿠 `" `" @㿠;gcc`  "6gc  .@:  '%#a`@d# . 7g@7  & & &  & & &@8d  . 㿠  @ & 㿐';R'bl'@"@ " ?? @y 2@s " 㽘@8@d @eg! @c˜a @c @L N @ b'?"%'@3 DN 9@'0ؔ5/@ct ` 7@c@ @@  ;@@ b@cU @?" 㿘@94 7@6@@6d @7`@@7!@7@7# @7@9 ֒5@7?5)̐ "?@c 㾘 '  @ '?? @  @!`H@+@? c -D@c`!'@s@? 7F @7r9"`@b`@\ @?㾘9S7#к!'@-`@ ?@& " ?@33c 5@b㾘!'@ 7@ 6 `&``"+'&` &`&` &`&` " @73@bb &`7 @6;@bxb@̀ @" c` *  @2    `? `? "  `? @ `? @ `? @ A.'H6 'L   /H;`@ `@$ 2J J'x7T`x  BF'|@ @f  @U 6 'x   /@'|'x @h `?㿠@^?@8 `㿠@M?@$ `㿠 @3?@ 㿠@(;c`9"@a㿠+ @b7gЬ"  "   @1 5g&А@39g#̺`'#́)bؒ"@# 㿠;g@2Lc 㿘'P;U'TaP@+U)#aЁ@%`` `#`#d`dŀ #`#d`d~  @ "     㿐'P#gc'T`P#h  #lhl2?ZH@ c???;`-Z @1?$?$?%H`#h #lhl ?   㿐'P#gc'T`P#h  #lhvl2?ZL@ c???;`-Z @1?$?$?%L`#h #lhRl ?    㿐g'Pc'T`  P L Z#P cPP'Z;`@1`&&$P` `* #h#l;`hl9``` ;``@` ```#@ݐ #h#l;`hl`;`e `@?㿠;gcЀ 3gc@1` `ƀ@j @v㿠%-gЀ@0ߒ`` `J@1@`&=㿈@q-'쀥`9@2!~-7'`* #`@d)g''#ܺ`   '% @0 ``J@_F`` #@_@@ .  $ a@0v " & @& ` (@_ "& & ``L@_|  &   2 @'@``@$`@p'%'@ p@_@p㿠7 㔺@_` ````2`"#@  @@ c @^@- @%@5@s 5@m@z 7ؐ @^є@@ ` )```m % @`` ``" `e`.`"P`_`@@` `@ ` @Q  ` l``@^@А@ΐ7``@T` `@ ` @)  /`@^@`-@֔ `  ` @^ L```2`` % `@^w```%$ @@@u `@^(@@ 9# @^@c#c @]j@`㿠N N`   /` JJ`   /J`'@1   `/`K``/,`@ %@@`  @` - @@ڐ  - '@㿘@` %* #`@@$@7g -* 7g#`@z@w؀`@0 &@@k"@!@. 9  @]@Z㿘N "' " + < ? $&`&-`@A@A %@!   & &/ @&@!㿘? +@:@ `a* #`@ K` &"   #"   "" `@*K` 㿘;a @@؁@ʐ* N`%* `#`, 5 % 3 F 2`% `#" ,`?"1,,,,`,,` ",,,,``N``ހ`%@,㿠N ;N`75 `O``N``@` # O``N`` O``/"O`O'`/9O`9 !$@`? 㿠@ ;a@.@Ő@Ð aZ`t@/!㿘;gcc܀`/@/ %`Ȁ@/{ &`@-z@5@-"`@.t@@ɐ@t@q`@-@-Q@.[@s@q@]@Z@-ޒ㿠;gc܀`/@/0 )g%#Ȁ@/( %``@-7`@-8 @5@2`@-50@@#$`㿘;gcc܀`7@/ &Ȁ`2@. 9'!@, @.@@V㿠;a @.ݐ ;'a@㿠;gcc܀`)@`@,`&`!Ȁ 5/-@@,+%a 7@@X @     Z  Z ZTXZ#\c` 㿠9g #2 @,}2  @.x &@,n  @@-㿐;gcԀ @.@. @@.2;g9g@,c'#ԁ㿠N  &<` > " `  2 ` ` N `耢&@`N`K o & # 3 2 ; a m p t q u<  +""!* &" * ,*  >" * &* * * * *  !`* N`  g< l...`* * * * *   `* * * * *  ` `N`ƀ<* 㿠@ @. & & 㿠@ ?"   g c 6 @ 㿠 " @  " @  " @  @@Ł㿠 @+`  @`2`@ 2 `   2 &&& 㿀 `@+q$ђ􀥠`&&``&` & @ZiL  &` &`@``' @+ `&  `-'f`` ` ` + --  ( "4@``7`#`t#\#d#h``@Z(㿘@, ,l&`%' `@* 5` @+`@@+19#;@Yaā3a@s!0`x'`@A# ;쀠@&`@&`@A ;! `+@k 쀧`쀦` "@K .'@]&`$@ "!`%`'@> 쀥 쀥@` "@@7&` @"t@ &쀡 쀢@ "* #`@/@@Mݐ?bg` &` .` c [` .` V%?-@ 8\c쀥?Q쀠M"@* #`@/@!@ΐ \#@6g` \Ș`.` DF&` J`  .` $` )"@ ` @.` @@4 ;2%N   7@ZA'@X   J  `⠅)  `2J  +   H +   H * @ 2 ."H * ` J``*  H`*@  H`+  2`."H (` 2H +  ``H` *`  H`` *  2`."H` * `` H` *  ``J` (`  `J` +  ``?㿠;cc`%@X=8i@`?)@X,"@@ڒ2 ` @XbD@i N   `. "M@XHM ."  `M.``"a M  @W"L&O `P@W"   2"N  #Zcdcd@   *`  )@W"N .N ." @;@8 "M. `7@W␰ 㿠@@ 㿘@; ;g /'c@ * #`*  @ S )@Xʐ)@X" @W#@o@[ P& . 2& @ / @& @A&  - `1"@W1  3 ZJ   *`;  ` K` 㿠@)   4 .   ޒ @'֒ &@  㿠@x@ `㿠 "  -`2   9 9"   @j"  ̐` 2'` 㿠 ``@` ` @2㿠.`5`'@/`̐@L && &@@`` @ @@"` @" ` `'``'``'`` ` ` @․@'@3*b]@=`= $`  ` "  㿐@  /*  #`*  @ے! . -`* #`' @ g "c? ` D  `@$ , & `* * #`,#+`" & @& &   `$`[F`b@ ?  @^ ` @Y @@$ ,`` @  = ; @D@A@?*@`@7@ ,  *`@$ .,`  @`.  ' c@#! # @$$㿠&@@5 : @  &L`b +  . ;b@`. ?Ѐ@ L` / . & `/#\,@Ő2 #`@@ # c0@T@ 3g&c@m`-'N` +`@ @ M ,@@2#〥  M  2'M M Ϻ  `O`ǀ 2`O````  #d O  2 dO    N  2@N  #h L  2 hL ` `   N  2 | @7M 2M%M "%@E$@A$d@=&$ ` '@T@A `? + `@.@,   c\@1 @ - ` * , 2$L.@ ga$bX#dJ?, @ha`P'g  B$`, \e\@<@m`2'`@h;c c#ch@T@ɐ 9g!#'#@ @a@n 1# @SƁc7g@@;@c@ @&@&N7fP'``3! >  >"4 .  .@@i #@ @@ #\ #` #h#d#l h@t   2 @&B2 `  @@ - @ST@6 @@ /0 @SE `5@S{H㿐 @& @&@ `2@&2@$ @l㿠;'D97b   D`DN>( D 'DJ 6(2DD'D@DI &*@ @ D'DK *`@2D   bЀD@2D    㿠M 5```-1' 쀤) h@R @ 쀥`/x@Q @ $7쀦 ;`@Q @&@`@ 㿈  2耧``/.) #쀤+`@QĐ @͒ 쀥1 @Q @ 9#쀦;`@Q @o@@ 㿠 @)9 @R> d  )@ @R3 @-f@ @ϒܐ @R @@f5@R  7fh@Qa;fb|@Q]0 2) `5!'26/ (8 ( ,' ' @XȖ   ;c` 'T' `f"' d` '#X'`d)f"'b`?'?  '  $` /f``  @~'   X?  @/n Ʈ  ' ' @S*!@Q a@PԐ @  $`@Đ  O "A3 2% 4 1!@P @P' !'@P @P|' "@P @Pp' H@P L@Pd'  bh-@P l@P|X'  ` b@Pp `/@Q  @*   " X57@PV @PS/' @PK @PG  ;c@P> ` @P  @i  "  " )'1$@P# #(@P '  @@`'   W @ [K @ ]E  ` #@Pc `c@P  /-)'@`& L"<`@"@&L@L /.**L* '`L . /*(L* ` ;c@P  %@Pd @O @w   @PS@J'  2"#14"7-@O `@Of' 83@O `<@O~Z'  h5@Ou l@PM'  `@Oe  L`'@OY 䢍 @P8 L `/H ` *"`L:<"j @  @J/ H /"@   / * #p@,`@ `  @O` ` @O 0@{ * #p@zL/ [L,   . /"(H  / ](( ` @OŐD ` ah@O  @Q/@Ou @'  4"#54"3!@N a@N' a-@N @N|' 7@N @P @O=m'  " @N R`` " $L b(@Nv E``@耣 % 쀡  @P $@@O   $@Ӕ   'e1#"T@NL bX@NI%'  쀠```@ff"@ @Nܒ '? ' j`{jܔ'$  8" 3#,)4"5#b-@N @N' 7@M @MԐ' ;@M c@M c @M #$@M 6  @#< #D@Nؐ꧔ 6 @  +' @#'ܨ@chؐ @Nh:   /@M ͐' 1 f T'?4"#@M c@Mf' cac@M~ @MzV' SQ`@Mm @@  @N@' =;9! @MV @@  @M*,1@MF  0@MC'  ` ? @@M1  p` U` c쀢  @L@Mǐ @)'  "2 " 3*&4"5$``-@M d@Lِ' ֐7@L @Lɐ' Ɛ%̤ @Lߐ   쀡 `@LՐ `  !/耤`3 c쀣 /@L !   x! 펐' 틐 'b耣  $ c쀣   @N $!@MC  $ $@ؐ'  ="+'41@L| a@LxT' QO!T@Ll !X@LhD' A?!@L[ @N $!@M1/c쀢@LG ֐ `"a/ 쀤`!@L6 @ '  <"+)O4"%I3-a@L @L' 7@L  @L ' "$9@K 5f"(@LӐ 쀣`"L@K xa   '  #! 2 '``ca@   `/@LT``@@ !"x@LX P  `PW`@s  @m "     @b, ??$?n@ ?b @z*0@ `1 "@LJ' GE  @Ӓ"2`@@ - @K/' ,* ``@`` &` " &`'Ѐ&`')   &` " &`''&`d@ &` " &`'Д '&` Ф #\#`#h#d@eB7@ @x} @i   a@8aP`  @V@@%  b@K}뭐' 몐 &낐ܐ@Kk?`@J 딐@ J `2@9@ 뀐@ gJ 2@(@K<9#4@J @2?a' ?`"Y ' "U '@q 1 @#L@@ 3 cP@K  '@{+&cX@ J? ""   " * J?  " @L@J @:@{kߐ@ '#@Jݖc @J- '   '! @팔  !a(@텔 ɔ%0X@~! (`@w! (@= @9 @5 @1 a,a<@`" [@&e @"@ @ @ @@<<<<<<<<$<<<<<<<<<<<<<<<<<<<<<<<ܝ ''@r& > @w   5\ @J/ @wq >+l `x  >   &'< ` % @ #` @j`"  && ?" && &`&  J `@ x@    @ @vր``#d@t  `@얒# `@월`d @I@`"'`` ''' &&&& 3ߟ+ @@iȐ2 @@qΐ& ހ` `` @  @iހVހT ?" ) " )?& ) @B@v+     @a@f В" j?& `@# @I(ր` ڀ2 րH ڀ2F@s[ 1@ #\#ؔ@I@T 3  @!! ֚E#! "%0 ܀#%@I%`8 @H@릐!@q@~ ! H@Hא `` 뀤9! !@ֶ@'!`$ %``" & & @;] 㿠`+'`&`? &`&`` @p@v`T@ `@HВ&`  C&` `@&& c @@ #@ @ @Hq ` @Hk@`&`h9Z-##'# ` ꀢ `  @H `?'``/' `&`&  & &`&`&` ^ ?) '(!%< ``   ܀&   3`?'` @H $`@n@pW& 뀢 C``  =`@h 6`  `` @`?`? `@    @Gѐ `    @GȐ  `@  !\@G `    " ?      @IF`@G ` @I<`",@G `u  IY`  a@Fސ `f  @ꕒЀ(@N`@!  * #` @ꅔ' `@l@I`- @G_ ` : @H` @GS @ `@e ? @@ @GB  " @F `  ``   ڔ`  I`"``!@t  La  L  @t3` `` P@F ```   !A  @   ꀢ`l@G @- & @mr@'3    ?&` `2 ?`  `@ ꀤ ` 1@F"`̐@`'`7̒@h%be'̝㿘;7ccಐ p/- Ԥ @` `@b`Z@X @U` * #`M  /M` `@M  `Đ@E   @F ``@F@u2 @G@@FJ   ` &@~ @l͒@( @lƒ@  ` `@@ ``  3 㿠N `/ ;@5cx@ 㿘``&`^ c(c(? ``"` @t`2 ` @G`!#|@E @n`2```" ` @Gx`%@EՐ @V`2` $M q9 `(Y' $ŀ ? @4 2@GC@6@C  $# @E@8 -2?D( Yb,YЀ`` $@`` `2` $K`2 `"2``&`   @F $#@EG @  1 !  `!@ 3 &`ئؒ ?@緔 (' 'آ '' $'M` b`k U/ `L?#H?R"@C?RԀ @;@mKԶ@2 '>ꀢ?R 8@pt??@c @Dڔ; `@DӔ@@o6 @@h0`@d/`` "( -`! @窒 /" @t ! # ` R ` ` `2`&`" "'@'`@㿠  @   @@ `' "&`'` 㿠 @   @@`2 㿠@aW;/c⠐@6 N 2N&.N` ". "  @Eɐ0@D&  N " N@E@DW`4N *`N `, `N `- N  9!1@ ."O&` @D@al 㿘>`8@Ȑ.'f@殐 * #`@歒O`  2*J  `"@E_#@E[`<@C'f%f⨖@p&  -)f"-@p  쀥`/p@敔 3`x @C5@B 9#;`@Cp2 J 2@ @/-s@7x #`#d`@ 4@ H``2`3 @ @ Z@@``**&H" +` ` * 9"?H- ,`*  @@R @M73s@Ǵ`x #`#d`−@8 4@3 2J `2@& @" 㿘 `% );?c@`=#` #d#\   1!@ݒ&.#Ԓ`@n 䀦' @g!;?H"  耥`G/'߈䐐&`  95s!L@M #`#d` @` 4@ J `2 @` @ `-(@@ !'XT S! ``";?@9?`#@ =#l  #\ #` #p#h#d 1!t@G c`@ =#; #\ #` #d #h #l #p #t #x #| #  #a # # # ### @ !Th@䪔!K f  耥 耥`G/'ɒ䐐&`  U95t"ؒ@䎶 #`#d`O @` 4@] J `2 @` @ `-В@K!t'㿠8   " @19"L@䙚&.-+b@@)! (  'N䐐&` Ȗ 995u"X]@ #`#d`Ԓ @f` 4@} J `2 @pR` @i I`x; @㐔  @̸u0 #`#d`@< 4@7 _J 2"J @* $`"S # `+b  ;bL"D # -`" !",@L`(@ (Л+ ,@L `*@ (`,````&,@@ &``@g 1? #/ @@&@ֺ #!b`"p@?!v7b|@8!rp @ bx @.vਘ #`#d`@ 4@ qJ 2"J @ $"e # +`"  ;`bJ`"V # -``"` -b`J`- .`-@[ #0,.`J` *` T - ?H@- @ + -  I ,G @7 # EC 쀥 : 9 -@L (` / Е* @ -@L ) / , `@&-@L @ #  ,@ #@ #L `,@ -  L / @ `.`- ``, $  @ͺ #``, L *` , ?L, @ +``,   ,~L7 `/ `/`M/` ` `* /`.`-?,  &` @  & `M@1@?h" C @?a `< # @?Z 5c4@?S0U &``@ޔ %?,  @& @+@?8cX /l@?1  7@?* `9#@?#@3 @. #@* #@& #9b"@Ꮤ"5d/@ሔ"6`b@ၔ"~DcL@z" 㿀``f+%f+c@l)w# #`#d`,@~ܐ 4@~א< aJ`2` $@~ʐ g93c ;@>` @c (2O`@~ #߀];`H` 2`&H`H`b +  *`7⠂`?H` /  -`*`H``)@~ #@~& @~| #@~x #@~t # #@ܔ"o#@Ք"k`/#@Δ"3㿀/;9x/`@ʹ"X #`#d`ݎ@~> 4@~9 J 2@~, @~( 㿀;`@9x#( #`#d`\@~  4@~l J 52@} @} @} 㿀;@z}`@a;y` #`#d`!@}ѐ 4@}͐2 J 3@} @} 㿀;z`$@0;y`ؘ #`#d`@} 4@} J 5 1@} @} @} x9 8 81y '!' 7@` #`#d`ܮ$@}^Ð J 51@}Q    @}K @}G  * @}< 4㿀;`<;y @߱bД #`#d`r@}" 4@} OJ 5@} D@`H@  6&`#`L@ߞ -&`'P@ߕ)$&` X@ߍ+`d@߇/p@߁ &`1 x@x &` &` &`@| 㿀;`;z @?` #`#d`@| 4@| "N 5 97@w @t 2`@|  @|@|y&`@| 㿀;H`@;za #`#d`۾@|n&& 4@|h͐ 'J 5@|[&& @ޚ"   @  &@ޑ& @|E&& @|? &&㿠/@Ɣ  N ` `a.> I㿠@ޛ  /` N  xN s`?N `r  `?`w-`?,@ /`㿠@v M  .N& 2N .N   ".  N   #\@E2#`@ @ 3`А @;r @k#du#|f#pb#xZ #t#h?c#l"#p@9 '@{P@q2'@{F'L - c d  l"   '؀ @;h \ '؀-@;_\ '؀  @;V` \ '؀`@;Ma\ ؀"! !!' ' ' 5@;3  &  '쀤#a,@;' ' #8 @      i?#J  @e  & "@"7 @T"  @ǔ hl @   @E "2''' '' @w-@:ڐ< # -@:АaH#  ܀L` }L*` (`@ L ?Ѐo !T@:kdL   *O .?ЦL@. +` . :0L `(` ,ЦL, `* ,`:(L (`` ,`?ЦL,`@ (`,`    `@:X  t@:L@/ 0  @̐&@ t,؀a@   w@z#  '`@:. @p\ !@jV @ܞ @yؐ'@ܙ"Q ؀ ܔJ/:* C @9!?؀`ܞ@K`@2 + 0 @9ܐ,܀= -؀ 쀎 IܐJ?* *?  @9܀!   +@9a ܀ ؀`"  `"*d `x @9 !@9" ܀ " @y" d`@y@y@d2 |@yB (#d#|@ (&  & '@y6 ($ #|@ (% @ '@I'''' ' @$  l'''''̴?'@0|%@yK@i|`@`d@{H)",@۰ @x@ۅ 3 b0 @8ܔ@iY#d##\?c#`"8DHbP (@x`' '܀@8ܒ@ݐ@? @Ґ @"L@Ȑ @ F`d@ۼ @bT@۲ @۶  K `P   Xgl@8'''''Į?''''@ۓ '耡 b@8b@ہ dN  +b@v YN < 'ؘ! '''쀢.@8s*@'"  @9 \ `@2 '@ڶ `"2'''!'! '쀠@t @8J" '@x (#dش@Ք (%  %d'@x  (% #d@Ȕ (& @xA@hr+@ڸ㿠N  `R `,".`D"`E"  9"`W"9    #;@8b N `߀`RH/@ڂ @J@W 3c   @7@h+')#d#7#,#`+cTc@w@h@w@h@w@h ~ -Ztd@ڦ `@7L ; I ;2 ) ;) @,`%@"/`@w '܀4@7O`    '''䀢1@7z#@' '؀ @7qcL 'O` '''''@O + @7ZcX@wj@gm@8 '@7B@wR `7@78t  @70#ؒ@  !#@7$@c@  ɬ `@p &0@ @ ;1@6 4`D@ 8*b]@8= @+'+`@N %   * :  N :2     @ƐM  : M " :2@ٲ ` gl#\H@6'?''''''''@ٖ '耠`|@6  @ل < @~ 6`@x  @6@v'Y '쀣 `@6t` '@v@ (ز@ (&  & '@v4 ($` آ@ ('` @vl@f #@6M`@v]@vY@Ր㿠` ` `-/; `") ); l3`@ر@y@؆ 5 @5ޔ @@أ?Ѐ  LH` @5ǐ B㿘;`P` ! @؂2`(@J@W 3a$ @5 `(! P &%@X`, f@Wffb"Đ@b  @uߐ@uݐ;fȐ@b @uӐ;@u,;a0#@؀ad'@|`|)` +9` @s!@p`a` ` @j!@gŦ 9f7Z"̢  /a@Z? '@z  .  l@Hb @@ ,@:4@5    " "H@&"X@! bh@x@`` b@ ` J /  x$ $-` @` H`  ?l$  $* @ 1 `$ 1$+"@ؔ  T$ $("@Ȑ  @q b@׼    "@װ 5$ $-@t F53@ל@t`P @[@Ð  /@d`  /@^ /@Y1 /@T @Oϐ:`  `@ @ ; +  "@ #@  + ! @ ?(: @0 㿐 . @ݔ @   ؔ @? ,`>;[./`ʔ * @ N  N ` N  `"  .   [*  @ M M M "  - #[ * `@@Ĕ L   L   L  `"  , !3[l * `@֤ O` @O` @O` " @ /@ ,L [*  @ք O   O ` O  "  / 7+[, * `#@c , c 7@3Œ㿀@:L * #`@:L@K@:I@E@:C@:H''@5  ?@:+ @:*@:/''@ 7gJ   K``    㿠+hc`?`@a^&@.(& 1" ".``    $$ 4 &@   $$$&@ @&@ـ `&@`% %? ?  `  @``$$?@4 ` `@$``$  $` (``"@%?% 㿠;c`;h5f` '?'?' @N ' - '  +'  `?' 㿠-c#\;a'a` 'ᘀ'h  '`˔h   ᘀ  hK  2~`p h`@4`% 4% /@ `􀤀 * ```%``+@J -2 J`%`` '`&`%`@`- @ @Ծ` `􀠀'`%%%'```+ @ I -2qI l   -` `?@%.@M `-\ M   h`  K  ?  = M=2 & h% @Ò @Ԓ% 2  %  ! c ` `#-x@ c@Ԣ`h@h `h9c`' $'`@#` ?r` '`M"2U$`c` , @H`- ``xc 3h@r` H#x`cP@gh@- 9h -c %$'  ?`(%c '`, @ $`  , @'+xc7h@B`@   ch`! $N@"``: ? :@ 3h `&`2'  "  #  \Z`- @K`-"U1cK Ԑ)h9h K1c  /h%K ĒK  `'`:)cJ J Wـ;؀:K `"`$```'`` c #``x` @ٖ3c&`$N`:J ? :``'`+`@ $``M`$  = `M`  =2`        %@ @Ӟ @m %@ )2     %@ 5c  `9+,  x@`H@ӂ`@I $`'` ? VM` " `<$`#c`  `;`x`l@]@$ $ ?&`6 9c`'`.@$`  `!1( x@ @;`@ N@$ : ? :@  $2' `"  $` $ W:J `:2K K " $``$`$'`$ "``$``'`$@!c 7``x@c $N:2  ? : $``'`*`@$`$)c   `95 x@Ж %c!1 x @Ȗ%c$$ ?1c `-@L - '+x`c@ҳ  3fL xc@Ҫ`3f`#hb$` '`;c'`$ ?2`? '`. @$` '`?    ߞ ۞㿠` G5- @``  G*`  '`;- `@@??㿘@o\ `-`' ' /4' ' ;5#d3a(0d ƙHL#`` ' #\a(\PT' @o0* . ' @Ѭ ' 㿠@og @oe㿠   @&  - rW"-@. @$ @2`㿠 Β 2 㿠Ē ? &" `&  㿠   ŀ&  . rW".@@. @$ 2  @ ?㿠 ) -`  & * #\ 8-`@\DF& @n @@3& .`$`@#`?"'` $    - rV"-@@ @2` `"```"`@(`@n㿠   `'`@ ` , rU",@/`  "ŀ 2 " && 2s   $  - rW"-@@, @ #  2 ` & &&㿠    '    , rU",@@/  @#` 2  2   ? .`% #& 2 2`&`@ ` - rV"- @@2`@ `  `& 2  Ґ 㿠  /`@ܒ & 㿠  /`%?"@ ?2( "`  +` "`    * " " "    J J  "J`) `  `"J`)  "㿠@|`?btbJ  ` K`` ` @ *  # I   * I  #@  㿠@Ϡ`?ccX*  3  * 1  ( 2 +  2   `? "` "㿠 @ / @.`'@ / /-@5 \.`㿠```" B $<   ? 2 `  "0  `@ $  `%   2  `2  `2  ` 2   `2 ` "  &  @β㿠 @ 7 & 6& 50@Ԕ   @ *  㿠L   2`2`=@l /`$ @k(&   & & ` `& & & &  & & `2``&&``2` &5*]@=`= $@; 9a8!T@j ׁ `` @ 2  `` @ 2 㿠@k @k݁㿠 7?& - \@+``1#3a @+؁㿠   @΢ & 㿈';'`''@h쀐"@ "  㿠;h  `@Ά @ 9h@@ 7h5@] @  5 K`   0 9)(`?Ї) `4% `"`@ 4 `  @ .`" `  @ *K`    㿠2N : "e N`: [ 3/-?   a⠠N ,aA* ɖ  *N`$,`  :  ", `4) `  2" *͐ .2 ` 4 i 2 ` `2   ``? 㿠;h`X  +h`X/ 3a@*`'` 㿠;h`X`2` `h# X&`!h@V* X `-+a@*`  ` @*x`&`9!@*o㿠;h`X`7hXA9h XSh9##;`@` ;`` ``  @ `4;` ` @ !` `@ ` ;`` @ ` Z`` @  ;`@+oa@)̐ `;` @S ` '`  ' `` ' '䀤 '3b '#hܐ#l hAl[܀ j Y@܀ @)  `"@`  `#`@i ' 4 ?  @( `@( $;7D@( bL@( `2 ` @̃@@  @)/ 㿠 `/9#8` #8@2 ` @ `?-P`@Ȕ#89㿠@Ґ `)7 @  L`K   @ # #`6K` "    㿐;h`X !#j9"h9"|@i` (27h5hX&X@k  `?I l #a"Ԗ g" ?q ?I x.  :@?J b *@ "7?a  ⠀A)  ) Ɉ !G` 8`J * 쀢A%`:? *` " ? )  "@Й)  !#` `J +` ) `"? "??2!?J "? "??2? ``"݈??2ڈ? : `J ;2 `  `  ?J " +`@ ?J t? >: `H;2 ` `   ?J ⠚ +`@ ?J t? <: `J ;2 ` `   J ⠚ +`@  J m J  p? &:h `J;2d ` ` "J ?J b ) @?J p?J o?J `s? ':7 `K ;23 `  `@  ?J ⠘+  `?J `u?J  o?J t?@ "K`;` `㿘 4@+'N`⠆ `(`@-`@N` -@ @2`N" +` @/⠴& N `(@@2& '& '&  ,,&,"  `  @g& & @f @ɶ & & @ .   @S @ ".N`N`&'?"/``@K`/``'@   `/`` '@`'@*N`  #'@ `&?"/``@L/``'@/`` '@*N`  '@ '@ `&  ,,&,"  `@f&  & @fs @4 & & @ .   & )\ &   - - &- "   @ff&  & @fF @ & & @ .   @  &  /`@/`@&/`@"   @f8&  & @f @ & & @ .   & - H@ @+ `@/ >(H   *:`(H  b@ș! V'@``8$X㿠 N   (@"  ) `! N` `    `"` %` '` "N`!߀`- `"`'" `>"  ߈   N``  |   x  ^ %`=``/  m   i `-߈  b ^ %`=`/" N``V   R `'`"S-` N`?`` E @2N`  > `; @K N` `3 `-O N` `+ `- N` `#    `-2N`   ` `-= N` ` `- N` `    8F@" Ēb@Dz"0-` N`; `  #!b#@Ǥ">N` ` 〡 '% @ǘ"CN` ` ׀ +)c0#<@nj"^N` ` ˀ "? < H`>`-"H-H-2)H -2% -2  H-">2 H -"H >2H-"  *H  㿘& `* #`@B/@ HH#p(!'( ', #l  2\`p # #   #(L  L +` @/ TL -`@2 /> FL *` @> ;L * @2 >>쀠 瀠6` =(` !L   =/2 Θ+ #`@   L - `@2    =`/ /> = ##_ L *` @" L * @2 "'> L `-`@`>2 x# #, (L >       L > L  #  |#`" .x6(@&- - &- \` - "(@b- !@b*`. .@] #\0@(% ?0(% 8%  % L `-` "( *%`;4'')' ``(@%(%(@%(  %(%(@%' ' t'$l*`4"8@bt(8'(\<','0/4@bh㿠h ;h7c'````5c  ,(``` ˔ `* H` H` +`2  @ `` "`````2  ' ( '?/c-f ,?  *??;c a4 ` ``*?㿠 `   @ě `  &  - & '. 㿠@DĐ"B9#' @!`  5  @!{@E / "y   `@!1# 'T@! @au " .` '.`#" `   " >`@JŒ   ! @!y@Eb 6@a ;@!iaT@aC " .` %`-  $@" ` `  " N /" `@/`` /` "&" && c + a,@!7@aG 㿠7c 0  `   *`?N%?K%``E /  #@ +  @ @ @ 65@0` `  @ò`)"  `+" + `    "` ``ɀ 'p|@U!r`㿘;aא!  *  `*  "@` @I&@`&㿘;a Ȗ `* 㿘;a#+a -@)/@#2  `/  / 㿘9!1l !Ȑg b)@!Ԁx+aYM(` / M/  *@ / ;;M `/` @+ L `/``@ L   /`@@2 +a@UuL ᠂ @RnL ! `LgL `=cL  `+@@  J ,`@ J   `- @2 E " *  `* 9 !@„3aڔ ,@w @ .N  ,3 a@o @A%@T@ .M㿠;h``t 7@3b@ "@㿀@P!h@@   @;  ` c c@\:`(@g`''''"' '/􀤠2`V`V ? #\+ `` /@@@@ .耧`@_F@P>㿘@O @~@ 7 X @5` 3@[:`b`@@@k ; b$@@Ē@  @ ( O` -`@ @ `@ O` / @2`J (`@"`@ @ J `+ @2"`@ /@@J @H@^Ր@B@D9"x @w@^Ð@@^@^ " $ @ @O㿠;h`````"= 7㿠@^c  " @^S `& " "  㿠 ` ``"  ` @^p @^m@^k  @^h㿠 6@^W `   @    &   ' ' '  @ , , & $,`@^  &  /``& %- % % % 㿘@Ȓ :-$@`* #`@.L`" +` `@`5 L  / @@ L   -`@2 @] 㿠 `%   @ `   & W  %@? .&@-@ɐ &   㿐@B @?  ` @   @3 @/  `@@ & `  * `#`@  @@/@`@  @ , "@   &      :  @@@  @-@@+  @  @.* & -`` -` $-` )- `5/@: ?'' 7@ '"@!g-㿠  " @]) `    @  &   @]@]㿠9 M M  ?"' # @c")p   ?+p`  ?7l@ܒ ? /H@Ғ@;fb{ 㿠;p` ֐ 1p& @\9p 78 ;c@㿘 #%@c@!Y ` ; -h %2`d@*f?  @   #` #d`Ȕ=` @E  @ې@@@?@@@@ " ? `" 3@?` ? c @!㿠)  @&@&@`6&`@&@O` 2`O`  O`` 2``"``@*O`O` 2  O` ` b@"@8㿠@[Ő " N      `/ `&  /  `& / ""@[.&`"N   N  ``@j N @;N  2Ƕ`/  &  / `& / .@[s/ &`."㿠 ]?`Y?@  4/`"L?%$ L`:@   `2?+-N`. @ @3bN `* @2Mb + @-% M `- @2%&' 㿠 ?@ 㿘  '@ @. 㿘֖2 @F㿠  `" 9 @Z &` ?'`&?#`@@ 2?@LL``/7`@:E'L` )  .`@9L` *@2` .`@:,'L` ,  `@ L` +@2`@2 `?`-`@"'`@ L`-@2`'`&U?bL``* "L?L` *`"E?L` +@ ">?ж?Ї/`?Я. (-@.`/`&J *@ @"O? J +@ @2 O? ,`@ '  O?-`@2' @E&`㿠  @Z0@Z.㿘&`7* #`@/@pH @͔㿠 `!` ``@N 2N&@N "&Д  @`2`㿠;`P@ 2&N N  :'N  ⠑* @+b N /  @ N  +@ @2 2N  !/ "`  /`  ?N 4`,` 9 B (B@ @@/` -2[ N  -`S &`&` N  (@ /`?L4`,`:C@ @* G@ B /` /23 L -``", &&L*??&  *  ( L 0`(`@;D *F@C@ `(&&  㽀 /c@UҒ;@$`pR3 @  % #` #@Up@ ` 4 #`b #d` "ɐ:` `@ g@` 6 3 `" `)f+#+@Ր` 3c  9@ː  X h@H#23㿠 .L `*@ @<L `/ @ L `(`@2`2&`&  L  *`@ = L  ` ```&` L ,`@L .`@ @ L - `@2  ="L `-`@L `+@ @ L `(` @2`"=&L"q " H "i "2&H *`@L ,@ @ L +@ @2  <L 5& 1/& &L L 2&L -@`@ '  &O? (`@' L"&   @# L"&  㿐D'DD ; ;p$,/@^ % " @L /&F \ "* '   ' ͖27#.!@#@K?/"  +@W?`&` /@c`, " 5@W1`&`@`% @`/ @C&`  㿠;c;p `p3@A`.7p 2@WLp @㿠7p?@ %?9- @W#%?#%?-?-?`;`@㿈-p   ?"? @"? @$"? >  옒  @ . 5` ?  㿠 " $@V $ " (@V ( " @V  " D@V D " L@V L "& @V& & $& (H?cx cx/ ?~'ĸ@ ''Ⱥ@ /&`@ &`@&`@ &` &``?&`&` @ &`$&`( '   $@Vh @<4f`@     ``@ '@R@BXa, |` ;fb@BK!8$ < |L` |0ٖ <DԖ  ( ,'' @ "? ??܀' ???''Ѐ2 ( 'Ѐ" ''@9   @ @ :c/`"@@ ) @  @A H̀`P\ p    t ho  @ p''/?b  @=''@B '؞?'@@  9!\@X ''@R9@U:??`   ? k`?`2`D''c'? 'ܢ'''', `    (,   ` @ ̀`1 *  '#@a@ va@) G  1!!!@ؐ   6 ?6@Y {   D_  v  @    ؐ'';  ` ؀  ؐ.Ԁ ;;,a@  &ϐ v'#bT@'ƒ t`􀠠@‐ @b `D9@[ "`D  Ԁ`"v!쀐2`H@<&`D`H3@A`D. ?`?؀2)/`D@-  &@D`D"߰ && & ? w ?@?؀ `D@AԒ `D@T[&`D䀠@ .`H w 6`I 2@`D x * #p`D@Ĕ@ X@2`D `D@X  `D " ?~@T&`L&`P&`T&`X ?~ ??ca;bؐ!??Wa@N"  @ ܺ @   `@> " `??=a `??6a3? /  "!@pa Ȁa |2p  'Āa  耤O??p+}` # TP ?xT@ gP #TPc ?2Tg3PT#@`* #p@`X,@Ѐ`9#T@  L` /` @JH@9@ ]#\@ L``(`@`2  ( '@S7€ ( #d@Ɣ  L` ,``@H @S3c4@ !#l@  2'Ā` ,&`,J @R#&`( @R&`(@R&`(-@Rސ@ ;N (@`@⠶& N *@`@2&.c&` &`$ /'# #LH ?'LH#@`* #p' @$ +   HL'?2L+`d!  @80   <D8@@cB:$`Ȁ`d$a,&B . >a, `  `&5  @` ##`$@ `   耤" @R' @`@ 4@@`d L@& & Fa Ba`D@ .%|@5@0a'@h`D @Q`D&`D@e ? w ? ?@@@ ?؀@>`D  `D @Z@>`D` &a@) @ &`&`&``&@Q  耤I & &`" ``@ " @Q ` 耤( ,d ,?@ ?&`&` ?p cZ1 @s ?~`$@l >@&` G&`?pK B@[ @M@U ` @C`@ @d @MԒ@C  @ @Mƒ#a@ې  @t!@ѐ  @   &`"@Q&`&`&`P`aP@7y`D y "`@1v`D`` `D@g! 3 ? w ? ? @$?؀ "`D@> =@ 5`D(@   耤k  $@5`D2?p@@  7`DH@a  ` 耤J  ?p`" u`DJ -J0P@?  u ``@  @ @@P{? ```   &`@ &`&` &`&`0&`4`0``   &`@ &`&` &`  &`0`0&`4#\`8#d#`#h@)&` ` 耤 "@P &`  耤2`@`2z '  '&`&`&``" 2k ' ` 耤 '֐ ' 2S ' ` 耤 ' '@ b @Ր   耤j ~74@i  ` 耤Rz   耤A}i 4#ܒ@(0<㽀#dd `l+d P K-L` d@O#d"`&` Ѐ" @T   @?   !@&  @[ ` '@O ' 22' @7'@<-  @ `? @  @ `?@" ;'   р@  a@   ' @>䀐"   `'  р    @ `?@           @6@;@  #a#h #p<#l?  `@.@H @;1 #x h@M  @8`$@ xb0@8x@@0@N|  2  '   ' @'  lp @D'' ``''`'`'`4 *`2  '  ' @ِ @:#t&@N&&``4R(`@.)-"L@ " @_@l P@ Ő)1"l@ #` 2% #̒b@  "  J @75 @  ̄ a􀠠(  р` ̚%`  р  @7̘@ zt 3@7@.%3@ mc @  Ӵ "@M `Ā/@    p쀠`fĀ`c27/f Ā] @Ā?L@    @   2D/I  @  o `:쀦0Ā -!  @I5@  - @  U@ ? `@ ; /  1 р`   / @ &     '  )  p@ Ő ) 9  @  ! !@  2  '! a 䀦`Ā H @GĀ?2@9@)!@@;!  ^?@ #@@I?t! @ R@,m @ @  `;@I tt @ 2@I#\+ a @ &ta` %aE'a$`   w r@H t!ܐ @ @,8@H#|@Ht#\" @ |@,#@ `F ) `#@H%@H#\ t4@ ǚ@H@H#`T #\t @ %-A%% 4  0 @Kd# -ad@M)'@ @2J  (`b @⠐ J +`@ @ J  *@ @2 G +J M2 J `T `?-"J  J  *`"@  x ;@ bp@ 9cܺ "P $ @@} `` ?  @h㿘@7@ސ`@t`5** `#`@]@=`= $,` * #`@H|@7d g g`\   H  :`I *? H@ *?* * 'D;pD'`d`dD ,$ 'D$C ,*+cb`)c"d `@#@@  ` `*  D-`@6@$ Dު ` @N ;* 1#`@L@K@I @D@@@> @9@5@3@8t@(@'@% b@ @@@[@ @b @ @@" @ @@t=` @@@@@@ߐ@@  @Jt #\"@  @Ȑ9"7@I@F@C@J7"@J1 @J+㿠&@` +c@  `"# N % ,@2 ` +c@ `" N 7⠸`/ @ @@  @ 㿠N / @ B D   @ /`@ /`@㿠;p```1&` $ ``9 s $.`p``p (㿠;p`t`t`"@I 㿠  k7@\>.`%-@@6@`@@?@ 㿠;3b @!hcy .cy.৺? &o / &w&.....@X< @5&.-$  2. ..W.&&&.&>'&&&ǁ㿠; @8`H@Q@R     @I#㿠; @`P N  @6J7@I; `@5@I "  @65@I  53 ̐x`X@@6 @H㿐; `@qh3p .`@9" U ''@Đ    "3[ "-U@g# x!̒``@{ 'x̒`Ԗ@p` +) `x ̘`@c"@H@H@H@8ϐ 2'9p/ @`?@@  !̐x@: @㿠; @5a$1 w!<> + aT@3/- a̐xl@ ); aT@ 9 R    75 !̐xl@@H?@s @H;J  _ -" +` `J  J  _+`㿘@N `" `/-`@@ 9" N ` `*@ @2 @'O" `/  @29`#@%O ,`@" 9"'`@ `O - @2'``"u `#q2N "*`@_-@+b`@ H` *  _-"`@/⠂`@ @H` +`@ @2`H`@"< H`=28 `Mb(@- M *`@2%@@3,&`@3(&`* #`@/BӐ?2&   㿠`l/`#$ c,  75) \!ܪ`@Ada`  ᨒa@"y/`㿘@  -* #`* *  @` ; Ĕ 7 a@"@U 㿐 @G @G @; ;9 a;"`x@@/ 㿠N``;` o yN` nfN``"- G52E5N` @ f2?5N` "6 95 1N``e215N` `  s2+5N`"  %5 nN`25  0N` `o25N` "  52 5N``25 @ . /- ̐x,@L 㿠@@@;; a;9 `x"`@2 㿠; b@& ہ㿠 @Fe@FQ& 㿠 #p@FY ` 6N`~2N`/.)@ǐ@M / %?-M/%N` / `J /J`/"7gp@2N & @F & 㿠2 @@N`/ &`/ ' O `/"/  㿠N`` @1@7& @6& 㿠N``#@1 @] @N /". @6& @6& @A0ABp?㿐@2; b@ J⠘ `+  @9""`  J ,@ @2"`J  J`m gk" "`5 t""`5)  +"`` -"` / * N /  :0;`N *"@"J  N +@ @2 J ,`@"`  J-`@2"`;`  ;`@" 7ก)  `D>` 1  >`㿐a ;97 a̐ x∖@ @&& 㿐I ;97 a̐ x⬖@ @&& ?@N@ @A"u㿐@Z@@  J" * `@;b"`@  @ J +@ @2"`J@ j%J@ s  d h""` m""`!7 w""`7'"` @ ) (@ +`0 @ -"`8@ /@ @* N`/@  @ :.;`N` * @"J`@ N` `, `@2`J `- @"`@  @ J .@2"`;`@  %;`@2 `%#5 ̐`xЖ@  D> 㿠;Jc; c7`?.  㿠N``-@58t+%ct @ 75/ ̐x@Ҙ ;9ct@5x'#t 㿠;c9#;/c@ 㿘2 7   .   ..`?.`& 㿘;'bl@  ;5/- x̒,@@ '`H㿠@ x 5/- ̐xL@r 9#;@Cc@C;'c 㿠;b3 b 7  ;/c 㿠7@@ ,??@3$@@$ # ct@1 = -L ' |@% 1 !L ,) #@ +  Lc@ -   L@  L`L'?@ /?'  97/ !̐x㨖@ 㿘U  9 #??`?#㿠@ǒ  5/- ̐x@˘ 9#;@C c@B;'c 㿘  ; 'b sK` ⠒ *` `@b`@ e K` *`@2` - +2K``@ "U  - `?$@ :M K` `* `D * bЉ(@&: `@ /K` `( `*  :+ K`" `) @ ""  0 ⠒! * (`@4 `@  K` `(@ !  @ 2 "  ?@$ dJ  b )  @" TH *` @2 - + -   -`?  a2 !؆!  bH (` `` ?БJ#\ \F?#\ J \̝D  .2 `2   *H  :` `㿠N `&`:$ `+-b@;bN : /``@  @ `? 㿠 `@r&-@`&  `P` P@7㿠. 5p@/`'.@ "%@A%%㿠@v;p`c%|`?'````-)p ( @-` @-%' ' GN@/' ?N`p`*@ +`# * @@A:&@ߔ,& N@Ԑ@A &@͔@Ȕ-@& N@.&N  ;p/``9p/ '`6'`㿠N  @Œ @@uN`s aր   s؀` x 㿠@6    "! % "쀣%耤`) "쀤-耥`@\1s!Հ7cx @M;s/aԁ ;saՀ @ǔ01c   @? . @@x& &     @@m& &  i@ 1c@@1c"x @5s.ԁ 㿠i;s@Y/aԁ㿠;c bx/c-x3saԀ  7c.xs aՁ+a՝㿐'L'P'T@'X;saր`1    "%L )L 쀤` L"耤- 쀥`L5耥L @\ ]㿐'H'L'P'T'X;c`@5sր` @> H>㿠`)g t+g`x@]-s%75sx@&@ ;s/aՁ@@! 3/ 1a̒$ x@{ @㿠;saشa؀  @6. .&``;c.ظ?'b|㿠;cb|b|53p ` ``6 /` p`@, #+`  `@ `6 @ /`'p ఀ* -p.`<% . @@WJ   "*@` K` 㿠.?`"'N GN @  b-`".`.``N; ;`0.` 0.` 0.``N .`  9g1/g "| +@ ".`.`` J 9  M@ .`L .``J   .`@B.`㿠.`?`D% <9p /p.@* p* /p`%/ @@_ `  @>&&1*up"`Z@<`:#+ #@ " "`# 0`H@&" \  % 㿠;p ``` @> *㿘; `P;p@, `9s'!)'  x\@=@>7s53 x1@1`@@ / -s x @%-7s.Ձcb` c#"ɞcb`s aՀ  c"p# 㿠;e3tc;ea@c  o n -/  / %e/ @$@f n㿠;t a;cb`   a : 5,`L!%  `%,: ` :(  " % % ,,``$& & & / % `2,  s*` ,- h|@H!SL% 9 7 #㠴!a@=a c@㿠;f9eb;#@ܐ`x `7h@B`r*` @?㿘'D;90'H!$ha#DHDB#\\^@=/""">@* ,$ , @!t+& ^ @> 9 * @ /`.&_@? <$@ !܅.3 (``'@ ."@* '༔ @ .#@5+ ' @#`#d`@<d@ِ㿠;f9b;7@\`Ԑ 5@Œh3@`h1/!-@h$+@`h @]8TҺ `9@ /'!`9'!! $!?#t%t'b\ܐ5?-t/g+c)ggत b ȸ`?' *  .( - ! ?-`  ? ~ ?g `w ? @?;a i ?)!?M`~p Hc!d"5!v/5␒G ` "? `b8 `b"1  `-b̒) `M`ʀpE? !,!J1  @ y o2 /ḴJ @n`? @  g `  ?ggg  ?$c4 ?'P?2(7c5& +-?% ``  "" "  *!"耤 b쀣   b#$b 耠1"쀧 5 # c+ F ) G%!#P* c  c ` ~ ` ~/5gXi   -g`\L` , `@(T2T  `@(*耠`@`㐹.   * #`c  *`@"`&) @;d@&`$`*`-)&3#wc;cP fb '!gE!P "/ J - -J `h P" - \+ga#ga@ ! P;@N@U` x)< @  ', @J  !!8@D 8@@  @= ǒ`4@9   a%3''\!`!$ ~ `'X@" ~@` 2 2@`" ~ 2@`  -2@ `@ -2 `\XT@  @'\ Ԁ`\ @@\ @ @ ;a4q X"\@:X\`@:\``2'\% +! c #@PPc!@M b/ !"'@ " ' ` ';c`P)!!`  I'ᠪ`B@  @&3aa@,`ᰢ` !!`@#\#X cc@ /᠘c  c@ cc@,ߐ (f #  `(Z   @: `@$ M @ >@$b`d@a@3 5@+@@ a@  `@8@ @ch@ @ @ !@Xh@  `  `s @ !!%@ؐ '@Ԑ)@А @ @cP@ސ `Pp㿠 5g  7g9g!6@;a8@ X@    @  @;ch`z%xL`*-%Ħ +xn%aL@ݐ @ِ!`9ga* !Ԝ#`@ޔ@9Ih@@"!ĀJ``#B#a " @ɒ% 2 0``,7Ā( 2&``&``"  @F 2 & &&` 2&㿠 `  `2'   @8  " @8  " @8@8  @  & &`J K`+``K` K`+``K` 2K`Hp㿘3'a'@@@ 9!;!̒!Đ`x@H@(#\  !⠢a!N`ކ(@@  O Ԛ+` @2  δa*`@ # O ö. @2 #"O ``" `\2  O ``"`\yO 2/  \2 n O  ) `@􀠠\/   7- @ "%@8! + !@7"`" "@7"  `` ` xa̒@  DO D@)  ;O "L@ 1O "T@ 'O b\@  O d@ O l@  O "x`x@ZO  < " @7@'\@ \ @7' &   ' & '2 㿠   " @7e  " @7_ @7Y@7W`2 㿠;f@ :aL" @Đ @  *  㿠;faLb@В :'@ @ @Ɣ*@N7x3x&t`&ap`  x#al㿠9x!l!l  `-%  `xat `xat` xat`㿠@6 (" " " "   u;``@: @:` e?`  3  6 G`( 8 @)Z@3>  g⨔`!L @3/D  @-5`-Ȩ̀` %`@ = # @ %  `=. [@%`s &@o  @`& 6`` & @& "В@Ô!& AC0@Y@X@#p =A?@$P'H9-'L +` H;p@c:   :``@[ >` @S@pB`?  > E@2####*;p*\\)1ʥʝ&'23@T ZօT#     :` @> p >`G/   @(#x#|"##*;pxN N)*!ʉʽ45$%\LZ ֍L#d  p>`  ;p@p@  ;p@Ӗp e ;p##@ p     #f!#|#;p K@#p`9>    & b@#h#l e@#`,#d,h`7!̝̽ \\"#()^J Fԁ) H J#@i  # (   N@#@X ׁ# #@4́㿐'P3'T```:`P;`@B   _& `5/- $(  ;`:`@): 5`@ B 3 . @1>   ``  $  9  #@  %@  9  . [!;`̐ `;`ǐ  & `` & `& #h#l;`hlr `  & 6  :㿠%'H'L???@Ε: +  ` @ -:`@: 2@ B 1 (`@18` ,.   @+# c48  #  ?`@%&@ ?`@ .7 ^ '@ \ `X  @ & H!L  #<K ِ @4A㿠"5N15P1#@@ː $9   2'  `   #H@  ` 0"`"""P@ +@# ` 0$`$$$-X@ 97  &&&&;`x;c`@㿠@3! 9x@!h!h%`%`%`%` `@0{ P%% -& -%%%` 5@3sc%`$   @! @`$?ə㿐'P'T   @ F` P& &   B  & & #h#l;`h@plx`d )d@0-;`` P$ -& -$@-ò& c;`@3: $& $$ ` ƀ    $ 5  #h#l;`hl@ @ $`> 㿠'H'L  `    @F &H& & HL;@ @ $c" @3 $@3?333333@?㿠'P)'T!!#X!@EP&!&!  G8'! 0 )#h@ .! !H.!T!P!&!&!  $ $ `   0 @ .! @!X&!&!㿠;xaPaP` 7@0&@-&@& & AC0@Y@X@#p =@?zGA?@$㾠'H 'L 0    @ $DH;@$@@"@ ?'"`   Ā`78####,,!)̡̽ FF67"#PX\ΕP#dd ;3cĐ@˔`c@ `;Դ@ `"+   -`#x#| .#x.!#p#tν\\5,-.έ89^J؍ VF#p1\*+R ؅VB# [.   + #`+  +? 4+    =` &+  +? >+   >+  # "@  "` (  ( +   ]+  P+ (?  ;`@ @@#@ ;` @. Y#@@ ` [%@@  [.`" ?  > =  <- -  2--  뀣 ]- (+ & (`;@۔@  @  -``-&-``H=PT8!'HPT!!B# #;D@@      #f5#,a;0@@@  ;`<@o ` a#      `M(I ! 0!Ё )a#h#l,#`,#d8h`1'̱̉\ \45()XJ@ ҁ @>!FH#&!@ǒ @(@: 6+`H @  .;`X@ @@H%'@B@#@ @ #;#@/``@@  $@ $&@  , $ $ " &,,;㤒@#d c;#@#L; @#F [㿠Ԑ ;`d'  $Ɂ㿠;@`h ! p@Y  %)x%!p`&/-`9x/@x@`3`x5x@:p" ;9x!p;`x #adǂ`4 @㿠`/g1f7g1f!9xw!X5f d &@Np%"""Y@;9 # *"@ * !@8)# %"""3$hY @cŻ9 +< #_ @Y@ ? :" ( (`9 '%@`) ""+$hc!"""Y@ 9 50< $@+_@Y@ ? ; "@ ("=(%'@`;0a-Y@9 >`%@Ae?PbM㿘;5xb; b?" @v&  @s/    * '@i@v 93ǒ ΐ b $`<`'%/␑@$` ơJ<` N1"<`xa@=Ae `ؚ# #\ `! #`\` ƁHhxa㿠@. ;xax`9x /!x@@.Ş㿠;xa;@`> > Ae㿐;x5a@ '#\   %#`\`ęHL& & 0> 12> 3 xa @.F@.u㿠@.1 "  " " @ * "   & @%& ``ܒE # <   2$  & "& 㿠 `*`& `!& `&``&`&` @ /  &  #7`5``9 !4 @.  8@ @T7T  %gϐ 'g@-`   ` @x#`ggb$#hg4#d#\%"#9 a' ##`@!!  @y؀um-Ȁ&)! a@-5'``뀠`ἀ !@<2-)''@ ] 뀢  ˀ `@@@-s')#쀥 /5 / `쀠@c /߰ )ʹ #Ѐ ߀`@ @  `(@  @% WV "* @@@-`@, 1  @ `@2'@@@, @,א 0 @ k@d2@,ѐ@ @ 3 /! @,'O  - !`-@B5+ ` c!` `"h\ ) #"hu1 #!dh, @ @@ b n 1@,d"@,^ |@,Xy'ؔԖИ@,KԀ`@,EԒؔԖИ2Đ@5@9;!!c` c@  3 " a!@!L䀦㿘; cc`+b @" ?3 @  bD`@+ `" 5ؐl @Ò 2 ? ?^  `"߰ 9Ð"     "ϰ #볐b J "° 릐 ? *@$@H  @ ,+ 2?B @2  " / z  ?B?>"$@  `"  0fn $J  @ ??? ,2@$ "a $#TCK @-` ? ``@ "H #c|*`2 ?․6`4@/ @P +@@+$c@  @۔@ /@ " 9  ` 5㿠@Β %)@Ȓ &/ @*" И@/@-@*ڐ  ;c ;`\꾒# $`8@;"nِ-@T@4"qؐ 㿠`N `* @ . @ .%;`@= `?@ .. @ ..㿘@ N`/"`@/#`+d+e   &  ` & -`& @*Q-&  `- &d&㿠 `   ``  `@ $ @*,       `  `#`# `@&  9 @*:& & & 7 @  㿘/ /@) 7 ⠠  '@@ʒ2 :N -@ #N (@2 #р"HH`+@ @"H`#2 8 5#"5 造(5H *`@ H * @2 2 -`N (`@ -" @` }N *@ @2s :q@M` `+  @`@M``.@@2``@ `@*`  @?`2%@ @ A`@ %"4``Ɩ ,@  "` `?`+ c -' - `/ '@ "  -@(  & & 5`@!-㿠@z2`;@L@Y a 貔 `@㿠 `    @(@ &   @(@(㿠N b;N`9b!"\ %(%N (!!%N  `*A`A`A?+` +`ɶ.>/%-< %'N``(` N` * a`A A@ A??* *?ɮ -=`/-`>`2  N  N`` 㿠2` ( `  `` &` `, + c  `/g`1g"l9!$4 㿐@>` @ :* #`@ ,@@3xa & #x$a 'x@')x!|㿘 :@>`@`* #`@t,@;xa`)x !㿠;@aH95#!#! ΒT֐ &`-Δ  - @ @ -Ϊ@ -@'" ` "@'&``?㿠;a@א@@'㿐;xa % @'2;x9xa'!a  @AC0?ə@@?㿈;-aa+  زضG'a$ ac؉,!,)̡̽TT>?*+\PāU `D'5N#h#;`a#l @# ``hl^#p#tpt ;` )@# ``  Z#h#lhl!`;`;h`@$dWh``Ƒ<  `<  $ ` / )< $ $ i< 㿠2  >&d&  &&" @ @D > @' F' @  `??ffffff㾘h)#h \ ``d#x''#l#\#`#d#|@ #p`   '''쀢 #   %'-''쀣'  % 2#;##  ||;@xuG ###` ;#cc d d pp##p9;##``pp܀  |x |: | x @x㠠᐀ p܀o` B;;{`ֽX`ځ  @##;h@*; 5;  * %`8)!J>@;Elߔ|x@a @  `8`< ;?;"##|` N;; `֩X `ځ  ##;h=,`8`<@ > >!@;E l{|x@c@ @  2`8?@; `8`<U ;`8`<L>;ȔF|c` B;;`֍N`ʁ e##;h^V>;@El2`8?N@7; B;  7`8`<;q;T##`H;;=`L`ā  @? " ##;hg`8`< > >!@;E l2`8?ހ@; `8`< ;Ő`8`<>;p :;``h`8`<@ >ː !;@El``8`<;̔|x@b @B?|``hxp>;@El/d`8`<@ ;;##|xe @  |x@ &=``h1`8`<@>#L>@lE`8`< R4##`?&?" d##dd="`̐``$A$\` \  褅$ E$ 㿘@#2 ~-Ӻ Ш& #`#d`fh@#m  @#&  D7//  0#/ .@"@#@Y "  .@"@#@G "  "  @" @" !@^! b @W!㿠@  2 Ԃ`, ]@X@#p =㿀@1;`x   -   #`9f1#d/`!3"0a/`@8d?AC0@?P㿈'L;'Pa0LP a0$%@+` G/ @# B#`#d 2`/ҭ J45V Ɓ9 ' >F (' D> @ ' >´ ' >?;h)b8;p"D@"$hp`;h-L;pX@"%hp㿈#\`'@"\`&&`@R #c    ''@֐  `"r`@&`f R``` c`  ?qoX`g #  `@E  `' A` ? ` D ⸒b@4"9` + 􀢠 3"@ "%1 "Y@@!`"ޠ 1% 8% < 1E` @ \"@!@ @!~'@T-@!s@!_`?' 4'@!j@`O 8  <% 8% <I'  @@@!T@!R`" "% 8% < "3@bԖ @@!<@!:`u% 8% <4` `&` q  @j\ \ ` `2     &`@!` &`@H & `@ `2&@ `"% 8% <@'9"l @ ֐`" 1% 8% < 1@% ` x@ Đb"@/"4㿐`   l `&3/'7 a' @}``     `` & v 3  `:"$    2 l@C l    ,l b @ ,lZ @ ,l   + 0 `8 "(@ v ` :b< @" @@ L  ' ` "  @ %" @    &2{'@| g"x g b ?㿈;fa`#f,a')#ȁX%Ȁ #hh ?#pp#h#lhl@h@d9#@ +- J#  4@3c &D  @#h5#lX;`hߙl`#h#lhl@0@,㿠  " @  @@`2 @;c @* @h* #`* #`@,%< @@$3/c-㄀@@@ג5@ז @˒㿠) #y`#y  @P"   ", ` -@   3@c " N " @f ;a7@ؔ$9/!㿠@Ғ  @?@    a`!@㿠#9!; ;'a;a@I㿐;a  %e\5$쀤/g3gbT9!%+ H#;cݓ-+Вc@ P3gJ :b!%(H``$H`  `* *`A A A6 ?((?ɔ *8`2) ) ```H` Ѐ%) 㿠N ?;` b@``M``-%@@`N 3/g-gb %Ƞܒ @ / :` `K/ K/  N/  N  ' / @1+ `(@c /     J %K` `) !" K`b(@ `? b ` `?㿠N `m75K ⠆`%`K -@!" K * @a2    `2 K 2K F#/ @NN 69g3N /-g#b⠂ %`% `N  `)  N  `+ 2*  @ 2* * ; K@ * J*  N N    2N * "1; 0`H@!㿠9f!`!! @@ѐ `  /``2  J 2 *b@ - +&K` ` (b  - + :bH  *` - + : `? f* a f* a  " 㿠7P@m O @ 㿠 &@@n : `@X4&&@O+& 㿠^ % X@0 "';O`:2#;O` /`O``/` -@Ȓ\@N /" ;9'@ h /@t.`;`t@l㿠@~ @J ` "ࠔ`*"`  *8+``K```f* a & f ;*aڄ'   ?( #(($㿈#\#d''ܐ  Sd+fZ\,a#`@~@4̐M``[#h@~2&@~  h`#h@~ ] `h  `L @~2h  `hN` :.N``@~c@~p N`  N`?N &`⠒c + "޴ -?Ю-@ 4ִ  (N N`/   f`@~0@~= O f! `  `;  ``@~@~   `N`  `?  ``@}@~  `N`  #  `@}ߒ@} N`} %`s _`@ 0" h@В'`'` '`('`,@ǒ'`@А`` @u`$``@} % `@'``@'` @'` ` `\2`@\'`'`@ْ '``\@@` ```\@`d`d'`  a<!D@}1#+㿠 . fa75L@}#}. 㿠@}G / ;@a&`@&@:&`@`&`㿠    @}   " @|   @| 㿠  @| /,@| `" @|ې ;,@|Ք ` @|̐ ?,@|Ɂ㿠@ ˒/J  !*`; g;  `,gH  %KK` K` 2* * ``* `K`  퀡 %* 㿠 ̔ Β /㿠@    $ L`@ސ& @|l /@|h@@|a-@|[-@&  " $@ϐ $@@ɐ@ @ & 㿠@ @& 㿠@ $@& $㿠@ @ @   " @  " @  " (@ ( " ,@ , @@ @ $@@|N`/@"9 "`J`/@"` @@|-h/<+ 3@b c 7F@{ː@ @{@{ 9! @E㿠@{``@/``& @ /`& @&/`&`@`&```@{`&`㿠`. `@? /``& @ /` & @&/`&`@`&```-`&`㿘-88 `  ` `&@* #`@{b/@]@{Y@&@N `. N  .5IJ &@&`N  c (L,  @"Q    'g  @E&` /`& @ /` & @/`' @f ' ,  @ !g'gN 㠨cT %@ ` 2+ +    = I  + H+  (N   @ #"  4  @zܔ  # %  % #``2 N N +;`.  @-=.     * ' ̒a@z%V  㿠 ; /c @zĒ / " ` @z뀐x';cc'' ?􀤠O?  ͐ /  ?G?"? 3f.a`?`/  / `& @z   |!w  :@ y!$ +`2 :* : c / $Ng#h@z  N`!$ @ 2 ?+: a@y~ W ??  H@@@@@˒ @S㿠@y @[L .3L`/"M`"J`.%L/$(:L/"6$(2L/2$,2) ," , /" L / , L /2,,*L2,@ 㿠 "  @yr" @y|㿠@@yGN`  ?'@{ @y;@@y7/@ #@yS #"@y'"@` @y @@y-@ /O /N` /'@y<"N`/2&@@?`@x@x, @y2N/2 '@y"'@`@xД@x̔/'pђ " @ `O`:`O/ $@ @@x-`"@ڐ @x@x.@㿠 /f9f᬴!/`u% (   `   , `  #gct   :@x| :@ @xQ@xN @@r:` 2@x<  @x6  @p@x.@x+@x&@x$  @ :+``@x@x+``@J@x@x [.@w@w ]-`  @w@w  :/   @':/"@%  (@J ` ," @? @@9'@w'48 (b",@w'|ـ `?㿠H+N C`I-N %9N .@!-N  ( !%A  A A ??+ )!+ ɶ/.``"   %.`  %.` .` +)b4"@@w@'`5HL@w9'N 㿘:`9N *;N``#OO  @ @N 2N` N N N  N``?@ bT"`@v'N 㿠@gJ 5 @/`>/  O  -=`/  O  㿠&@@`@vٔ/㿠J N`E    ",) @`ْ& `&N` ,`@"`N` . @"N`` -`@2`N``Ԁ, /`@/ @&& 㿠'H'L 'P'T'X @ H@w? @/`@㿈'H'L'P'T6'XH   @vI`$` @z   H쀦`@v+@v(  퀦-@Y * 㿠'D@voD9!Ē @vҖ ;a@u9@u;abhbtݞ㿠9#∔c@ @u@v1!"@vv@vqb,@v 5@ve @v31b"/@vX-+c)'@v h%#`x@v@vR"@u] @uY 㿘'@u '@vo? @uY@uf ;c Ҿh@uȐ" 3<-( @9 #;c$ߒ@ud @u/@u< ;c@ Ҕ@uh2 `@uh" ;<;@ 㿠;@u:cd??  @v @v @u0㿘@u. * # .` @u%.  F`@a@㿠``@pҁ㿠` @-@t  @mݒ @ @t `  "&&@S@O㿠%@u!` 9g#@u;gc@u㿘@t * #`@tO `/`?M! // `N` /`-:@ux- Mꀥ/-, @ui㿠@t /@@tv'@   /@@to-@tm㿘@tb * #`@t[ N * #`; `  ,`;,N  ,N``  ```. =-  N`` `- @t㿠@t* N@`/ @$L/2N@ //`/@$$@   @ `?@  @` @ `?J  c4 ? J`: 8 J (`J`$ !+ J` &    @` J  `J`  @@   J`" / `?  @ 㿠;c4`%(  'Y # M /`?@ @     2M   @ @ 㿠N `/9#0` #02 ` `?㿠 @s@@s=74@HH21 ?6 7   @ 2H"?@s"@s@3L `K  ` 2  ?$ # 6L ?`?㿠 O;'c4@o   , @s6 $   2/   ( @J  e  @s    @r @rԐ "    㿠@rO%.@ &N&.`8O.O. `J ``*`? `[ `] J ``*  㿠ǐ7 h@r9 #p@r~2N ` ;@rrct`?㿠@ R R@s/, R @rA &@s!N .@&@s `  @@t@ N `-'N #1@r X&~ @C h@r 2&     $`#\@rܘ?d$` #& @rȒ  @! h@r &     ' #\@r?@' &  @"& "5  =- @ & %@q:  `  &  5 `2 @q  `"& @ & & @q@ @ @q{ & 㿠 ` @rn @@ @㿠  `@` `@㿠`2`2 @А   ` ````` `  `@ -@/`.@q*@㿠  `"   `"     /`@[@l.'?&㿠` @];gcM㿐 &``2㿐А֐ @Bϐ2Ӑ㿐 @-@+2㿠;aa쀧`2'?@q $? $?@p |$??K`  `L`,'$?/+/c$?$? , ?& ?&`㿘̒@pm6  O   1`"+#&   @q`0.   @q @  2&L`& . L@p@Lݨ ڰ&   -.?& AC0?P@$㿐d   b# @pq">   5 @F 5 +@; d  `?  9 >  #`! #d"! `!™ H*+LPԖ  ;f #hb1L3##lb /#\h@p,l㿠`      @p@   @py @2 㿠`  ; @  -  @p^:`@ %@ @pY0  -.  ` `0.   `d`   @p@`0.   @p6`0- ``   d @p+`0 .  d@p!   @p `0-  @p`0, h`- `- # @p`0.  #@o   @o d`0 , d@o  @o `0.  @o`0,`` 7`9a" `:  @o֒`0.  @o̒   @oɖ#`0 - #@o   @o d`0 ,` d@o  `@o `0,   @o`0-`)Є"@`G"  @o`0".  @o  @o `0-  @o   @o~#`0,`# @ot  `@oq d`0,   d@og   @od `0-  @oZ`0.`'&%  `T"@  @oM`0. "@ @oC "@o@ `0." @o6 @o3 `0-  @o)   @o&#`0 ,`#@o  `@o d`0 ,  d@o  @o  `0-  @o`0.V`%}x `a‐ @n`0.    @n "@@n `0"@.  @nޒ " @n۔ `0", @nђ @nΔ `0. @nĒ  `@n#`0 /`#@n   @n d`0 .  d@n   @n `0,   @n`0-`#沔b `n  @n`0.  @n ‶ @n `0,  @ny "@ @nv `0"@. @nl "`@ni `0"/` @n_  @n\ `0.  @nR   @nO#`0 , #@nE  @nB d`0 . d@n8  @n5 `0,  @n+`0.` `{b @n `0b.    @n @n `0.  @n ‮ @n `0. @m "@@m `0"@- @m "`@m `0"/` @m `@mޔ `0,` @mԒ  @mі#`0 .#@mǒ  @mĖ d`0 - d@m  `@m `0/`  @m`0,``` `! @m`0.    @m b@m `0b. @m @m `0- @m| ‶`@my `0,` @mo "@@ml `0"@. @mb "@m_ `0"- @mU `@mR `0/` @mH  @mE#`0 ,#@m;  @m8 d`0 . d@m.   @m+ `0-   @m!`0/` u`5)D `; @m`0.    @m   3@m`0.  @l b@l `0.b @l  @l `0.  @l ‶ @lߔ `0,  @lՒ "@@lҔ `0"@. @lȒ "`@lŔ `0"/` @l `@l `0,` @l   @l#`0 , #@l  @l d`0 . d@l  `@l `0/`  @l`0,``ۀ` i!5)D @l{`0.    @lo  3@ll`0- @lb  !@l_`0. @lU b@lR `0b.    @lF @lD `0. @l: ‶@l7 `0- @l- "@@l* `0"@. @l  "`@l `0",` @l @l `0- @l  @l#`0 ,#@k  @k d`0 . d@k   @k `0,   @kߒ`0-3` b@ !)@kђ`0. )@kǒ  /5)D@kĖ `0. 3@k  @k`0.  @k   1@k`0. @k b @k `0, b @k @k `0. @k ‮`@k `0/` @ku "@@kr `0"@- @kh "@ke `0". @k[ `@kX `0/` @kN   @kK#`0 , #@kA  `@k> d`0 ,` d@k4  @k1 `0.  @k'`0/``{`)1~@/@k`0.   @k  )3@k `0. )@k/5)D  @j`0,  @j   !1@j`0. @j  @jߖ`0- @jՒ b@jҔ `0.b @jȒ  @jÒ`0- @j †@j `0,  @j "@ @j `0"@. @j "@j `0".  @j  @j `0,    @j  @j#`0,# @jv   @js d`0.  d@ji  @jg `0.   @j]`0/  `! @"@;a~)1@jO`0.  a~)1 @jC! "@j@`0". @j6 ))@j3`0,`) -5)D@j'  1@j$`0. @j  `@j`0/` @j   )@j ``0,` `@i沤  @i`0- @i}x ! @i`0. @i&%  @iۖ`0, @iђ и "@ @i̖`0- @i’a  @i`0, @i   @i`0 .@i  @i#`0 -#@i   @i d`0/   d@i  `@i `0/`  @i}`0.р`;Xb ax@ ޔ"@@ip`0".  @ @id! !~@ia)1`0!~. )1@iW3  b!@iR`0b-@iH )35)D@iE`0.)@i;  @i8`0- @i.  !@i+`0 .3@i  @i`0- @i b@i `0b. @i @i `0- @h ‰@h `0.  @h "@ @h `0"@. @hޒ "@h۔ `0"- @hђ  # @h̖`0, @h’  @h#`0 , #@h   @h d`0 . d@h  @h `0 - @h`0,`x- )"@axb@h`0ax. b@h " @h@`0". @ 3@ht a~ @hq)1`0a~/`)1@hg1 "@hd`0".@hZ );@hW`0-)15)D@hK  @hH`0. @h>  -@h;`0- 1@h/  @h,`0,  @h" b @h `0b. @h @h `0/` @h †`@h `0,  @g "@ @g `0"@/  @g )a " @g`0. @gߒ c  @gږ`0, @gВ  @g͖#`0 ,#@gÒ  @g d`0 - d@g  @g `0 . @g`0,`9x-)" @g`0". )@g ax@gb`0ax-b@g "@@g`0".@@gz! !~@gw)1`0!~.)1@gm9 "@gj`0"-!@g^ )@g[`0/`)@gQ  -5)D@gN``0. !@gB  @g?`0/` @g5  -@g2``0- @g& b@g# `0b. @g @g `0. @g  ‸@g  `0- @f "@ @f `0"@/  @f )a "@f`0. @f  # `@fޖ`0 ,`@fԒ  @fі#`0#- @fǒ   @fĖ d`0 -  d@f  @f `0.  @f`0,```". .  . 㿠;bp-*5/ %'@.$p[@<; $@+$# "p㿘;c`9 @f\ x7h@f6 㿠-` @eѐ @f@f '$@f  &  : &&: `.; _@"㿠;b` @e @fy@fz 7&@f{㿠 ?;b@fr97#@e[&;A.x'D 'H;DH;`@e `` B#l'lDH#hh '' @fH 㿐 @d  @f= 㿘'D'H'L'PDH B;` LP+\ \c@e "@f   @e  +\ \`dL@P@d  @e @d" +\ \AeP'D;'HaDHB'DH'@e@d ''@e@d "㿠%  M࠶"&+*b^@> <`#@ !` <L@/ ;` * J@ / 9 `-L/ `?L/ * <L@/`  ;`  *J@ /`  9 `-L/`  `?L/``( *b^@@@8>`&.'&@``" %/`  =8`N/` -M@/`/`/``/`< =L/`  `< + J/`  * I/`/`/``'@ J *@ @ =|zJvJ `*@ @  J   `*`@2J "g?=_]J`Y*(`  2(J *@`@  J   *@`@2J "G?-=J )="*J +  2(J *@`@  J   `*`@2J "'?=2"?J`&?(J 2?J   +``@2J `" ?`="J ??? 㿠c#\3`4\#WU@U@`@c @U@ct  U@U @@ch`@@( 8\WU@ @cX@\U@@@cL@@㿘&`V@/`` * #`@#fffff?ffffff?PbM?@bM㿘'D;'HaHD ªa! `` bt#`#d- `@c]d` #`#d/ `@cNd` #`#d5 `@c?d`  #`#d7 `@c0d9@bڒ#Ё㿠 ;a; c԰ @by㿠@cϐ;`㿠 @cƒ;`ߒ㿠@c @c ;` ǒ㿠@c@b ;`(㿠;@c`0;`<@bi @c㿠 㿠;Zx0N<[y1O,4 );Ok[WQ  /?"!,i9Ka~֝jבe  7CA f!*7ΑH^P}zdK5 _U^/%=kO[G)6F\I (QۚK5ަ5)n>5#F[um'$ ','\8(MH&T'd'll't('z'H(L'\'( ' l'('Hʤ '@ 'H '8 $(\ 0(l <(l H( T', h'< x'L 'D '  'd 'd ' '` 'i  ( t 'x!'p! 'p!'|!('!4'l!@'4!L&!\'H!h'0!|(F!(G!'8!(,!'\!($8!'8!'`!&l!˼!'h!'"'" '"&" 'P8"0("@'j"L'd"T'X"`(0"l(48"x,"(E"'̔"'"'"'"'"&"'Ǽ"'#'H# '##$'#,'(#4'#D'#Td#h'M#x&#'#((8#'#'#&#'!#(D##'#&$'y$ 'T$,$ Ϥ$('H$0'H'''$ eta %sCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123%s: unable to resolve bind address `%s'; disabling bind. Connecting to %s|%s|:%d... Connecting to %s:%d... sock >= 0connect.cconnected. Created socket %d. failed: %s. %s: unable to resolve host address `%s' Local socket fd %d bound. binding to address %s using port %i. Accepted client at socket %d. conaddr is: %s conaddr is: %s Closed fd %d fd >= 0connect.cApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %s seconds. Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbCannot convert links in %s: %s Something strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d ../orig.origCannot back up %s as %s: %s %d; URL=%s?#%/index.htmlfile != NULLconvert.cDeleted old cookie (to be replaced.) Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s res != 0cookies.cDiscarded old cookie. domainpathexpiresmax-age%lfsecureSyntax error in Set-Cookie: %s at position %d. cdm: 1 2 3 4 5 6.com.edu.net.org.gov.mil.int 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s ocnt == countcookies.cpos == result_sizecookies.crCannot open cookies file `%s': %s TRUETRUE%lfSaving cookies to %s. wCannot open cookies file `%s': %s # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. :%d %s %s %s %.0f %s %s Error writing to `%s': %s Error closing `%s': %s Done saving cookies. byte==> PASV ... ==> EPSV ... ==> LPSV ... ==> PORT ... ==> EPRT ... ==> LPRT ... Length: %s (%s), %s (%s) remaining, %s remainingcon != NULLftp.ccon->target != NULLftp.c!((cmd & DO_LIST) && (cmd & DO_RETR))ftp.c(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0ftp.cLogging in as %s ... Error in server response, closing control connection. Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Error in server response, closing control connection. Server error, can't determine system type. done. ==> PWD ... Error in server response, closing control connection. /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Error in server response, closing control connection. Write failed, closing control connection. Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' *ntarget == '/'ftp.cChanged file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... Error in server response, closing control connection. Write failed, closing control connection. No such directory `%s'. done. ==> CWD not required. ==> SIZE %s ... Error in server response, closing control connection. Error in server response, closing control connection. Write failed, closing control connection. Cannot initiate PASV transfer. Cannot parse PASV response. trying to connect to %s port %d couldn't connect to %s port %d: %s done. Error in server response, closing control connection. Write failed, closing control connection. socket: %s Bind error (%s). Invalid PORT. done. ==> REST %s ... Error in server response, closing control connection. Write failed, closing control connection. REST failed, starting from scratch. done. ==> RETR %s ... Error in server response, closing control connection. Write failed, closing control connection. No such file `%s'. done. ==> LIST ... Error in server response, closing control connection. Write failed, closing control connection. No such file or directory `%s'. done. Lying FTP server found, adjusting. accept: %s abwb%s has sprung into existence. %s: %s %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. %s (%s) - Data transfer aborted. r%s: %s %s File `%s' already there; not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%s] %s URL: %s [%s] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing `%s' as listing tmp file. unlink: %s Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLftp.cRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %s) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. ../Rejecting `%s'. Rejecting `%s'. Error matching %s against %s: %s No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%s]. Wrote HTML-ized index to `%s'. %s %s Detected newlines in %s "%s"; changing to %s "%s" PASS--> %s --> PASS Turtle Power! --> %s USER331 s/key 331 opiekey PASSaddr->family == AF_INETftp-basic.cbuflen >= 6 * 4ftp-basic.c%d,%d,%d,%d,%d,%daddr.family == AF_INETftp-basic.cPORTbuflen >= 21 * 4ftp-basic.c%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%daddr.family == AF_INET || addr.family == AF_INET6ftp-basic.cLPRTbuflen >= 4 + INET6_ADDRSTRLEN + 1 + 5ftp-basic.c|%d|%s|%d|EPRTaddr != NULLftp-basic.cport != NULLftp-basic.cPASVaddr != NULLftp-basic.cport != NULLftp-basic.cLPSVs != NULLftp-basic.clpsv addr is: %s tmpprt[0] is: %d tmpprt[1] is: %d *port is: %d af == 6ftp-basic.clpsv addr is: %s tmpprt[0] is: %d tmpprt[1] is: %d *port is: %d ip != NULLftp-basic.cport != NULLftp-basic.cEPSVrespline != NULLftp-basic.crespline is %s TYPECWDRESTRETRLIST -aLISTSYST VMSUNIXWINDOWS_NTWINDOWS2000MACOSOS/400PWD""SIZEtype=JanFebMarAprMayJunJulAugSepOctNovDecrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; size: %s; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. %s Skipping. rb%s: %s Name: '%s' -- :MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %s bytes wrong VMS permissons! JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECrb%s: %s file name: '%s' .DIRName: '%s' Directory File Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' -day: '%s' -nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d Timestamp: %ld ,)confusing VMS permissions, skipping line permissions: %s -> 0%o rb%s: %s Unsupported listing type, trying Unix listing parser. wb%s: %s ���Index of /%s on %s:%d���

Index of /%s on %s:%d

  JanFebMarAprMayJunJulAugSepOctNovDec%d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s
wrote `%s' to STORE --%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument %s: option `%s' requires an argument %s: option requires an argument -- %c pos >= al->faulty && pos < al->counthost.cindex == al->faultyhost.cip - al->addresses == cnthost.cReleasing 0x%0*lx (new refcount %d). Deleting unused 0x%0*lx. Found %s in host_name_addresses_map (%p) Caching %s => %s Resolving %s... failed: %s. failed: No IPv4/IPv6 addresses for host. , , ... u->host != NULLhost.cal->refcount == 1host.cto - (pool->contents + pool->tail) <= end - beghtml-parse.cch == '\'' || ch == 0x22html-parse.cch == quote_charhtml-parse.cch == '-'html-parse.cch == '-'html-parse.caappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaobjectoverlayscripttabletdthhrefcodehrefsrcbackgroundhrefsrcsrcsrcsrchreflowsrcsrcsrcsrcdatasrcsrcbackgroundbackgroundbackgroundrelhttp-equivnamecontentaction%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. first != -1html-url.chrefactionhrefrelstylesheetshortcut iconnamehttp-equivrefreshcontentrobotscontentnonenofollowt != NULLhtml-url.c%s: %s Loaded %s (size %s). no-follow in %s: %d %s: %s Loaded %s (size %s). %s: Invalid URL %s: %s HTTP/1.0 p - request_string == sizehttp.c ---request begin--- %s---request end--- Failed writing HTTP request: %s. Auth-without-challenge set, sending Basic credentials. Found `%s' in basic_authed_hosts. Host `%s' has not issued a general basic challenge. Inserted `%s' into basic_authed_hosts [writing POST file %s ... rbwritten == promised_sizehttp.cdone] HTTPNo headers, assuming HTTP/0.9HTTP%s%s bytescontlen != -1http.cSkipping %s bytes of body: [] aborting (%s). %.*s] done. filenameDisabling further reuse of socket %d. Registered socket %d for persistent reuse. GETHEADPOSTbytes=%s-Wget/%s%s[%s]%s:%d[%s]:%dPOST data file `%s' missing: %s Reusing existing connection to %s:%d. Reusing fd %d. %s: unable to resolve host address `%s' [POST data: %s] %s request sent, awaiting response... No data received. Read error (%s) in headers. ---response begin--- %s---response end--- %2d %s Content-DispositionFile `%s' already there; not retrieving. .origContent-LengthKeep-AliveConnectionKeep-AliveWWW-AuthenticateWWW-AuthenticateUnknown authentication scheme. BasicNTLMBasicAuthorization failed. Malformed status line(no description)Content-TypeLocationLast-Modifiedwget_cookie_jar != NULLhttp.cSet-CookieSet-CookieContent-RangeLocation: %s%s text/htmltext/htmlapplication/xhtml+xmlapplication/xhtml+xml.htm.html.html.%d.html The file is already fully retrieved; nothing to do. Length: (%s), %s (%s) remaining, %s remaining [%s] abwb%s has sprung into existence. %s: %s Saving to: `%s' local_file == NULL || *local_file == NULLhttp.cWarning: wildcards not supported in HTTP. File `%s' already there; not retrieving. Spider mode enabled. Check if remote file exists. (try:%2d)--%s-- %s %s --%s-- %s Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: Remote file does not exist -- broken link!!! %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %s) -- retrieving. Remote file is newer, retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Remote file exists. %s (%s) - `%s' saved [%s/%s] %s URL:%s [%s/%s] -> "%s" [%d] %s (%s) - `%s' saved [%s] %s URL:%s [%s] -> "%s" [%d] %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %TC%s:%sBasic realmopaquenonce:::::Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque=""BasicDigestacceptaddhostdiralwaysrestauthnochallengebackgroundbackupconvertedbackupsbasebindaddresscacheconnecttimeoutcontentdispositioncontinueconvertlinkscookiescutdirsdebugdeleteafterdirprefixdirstructdnscachednstimeoutdomainsdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpuserglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsproxyhttpuserignorecaseignorelengthignoretagsincludedirectoriesinet4onlyinet6onlyinputkeepsessioncookieslimitrateloadcookieslogfileloginmaxredirectmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppasswdpasswordpostdatapostfilepreferfamilypreservepermissionsprogressprotocoldirectoriesproxypasswdproxypasswordproxyuserquietquotarandomwaitreadtimeoutreclevelrecursiverefererrejectrelativeonlyremovelistingrestrictfilenamesretrsymlinksretryconnrefusedrobotssavecookiessaveheadersserverresponsespanhostsspiderstrictcommentstimeouttimestampingtriesuseproxyuseruseragentverbosewaitwaitretryno_proxyHOMEWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Syntax error in %s at line %d. %s: Unknown command `%s' in %s at line %d. /usr/local/etc/wgetrc/usr/local/etc/wgetrc/usr/local/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. 0 <= comind && comind < countof (commands)init.cSetting %s (%s) to %s val != NULLinit.c%s: Invalid --execute command `%s' %s: %s: Invalid boolean `%s'; use `on' or `off'. %s: %s: Invalid number `%s'. infinf%s: %s: Invalid byte value `%s' %s: %s: Invalid byte value `%s' %s: %s: Invalid time period `%s' %s: %s: Invalid header `%s'. IPv4IPv6none%s: %s: Invalid value `%s'. %s: %s: Invalid progress type `%s'. unixwindowslowercaseuppercasenocontrol%s: %s: Invalid restriction `%s', use [unix|windows],[lowercase|uppercase],[nocontrol]. %s: %s: Invalid value `%s'. %s: %s: %s base == 8 || base == 16log.cwget-log %s received, redirecting output to `%s'. %s received. %s: %s; disabling logging. acceptacceptappend-outputauth-no-challengeauthnochallengebackgroundbackgroundbackup-convertedbackupconvertedbackupsbackupsbasebasebind-addressbindaddresscacertificatecadirectorycachecachecertificatecertificatetypecheckcertificateclobberconnect-timeoutconnecttimeoutcontinuecontinueconvert-linksconvertlinkscontent-dispositioncontentdispositioncookiescookiescut-dirscutdirsdebugdebugdelete-afterdeleteafterdirectoriesdirstructdirectory-prefixdirprefixdns-cachednscachedns-timeoutdnstimeoutdomainsdomainsdont-remove-listingdot-styledotstyleegd-fileegdfileexclude-directoriesexcludedirectoriesexclude-domainsexcludedomainsexecutefollow-ftpfollowftpfollow-tagsfollowtagsforce-directoriesdirstructforce-htmlforcehtmlftp-passwordftppasswordftp-userftpuserglobglobheaderheaderhelphost-directoriesaddhostdirhtml-extensionhtmlextensionhtmlifyhtmlifyhttp-keep-alivehttpkeepalivehttp-passwdhttppasswordhttp-passwordhttppasswordhttp-userhttpuserignore-caseignorecaseignore-lengthignorelengthignore-tagsignoretagsinclude-directoriesincludedirectoriesinet4-onlyinet4onlyinet6-onlyinet6onlyinput-fileinputkeep-session-cookieskeepsessioncookieslevelreclevellimit-ratelimitrateload-cookiesloadcookiesmax-redirectmaxredirectmirrormirrornono-clobbernoclobberno-parentnoparentoutput-documentoutputdocumentoutput-filelogfilepage-requisitespagerequisitesparentpassive-ftppassiveftppasswordpasswordpost-datapostdatapost-filepostfileprefer-familypreferfamilypreserve-permissionspreservepermissionsprivatekeyprivatekeytypeprogressprogressprotocol-directoriesprotocoldirectoriesproxyuseproxyproxy__compatuseproxyproxy-passwdproxypasswordproxy-passwordproxypasswordproxy-userproxyuserquietquietquotaquotarandom-filerandomfilerandom-waitrandomwaitread-timeoutreadtimeoutrecursiverecursiverefererrefererrejectrejectrelativerelativeonlyremove-listingremovelistingrestrict-file-namesrestrictfilenamesretr-symlinksretrsymlinksretry-connrefusedretryconnrefusedsave-cookiessavecookiessave-headerssaveheaderssecureprotocolserver-responseserverresponsespan-hostsspanhostsspiderspiderstrict-commentsstrictcommentstimeouttimeouttimestampingtimestampingtriestriesuseruseruser-agentuseragentverboseverboseverboseverboseversionwaitwaitwaitretrywaitretryopt->argtype != -1main.co <= countof (long_options)main.cUsage: %s [OPTION]... [URL]... Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print lots of debugging information. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --no-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O, --output-document=FILE write documents to FILE. -nc, --no-clobber skip downloads that would download to existing files. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. --no-proxy explicitly turn off proxy. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --no-dns-cache disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. --ignore-case ignore case when matching files/directories. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --user=USER set both ftp and http user to USER. --password=PASS set both ftp and http password to PASS. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. --protocol-directories use protocol name in directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-password=PASS set http password to PASS. --no-cache disallow server-cached data. -E, --html-extension save HTML documents with `.html' extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --max-redirect maximum redirections allowed per page. --proxy-user=USER set USER as proxy username. --proxy-password=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-cookies don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --keep-session-cookies load and save session (non-permanent) cookies. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --auth-no-challenge Send Basic HTTP authentication information without first waiting for the server's challenge. FTP options: --ftp-user=USER set ftp user to USER. --ftp-password=PASS set ftp password to PASS. --no-remove-listing don't remove `.listing' files. --no-glob turn off FTP file name globbing. --no-passive-ftp disable the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dir). --preserve-permissions preserve remote file permissions. Recursive download: -r, --recursive specify recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links make links in downloaded HTML point to local files. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . GNU Wget %s, a non-interactive network retriever. %dd %dh %dm %ds%dh %dm %ds%dm %ds%ssGNU Wget %s Copyright (C) 2008 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Originally written by Hrvoje Niksic . Currently maintained by Micah Cowan . Try `%s --help' for more options. logfileverbose0addhostdir0dirstruct0noclobber1noparent1%s: illegal option -- `-n%c' Try `%s --help' for more options. removelisting0Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. Cannot specify both --inet4-only and --inet6-only. Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. %s%sFile `%s' already there; not retrieving. %s: missing URL Try `%s --help' for more options. DEBUG output created by Wget %s on %s. Removing file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! .netrc%s/%sr%s: Cannot read %s (%s). loginpasswordmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name accountdefaultloginmacdefmachinepassword%s: %s:%d: unknown token "%s" dotbarbardot %*s[ skipping %sK ] %6sK ,dp->dots < opt.dots_in_lineprogress.c%3d%% %4.*f%c %s=%s=%ss %6sK . %6sK defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100progress.c%2d%% 100% dlsz <= progress_sizeprogress.cinsz <= dlszprogress.c %sB/sK/sM/sG/s %4.*f%s --.-K/s in %ss TERMforceemacsdot%ds%dm%s%ds%dh%s%dm%dd%s%dh%ddCannot get REALTIME clock frequency: %s Enqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d Queue count %d, maxcount %d. %s: %s. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. url_parsed != NULLrecur.cRemoving file due to %s in recursive_retrieve(): unlink: %s Deciding whether to enqueue "%s". download_child_p: parent->url is: `%s' Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLrecur.cnew_parsed != NULLrecur.cRedirection "%s" failed the test. wgetj == cntres.c!EOL (p)res.cIgnoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %s%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. /robots.txtdeferring a %.2f ms sleep (%s/%.2f). sleeping %.2f ms for %s bytes, adjust %.2f ms maxsize >= bufsizeretr.cremain >= 0retr.cB/sKB/sMB/sGB/s%.*f %ssecs >= 0retr.cbytes >= 0retr.c%s: %s. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. mynewloc != NULLretr.c%s: %s. %d redirections exceeded. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s sleep_between_retrievals: avg=%f,sleep=%f %s.%d%s.%d%s.%dhttp_proxyftp_proxyFound no broken links. num_elems > 0spider.c%s httphttp://ftpftp://p2 - newstr == newlenurl.cp2 - newstr == newlenurl.c@/?#;:/0123456789ftp://%shttp://%sNo errorUnsupported schemeInvalid host nameBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric address*p == 0url.cerror_code >= 0 && error_code < countof (parse_errors)url.cRemoving %s because of directory danger! %s: %s%2E%2Eq - TAIL (dest) == outlenurl.c..%2E%2Escheme_str != NULLurl.cp - result == sizeurl.cstr && *strurl.ccurl.cu1 && u2url.c%H:%M:%S%Y-%m-%d %H:%M:%Swget-logforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullr/dev/nullw/dev/nullwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s rbhtmlhtmhtml,.%d%.*f%csig == SIGALRMutils.c%.0f%.1f%.1g%.3f0%s: %s: Failed to allocate %ld bytes; memory exhausted. malloccallocreallocstrdupptr != NULLxmalloc.cj800<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000000N*  & Y oXno:,o;: oodLj(T\dlt|            AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?LVPVXV`X4hVpVxVVX V V V V VY,YVVVVVV   $ ( 0 8 < @DLPT`lx|@DLT0@P`dhl(A((a(((b))K)$)4)<)DB)L)T)d)p))))))))))c** k**,*@*T*\*d*p*xd******P****++ D+++0+<+H+T+\X+p+++e+++++x++F,,,$,0,<,D,L,T,\,dh,l,,E,,,,,,,,---$-0-<-H-X-h-t-I--4--6--i--..l. .,.8.D.T.`.p.|m..n.....O..o..p////(/4/@/L/X/d/p/|////////00(0008>|>?P????@8@|@AADAAAABB\BBC4C|CCDDDDE$EXEEF4FFGdH H$H4HlHHI,ItIJJ J$J`JJKPKKL8LLLLMPMMN<NNO$OdOOP8P<VXP ( V @ (H KMGX X$X(X,^^^ ^(__P `` :/```````aKMGTPE (ANY)permanentsessionsecureinsecurenoneFALSETRUETRUEFALSE (unauthoritative) anonymous-wget@@%s done. . 12:@@(nil)POSIXLY_CORRECT11AuthorizationEOF receivedRefererPragmano-cacheRangeUser-AgentUser-AgentAccept*/*HostConnectionKeep-AliveCookieContent-Typeapplication/x-www-form-urlencodedContent-LengthProxy-AuthorizationAuthorizationProxyHTTPAuthorizationunspecified [following]ignoredunspecifiedSTDOUT0123456789abcdef0123456789abcdef/aw0123456789ABCDEF0123456789ABCDEF01noparentnoclobber01WARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. WARNING: timestamping does nothing in combination with -O. See the manual for details. solaris2.8abwbSIGHUPSIGUSR1WTF?!.netrc --delete-after--spiderrecursive rejection criteriaRemoving %s. Removing %s since it should be rejected. AllowingRejectingGiving up. Retrying. Found %d broken link. Found %d broken links. 0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF0123456789ABCDEFindex.html*password*wbw11.11.4cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 02/09/05 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)md5.h 1.1 99/07/02 SMI@(#)md5.h 1.5 99/07/05 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)wchar.h 1.34 04/08/10 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMI@(#)netdb.h 1.23 99/12/06 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.87 04/10/14 SMI@(#)vnode.h 1.86 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)mman.h 1.38 99/05/19 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.13 02/09/05 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)ucontext.h 1.26 99/05/04 SMI@(#)regset.h 1.24 99/10/05 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)setjmp.h 1.36 99/08/10 SMI@(#)setjmp_iso.h 1.1 99/08/09 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18acomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18cg: Sun Compiler Common 11 Patch 120760-11 2006/10/18@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.69 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.67 03/08/07 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.3 02/10/10 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)inttypes.h 1.1 96/04/02 SMI@(#)inttypes.h 1.2 98/01/16 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)int_const.h 1.2 96/07/08 SMI@(#)int_fmtio.h 1.2 96/07/08 SMI@(#)limits.h 1.52 03/08/07 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)fnmatch.h 1.3 94/10/11 SMIacomp: Sun C 5.8 Patch 121015-04 2007/01/10iropt: Sun Compiler Common 11 Patch 120760-11 2006/10/18ld: Software Generation Utilities - Solaris Link Editors: 5.8-1.301.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.dynamic.data1.symtab.strtab.debug_info.debug_line.debug_abbrev.comment.shstrtab    0"&&Yo:,:,-B::  8B:: BB;; L@@,RX ^ `f``zodHdHGdLdL tj8j82kk.}  = k