HmVH V:c 1L.textPPVP .data  :cX@.bss Bx Bx.loader@x.except"$|nx|#x|+x|1B(9 e)-*@H`H0HA|nxAA| QN!A89}sx}{x~xHi`,Ab H5A| @__startb|,!HAcA}hcCN!Ab ,Ac|CN!Ab,Ac|CN!Ab,Ac|CN!Ab,Ac|CN!AH8!@}N 8!@N A__threads_init,4A L| N |`~}&`!`?;`;H%}8/HAB@,z@H 8H6`H q; P?@cc888@Hؙ``q,AbpXt`::x :Cȁx,?@,@<@0H 8v |88`,@ HkAcHW`X8!P}N HA L| N LA L| N bT8qA||+|"*AH|8@@@@|A LHp|+|*A$0|8@@@|+@P@D|*@|, TA|0|0|8@H|8@|0}0@@@ LAA 8`N 8`N 8`N 8c8,|0@A@,|0@KAA8`N 8`N 8`N @strcmp\A L| N `A L| N lA L| N pA L| N A||8@}&`|:!``}``T~D@ cGK;:ccecc&cDK|@~@c|{c||A |}|~ ~~AHA~~{aDbcbHǸA,~bceA,bv;bdHO `~@|@:R@H(b;9cebHN`|@:R@Al|x8||"|{AT~ |}~~۲~~Rbbce;HN`|@~~۲;bbce@|@|ce||{|AH|}[[cDc;9HN)`|@[;9ccDce@||{ce| |{c`|HM`;|@|{c`|ce@܁8!|} AN Ah8!N h|t!8@9% X||88`HO AX8!P}N @|t8 !<C08a@||PHN`l`4T_0`aH!P*("2HN`,,aL8@8`88LFALHNIAhx8!p}N ",|!HAt88d8HOAb8c8HO%`|pH HA|``~!, @HPeAc`zc KA,tz8`@ ;ȓ,@D;eԓ ;(,A$}X8!PA}H$;Г}X8!PA}N |``~Le,!8c,|`4T~D@|e`fAH7,c`D8A(HJ9A,@(8`,@XHP`HF,@0;,d8|4A$T~|d`fK8`,@8`h8!`}N |`fc}&T>,.!D;AH6L,aD,AT8`ADH;9,HDHNEA,@x8`TX8!P|} N A0H7,AH8`TX8!P|} N AKA,HK]`,A,@88`TX8!P|} N (|a!aD`?;KA`}`e cTc6D|n;@cHH`8A}p8.8cc|;H cH?,pc;cc@cHM`!a}N !|!ahlD8ahHbeA|y@ H`MA8 cD8~HbaA,@ H`!A8~X8!P}N |Pt|8 F8!pF`Ȇ@8A88c }(B|J.p@A8c }(B|J.p@K(=,U09#9COA8,@|@T|q@@@d8c }}B.q@A8c }}B.q@K(=,A@ 9C8c }(B|J.p@KxH|@T|pT02}`xT>88c }(B}&J.q)@A8c }(B}&J.q)@K(=,A\@ 9C8c }(B|J.p@Kq @}'@U)})q@@ }@U}p}x8K8`N |d(N ||`f|c"`8|@`989&8j9et@H38c|ic|C@p;T| i 8Tc>|T&|i 9 TcѾ|lT| 9k T|  C T| i 8Tc>|lT&| i TcѾ|T| T|  <`UU8UVaaCH1U@|98g8|Pa,,;=899gA(9@=8gAL|e8}HT| 8T&| HHU} @8U&U>}b} @T| C|e8}N  |<C0!PHB`l`tTa@4DA8K8`8HZA8`X8!P}N "|8`!,@,H[=A`H[YA|cxH[uA8H[AH8!@}N h|!aD,8`@,HZA`HZ݀A|cxHZA8H[9ADH2`X8!P}N x|!bh<@X8@0cR8th,A8`X8!P}N HZA,aBA܁X8!P}N h|``d!8~HYA80`<`8Ŗ;8H>̀A80`<`8B@;8H>A80`<`8ņ;8H>}A80``8;8'H>YA80``8;8H>5A80``8;8dH>A80``8;8 H=A8080;,A ;ch8!`!}N |;8||!|8 @;H=eA|8|8 |A(;H=AA|8|8 |@cH8!@}N |a|y<C0<`E0!`aH@;@(;`c88@t8|8c8H9ـA8|8!aHtDbo!@!*LD8}#خH*cD8|!*8"r!PTP@;cH9QA8HH<A,88@(Ah``;`H;ՀA,88@(A<``;`H;A,88@(A``;`H;}A,88@(A``;`H;QA,@(A``;`tDbo!@!*LD8K8!a}N " |`}&`||~!;;`8aD8@K ADcCK A`y@;@ #,;@ccc8 8HA,H:AA80;`|d||;{|`8 c8@A;;`,@c8 8K`;Klccc88 HAH9A80;`|d||;{|`8 c8@APDc%cH`;`,@ccc88 K`;KX@;8-ctx8!p|} N  |!8@XH=`8a@H<`,a@A0H i`aDH ]`8a@H<`,a@@؁X8!P}N l|!8@aThH=`8a@H`X8!P}N X|,!D,;8;8A4`eA$8,A8,K8;T:H``}aDHe`W:|"e!.ch8!`}N ||}y``!A,c8;;Acc,@$H}`cX8!P}H,A,8T:,A8T:,K;,A;,K|d8T:cH``}8T:|ccH`cH`cX8!P}N LD8!PN @8!PN 4||yc!AD,AH]`~,@cHE`H8!@}N 88!@N h|`c!H`cH`H8!@}N @|ha!(-;8;@$,@;,8` @8HHÀA`},8` @X8!P}8`N H``|8`;`H`dp||| 8@{H`|||cHAiA|`p|||ep||0@||(|K,c@@LHAAAH@@ HA1A|| ,LB+BAH%`|cH |HE`cH9`8`X8!Pa}N a|`}&;!;R8`RH``{8RcH@A,|{AKuA.|ccA$( A<cHM``{|ccH@EA,c@8|Accp A0ccH9`8`TX8!P|} aN @H``{ccTX8!P|} aN (|!Hq|ytc8AhK̀A,c8@8`H8!@}N KA,88AԈ,AKyA,A8`H8!@}N ,(*+?+[*]A@LFӂL^LVA8,(*+?+[*]ALFӂL^LVK8`N 8`N h|}&T>.!``K9A`}cK)A,@H||888A,A,8|8@@8cAK||88X8Ax,| 8Ah$C@HH@T8cAL$|@,8}H|@@C @(8cA $|@|H|@@8cT8|4T~X8!P|} N D|`!KA,|(.+/At8|AhAp4c(.+/ALH AD4c(.+/A,(.@A 8|H8!@}N 88`@|H8!@}N |`(/!~H,@;cA(K,@8`H8!@}N c~D,AKı,@8`H8!@}N |!`KA,||+/A@A@4c+/(/A$A$4c+/(/AK@ 8;c8~<@,,A@A4K,~@c8AK,@;cH8KĹH0`A$Kĩ|`4T~X8!P}N 8`X8!P}N |a!`~`?D`KQA cTd6c|!n`<;a@K-Ace cTc6,|n8@bX8?A48|0,A8|0,K8`8?X,A48c|(,A8c|(,KccDHA!a}N ! |!D`8/KyA,aD@$H`Th8!`}N KA8|cH``~ccH `8/|}|8cDH9`ch8!`}N |T>8!8H8A,t,8@8`H8!@}N A8H9AH8!@}N t|a!T>aD`8H`}cKQ8|{yc,LB1A!aDHm,,aD@$@$H`X8!P}N K큁X8!P}N d|a!aH`?;;K}A cTc6H|n8a@@H6`;/@8|4T~|خ|,(/A$A;{,(/A K@;ٮ@Hm,@8@H7mA@,@(H8`@,@ٮ@;{Kx!a}N !|t!8ȐXKA,aD888@8`8X8!P}N H6AaDH7AaHLaDH"MAaHLX8!P}N |!@8@H6ـAH,8`T&(@@8`@8`8!}N L|!@8@H6AT`h8!}N 0|;!08@aH61AH,T&d(/@`Ābt8c@PA H`aH69A|yb8cA(KAt`f8`8H`c8!Ѓ}N !|DaLX8`H$Aa@8@aLH5рA,b8c@(KAt`f8`L8xH`X8!P}N x|,;;!a!A;;;,848eA8A KeAaDH僢||yaDT8A}KmA8c@,|`A$H|,|`A@cK!`{`daDccH}}!8D8Ax8D88AHAHTc, } ZUi>Uj>A<}B.qA`c88, } ZUi>Uj>AH, UѾU~U~}lb909)09J0A}eZ.qkA4`888UѾ, U~U~}lbH<'F;888UѾ, U~U~}lb909)09J0AX}eZ.qkAK|}H;|Pc88, } ZUi>Uj>A}B.qKԁH88!@}N 8D,|AHH$A|*.p,|*H8|*.p,|*@@8`N da|!H]||yc,;}(/LFAA;,A;|`c,A H aA;,cA;|~|cAc,KĈ}c|,Ae,A H AcH AX8!Pa}N |`a! `;@;HQĐa`,@(`H рA8bc,AH܀,A `ccH A,|;cc@,K`8`8!a}HcdA,Ke`8`8!a}N cHcH A,A KU`8bc,A HIH8`8!a}N d8`h,L d ,L 8e@N ,|8 !`~,AdK9A,;cc@KEAccHMcc8 ,@H8!@}N 88!@N ܃|`|| `,!/^";:(A 8@@,cHH,c^ce;:(c@0cK`zz}84c0Hdc#K!`8|ٮ:H4c#,AbKA`yb8K`z|ycceK`z8|}84c0|e8~,@HKA,`w|ycce@p8xKQ`zc$bKA`cce|wK)`z8|}84c0|e8H4K`8|:}84c0|e8~,@Ah8!`}N !D8!`N  X|c!,AK`88H8!@}N T8b,L KLN 8%8K 8\8K 8e,,LB3BM N 0b|;!,;A K`;(@,KH8!@}N \| !,A HA;8; 8`KE;,cAb8X8!P}N |||yhT>!c8@cA|,@8KɀA8,~ @hd@KɀA`g88~@ccKՀA8`HEAX8!P}HLeR HIA,8A4X@8!P}N X8!P}N X@8!P}N d`N |p`!8`,(@A<@<8!@N @AM{8H8!@}N <8!@N x!|HK,A HQA8bH8!@}N <|`!DK1K|dyb,/aDO,A/ALAA(H@,A4X8!P}N ,@d,A KAPHYAaD,@)8bc,AK遁X8!P}N X8!P}N |b! ahlp,tx|A!AhKb9@;h9$h8a@,@(|d|e8Kp`h8a@8A쁁X8!P}N 8!PN |`!ahlptx|A!KMb,,/c99!@./;ll8a@@hA8A@0,@L,AX8!P}N A(|d|e8Kp`l8a@8A쁁X8!P}N A L| N A L| N A L| N A L| N A L| N ĐA L| N ȐA L| N ̐A L| N ԐA L| N ؐA L| N ܐA L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N |&`,|# CHiH|nx|ex8`ee8`8A!KA8!88`|N @h sigsetjmp #$C(c,048<@#DCHcLPTX\N `@P jmpsavegprhpx#Ccڃڣ#CcۃۣN `@L jmpsavefprA L| N A L| N A L| N  A L| N A L| N A L| N A L| N !|HKA|`4T~H8!@}N ,X8|d0,M ,M |0T`(4,||gM |0T`(4,||gKN `!|HK`|`4T~H8!@}N ,8c,M ,M T`(4||e,M T`(4||e,KN P`y|c <C0Td8!"@|c8HE`|b oD(C !@*"2K`yW8cK``{;@c8H `|@yc@8:cw|@APKـAcH2T8|.|{|@|@A 8c@cc|@|@@|D|E;9|@@cw|@KcK!`x8!p}N " L||4T~N |!H G (G|T:|288@8C@(H@@8|C @,8|@KAH8!@}N `8!@N T``&|TU|xT 6|T~|xTP*|T|xT80|T>|xN D$(H ,0Hp cN  88|T|0@88| @@C@,H@8`|8@8C @ `8|8@@ 8`N 8`N  cdT8| N |a! HDT8|@@;;|aHD|@ccA<KŀA,aHD|@@``@0LFӂ@;|@@|aHD|@ccKh8!`a}N X8!`N |8` !cT8H`8H8!@}N H!|`{ !D`{K۽Ac;H2T8C|.|@ALW88~aDcK}A|@,aDc@;Z@c|@@Ѐ|@@x8!pA}8`N { 8W8|};#|@A;z[|@AHc[|@AcCcKɀAcH2T8|.|}|@|@@A(8cA,@c|@|@@@|D|E|@;{@c[|@AcCcKx8!p!}8`N |`# c!```KAc$;`H2_8W%8c%cKT8|.|@A8KٱA|@,ccK@;@c|@@c|@A h8!`}H|AK_ cK-AcD?H28WC8Ccc+T8"| .|@A8KA|@,cc+@;@c|@@Ѐ8h8!`}N a|`| !Dc`K]Ac|H2;8W8aDckT8|.|@A8KA|@,aDck@;@c|@@Ѐ|80`|ch8!`a}N !|`zc !D```zKׅAcd:H2;8We8aDec+T8D|.|@A8KEA|@,aDc+@;Z@c|@@,8`|@A 8`A,A x8!p!}N a|`| !Dc`K֕Ac|H2;8W8aDckT8|.|@A8KUA|@,aDck@;@c|@@8`|@A|h8!`a}N |`c!Kۅ`cKy`H8!@}N @|<C0`}!``8`H@K`,oD ;,(@* `|A$$$H4$$$8A H *K1`8Kl``L| H*>2K`|W8K`|W88H=`cxh`8!p}N ",(|+x|+x|+xA||*N T|+x|+x|+x|+xA| 8 |T|*0c BK @X_fill@N @strcpyLA L| N PA L| N TA L| N XA L| N \A L| N `A L| N dA L| N hA L| N lA L| N pA L| N tA L| N xA L| N |A L| N A L| N ,8,@A`N 8a(;0 |(}!| |!8A8$8; LE39 @4@||; C 8|ŪHCx0, cT8#}_RJ(x| A fD#|Yj x*|x|18,0@0N N "H|!aD8`Ka`T>8`8KA`8`DK1`cK-`X8!P}N h|}&H`c|!=@C0=`E0=C0T>|c<E08c||@488 8c||@8c||K8]:H(|88H2|(@ 8d8[88@H$|y 8|`8[88@|8)88 9=9 >9@<||09d8@DadC H8@adC H$@$adC HadC 8]:(8(b8 HɀAb8KwA  ,`y@8y| 8 9C ?x@|e|`|A؀(AD| !*|`8DH"`LB @<8!`D;@; :@:;@ ;@A@K``v.A],A^8DHE`|uy@\aDHEq``f8`b84Ke`bK5`Ah8!|8`} N ,@ bb-H A`bK`AT@D8`1HpaDH@``f8`b8K`bK`A @D8`1H(A]bKi`A @Da8!|} } } N cbCH``oK| Ԁ888H |}&!`aDH``Ki`|`};;`@88d8KA-B;?H4AٮA@|: aDcH |A\|: aDcHOI``e|wycaHcAK]A`v|uy8z88Al~N@ KmA|| c8A8@@`K``}aD:bcHQI`H(ٮcHaD:bcHQ!`,{,;?@AٮAlA |AXc|A|@$LJ+BAccK``}KK `88 8`HxcHp,@cK`88`8!|} } N ,AcK`8`HcK`8`8!|} } N K8" |}&Kž!!@:`aTpXT``a<a[;@; @;:: a@aD88::aHaLA@D`at,AX| |!|A 8`8||K%`H`a||K ``wK`Tq>t|||@%-@(|` |d!|@a,A$HG`쀔`x|` |d!|A,@(@@`,A,@@@,N1p|&T 6AU||@|@@c:~h 4Ad˿A0cHE`!(]*@(A\ 萀aTcE:D0bDHM`|zyM~h LBCBA9(@, ,8`OAxH\@0G8cU 6| @}jR}eZ./:/ Aqk;K0,,A 9A, ,8`OAAX8!P}H@X8!P}N | @88,88|c @l|if ,/0/..98c|A,/A$A@08,8@ 8`N 88LBBLFAC 8`,AN ,,/A,A 8d8@ bN L 8dN 8|!a@X8@KO`,aD88,A4H YA888N8`X8!P}N @X8!P}N |`c!H AH8!@}N 8|`c!K`cK`H8!@}N @|`!8`K``};;,cA$;,A;,K,W888TA8fHKAW8K`8}cX8!P}HL|.|;C |.|fcX8!P}N Ka`}888C`K 0|!8@,AKU`8a@K`,a@DAPK%`8~t8T8j,A KAcK8a@Ka`,Da@@K9`8h8!`}N \8!`N |A`~!``K:5A`},ABX;}cK: A,,8c|iLDA`C@@H@L4cAD|0|8|0@C @(4cA |8|0| @@8c,A<,@h8`X8!PA}HX8!PA}N 8`K |`~8dd,!888T@ K̀AP,A,K,@8`H8!@}N T,AKa,@8`H8!@}N |!cHHAH8!@}N (|`~b8!,88ctcAK`b,88c,cAA K`cK H8!@}N c N 8 N ||8`!8fP88TAK A88|AH8!@}N l!|H,@t,| @Lc8cC@$,@|@A0C ,@c|@A8!@8`N 8!@8`N KՀAH8!@}N |``|!8f(8\8TA|A K̀AW8|cH8!@}N hN |}&!ԃ!paT`;TH݀A<X8|@s/a@8@8aHA,HLKɃ!d8!}N aTA4@,K,A$!d8!}N KUaT.@$K``e8`8K!`aT K,8c@,N8`8@`ATHuAcK`e8`8K`!d|8!} cH0K`!d|8!} cN K`~;cb@,A |y@\;]|`KE`d8`KU`|8`8@ K=`;|;@|`K|8`8 A K`8`8pK`,aTc@1c8!|} !N "A L| N A L| N A L| N A L| N ||y`!88A,@8f KA,88d8@ KـAD8%8`(%@؈|"|*.pA$(AB|*|:.+Ap@H8!@}N ,9%9U 6`@8`H8!@}HlA| 8T 6|BA|(8|BT>|*p@|8`H8!@}N H8!@}N d|!aDXH$m,@8`H 8aDH,ـA,8@aDK0AX8!P}N \|b`!$8/cK05A||yAp|@,;A4c8`/A(,@}M{ccc8HU;c8/K/ـA||yA|@,;KX8!P}N |c `}~H}&`pL, !`?/T6;8@ 8;ceA`AD|n8a@@cK5`8@|ٮ@H@cK/A|| ,;`b8@(`e(.@(.@ 8;| ~ @|8@|009C@l|008C@PC@4HA;{,88|0C A;{,88|c0A;{,8A;{,A;{] ||:*|c|@,|",@8|@|,K,|`AK`|b,88%8@4c%c|gK`PbX|,H}'a'I9 @č$C@T|HU*>U,>9@'a9$C H(|P8|`9$C |HU*>U$>9@4'a|}#|i88V|8d8H@|P8| |}#|i88V|8d8AKeAPbX|,,A@||:8|8@8@pP,@,|8|:|:|8@8@T>|*,|:(%T>`eA`@@|@@@4|0@@(8c8c8,(%@H 8c8,(%@8N a|``,!cA4K'A`}8/;cccKyi`|,cA4K'UA`}8;;cccKy)`|,cA(K'A`e8?8{cKx`X8!Pa}N |`;c!,AK&A;,AK&A8,AK&uA8cH8!@}N Tc 689;|d4`8| 8#8?@ 8@ 8@ 8N X8XD,|"A8|2.pA8| ,|"A|2.pK`N X|!`aD`8/KA|}yaDc@(8ekK|`aDK|`~H Ku`8}K|`~HY~HQh8!`}N a|`| @`| !``8:@8`X8!Pa}HH A|{y|@8{8cAA(Kt`|HccdKt`HcccdKt`}H}8`X8!Pa}N |!aD8lXHA,8c(@AAaDX8!P}N La`|,8`!c;8D8A`(%88@@ }|B.pA }|B.p@(8c ,A8H |@| @@ ,A`(%88K,|c| 8}@cD8!PN K{``|D,888%;`A(%99#T>T>@4}b}b.qA}b}b.q@,H} } @@,;A,|P8c|X,A4Ha,A(%99#T>T>K`||88d,8A KviAcX8!Pa}N  88H A|T>,!`88T>`h;A<|08c|9,A8A|(8c,|9K|,8|@,,c@Kx]`X8!P}N Ky``{`z,8c888%8T>9?Ax}f T>}k9A4|@;G|ePg8z89),H `z8z89),T>T>A}f }k9K|8|8d,8A KtAccX8!PA}N @8!PN `dD,A(%A 88c,@H,}':A؉,}HBA}%J.(A+Aq)A}ER.9'U) 69hqJAA|88T 6|JA|@8|JpAp888c,@L8N ܿ|`}&``}`!8cKQA|@@|/@(.*/@*/,A@;|@H,~@(.@h(/A ,@T@H;|@8@(/A;|@@(/At;|@@hK@`;cc8@X@A0;|@;@(/A;|@;K@;|@;Hd;|@HXL@hA8;|@;@P(/A;|@;K@,;;|@@@(.*/K|@A 8T|0`|cX8!P|} N ||y`!88f 8A ,@ KqAA8@c,,AAK|}yc8AAK,@XA8@A|(|0|(@@c,,ApAhK|}yc8AALKq,A@8@A4|(|0|@@$c,,K,@8`,A8`h8!`}N P||4T~N |!`H,c8A8`X8!P}HHA|}y|@AA8}8 +:@(/@(/ALBBA`HA8,8~cA|((/,LFA0Kf`|88/|!X8!P}N c8~$Kfi`X8!P}N |`!0KA|||@`(/|iAHAH8C@,HA08(/|@C A8|@(/@ @ A8`8!Ѓ}N cKi`aĐa8@K}AH,aT&(@/@L`d@$Kpa`8`8!Ѓ}N 8eA K`aK9AaK`A`|yb8cA(K}A`f8`8K`aKo`c8!Ѓ}N |ܐ`!``H ,cA$cKo`h8!`}N K1`}cKA`|c,(?+#[@ Ko`h8!`A}N (/8z8#@TKp``}cceKi`|{ccKi`8|Ѯch8!`}H;`;@c|@lK1A,@cKEA|\8zKp!``}cceKi`|}ccKh`8|ѮH8/; ;:@D(/@tH A,_(/LB3BA_|8{Ko`,`}ccEA Kh`|}ccKhm`8|ٮH|HA,,;8/LB3BA(/@8c|K,@(c@0c\8zKn`H(ALFA`y\8zKn`,`}cceA Kg`|}ccKg`~ѮHH)`,8|@8@ c? 8xKne`H~8$8 K~ccK߉Tz>~8%ccK!A,AccK;@,AbbKU`~,AbCbKU}`~,Ab#bdKUa`~,@ ,@,@ |@@0c8K~|@Ap|p|m, , |c2T:9|L#B|})JL=`Al 9kQ;@L`8H1T|c.p|ccd|c@$8`H1|c>p|}c|@9|hJ|.l<|:||Y|||`R}N HАA L| N bT8q8A||04@T|+|*@0|||(8|894@|*0K0||*N 0||+|*AN /T,/|M 00AHAA,,N@ A,N@ A$, %N@ A$,,//N@ ALN@ ALN@ AL%N@ AL$,,//KBN BN BN %BN @strncpyؐA L| N b#N " #N "|`8!<C0;@8a@PHHqADb܀@|l#T|(lCLP`*ȿȁH$*C$!*%*@|D |E?h8!`}N "|8`!HAbH8!@}N "D!|HKUm`H8!@}N $|!8`XKV`aDK]aDX8!P}N 4A L| N A L| N |!,A Kx`,A Kx`H8!@}N P|!D`eKw`|~y8@8dp8$@ KQA~~DcKN=AX8!P}N x!|`}&`!``K`b\Ty>,cc/8fHL@ \,@A Kd`.c8c@4 8`8lKeI`8`tx8!p|} HK`|zybc,8c@A Kd=`8`HpcCK`aD`f,`cE8dcA Kc`8aDK`|zyaD@H,A bD8cKc`aDKRA`x8!p!}8`N KR!`.,Ab8cKce`8` KS=` ,|2 C|@$(/Ad@HAd A(|dtx8!p|} !N ||tx8!p|} !N |a;!,`D`;`@D |c.KA,;{DA<;|@ |c.K8`h8!`a}N  ,|`cAܓh8!`a}K |8`A!Klq`;@;; ; cKpU`;(@; cK܃`,,LFAKnI`,@\8`,AdKk`\`|,A4Ks)`|eycAKo`,@ԀKs`8` Kku`c\;~8,Koa`;(8,@K8,; Ko-`;Z(8,@ KX8!PA}N |`a!`H88Ka`~aH88KM,8LAKA,;aH8@8@K,D`f|At|*.pAL8c |*;||*.pA(8c |*;||*.pK(;8`@|:|2.p@A48|:|2.p@A8|:|2.p@K|8(U@e|(R@8e|8(L@`f(=@||*.p@A48c||*.p@A8c||*.p@K耡@HcfK-,ddA haL8!` }N ,c8TAK̀A,aH88@Ka|~yc8\AKA,8c;8,@ haL8!`}N ,AxKŀA,;c|@KрA|c8dK A,cc8,@,@h8!`a}N haL8!`}N |!H`L8@8`K=,@LHAK|yaL88AlK ,aP80ALKIA,aP8AP@(-@(-A,8c| @@8,-,>K8`N 8cN (-AD8c| @@܈,-,>@(-K@(-@8cN `e8c| @A,-,>@8c| @K@X8cN !|| @}&`!`;8;bBAЋ?HA( |@@ 88`|{c@|c|iN AT:|{c@|c|iN (!@@8<;,,K8y+,', .-@/ /"A.>A LFA@ 8 ,,KT8AA,( (LEA(=A(>A(/A8,,K(-( +A4(=@(>@+/LFA@T8,,K8H(-8{t8C80A K80AK;!A8<;,,K\dh8!`|} !N AH8!`N |}&!| !``N`@|@@LDd|c|g.pc@A4`8|@@$|*|*.p@A8|@K| @@LD~|c|g.pc@A48~;| @@$|*|*.p@A;| @K@4||(@T`{@{|(@{|(K|At ,A(cdK<`@HHccK=``zK6`8_ cC@H|@|`@/8a@(&( + @,cH,@A4{@;{|@H| @AX`N |,}&`!`48<"!@;;ap;A 808`TT89.-@aDPLBDaTD9; H;|c8@`(/AXcLFAL;|@@\HA8;|@@H( (+=+>*/LA!LZL^@|@@$9; H;|c8@܀a(/@`;|@c@|`|z.pc@A0;|@@|`|z.pc@A;|@K(>@HcA( (LEA`c(=AT(/AL;|@@|HA8;|@@h( (+=+>*/LELZL^@|@cc|`Ad|z.pc@A4;|@@|`|z.pc@A;|@K( (/bqbPbobM@(@(=A (>@A(>A(=;c@|@@|d"|.T>| @4;|@@x|d"|.T>| @;|@K("c8cA ('@;|@cc@$| @A,+>+ @$@b?8| @A8H$AA4;|@@؈| @A,+>+ KcH,cA$9; H;|c8A8;|@@P||".(>p@LFBA;|@K|@cb/c:AHA c:|`|z.pc@Ka@bdbEK,@ c:|`|z.pc@Kt;9|c@}r|@}r|K|At,n`dAcKȝ`cKȑ`cK+}`,bD8e@,A K<`cx8!p}N |`~`!,``HAcb8cxK,!,8^~ 8`AD?8h@g,8A4K6]`b8c,A K69`cK$`8`X8!P}N D8!PN !|```!``8`K&`B `y88`|,y y@ 8f ccA0K5i`b8c,A K5E`?,,A#@?h8!`!}N !|HK#`H8!@}N $|!8`HK$`H8!@}N (|}&!@;ap8DK}`|~y@DaDK``f8`p8(K4`8!}8`N KUat8`K>`ax~K"``dat888K퀞axK`8@|&;`| B"8:aH|`(:|e)|Az|(@|@A,Aat8T8P8L8@Ka,Ày,ATKC`,AyTKE9`K!`aH`e,AT8w4K2`@,Ax,AHK=`,AML|(A0HؓaXa\aTP8H8\8X9Kz)``@,A,H,A ,@XT,@:a\-,ATA<TLcxKi,@W>| HTaxK`aTK `\TAL|(AX,AP*,AA8|@ :H,,A8wdK1`aH,AHAaAaHT8AKٍ``u,A(A,AKo`aH,A\HX,ADbaT8K%`|syAT8As(,A8T>-Abc8K!``r-LbdcbxTT@p,AAdK ,tATcKq`a|bCKa`L`eatT78|KYaxK`Lbdc,bxATTKdAbCK`bcK`bKn`aH,A(,@(9,@K q`,@܈(,,A(/A 8c`8c@}:}B.(AqAp9'ЉU+ 6}(B}%J.+Aq)APA|88T 6@8|ZT>(/A(H|@8|ZT>(/A 8`|P@@(8D,, +%+%AK8`N 8`N h|`!,;;c@(|c.K`;;|A,A K`cK`X8!P}N |!`,;| ;@\8c,C@@C@,HA;,C A;,A;,A;W8K`88`|,||c"8@XT889}$2,A|D|E;W8}$R||T8@|8,K| 88d 8,A K!AK`X8!P}N T||(@!```@(/@8``KQ`a@D8|E,|@,@8HT8K`T88@|c8c|D|Eh8!`}N ȿ|`, (8!`88@(8(*@88!@N @4K1A,8@ H8!@}N 8H8!@}N |!,8@AtK3`8a@K3`,a@A,K}`aDK%8a@K2`,a@@܀K:`8h8!`}N \8!`N | !8ؐaDKE`aH``aD`K`T>aHK`cX8!P}N dA| `!8K`BaD8`8䋺9K%`;aD9c8889KnI``{aD9K`,,LFAK`8|4T~h8!`A}N |a!aD`?`KaA`}pcccK9`8|c"D|ccTc6|n;@cK`8:8aA||}cdcK)`bcc,@8`!a}HK7`!a}N !|a!`?aLP`KuA`}pccKM`8|c"L|ccTc6|n;a@ccK%`8:8aA||}ccK=`~,@8`K/U`~8@8DcdK5`,@,A @~DPK3!`H$ccK=``dcPK2`!a}N !(||y!;;D;AT,@H|c.KH@LW8|c.K,;;|DA@8`h8!`}N bD |8d,,A|.@8 K#=`cK ؓ|!aDK`|y8@DdKA `f8`D8K#`8`X8!P}N `H=aHcK)`aHX8!P}N a|`u}&"8!;@A;;8` K``{BD" |@A|b8 KA,A :Hc|@@`|`|.p@A4b:|@@<|`|.p@A:|@K@(#A b||u|iAt|c|z.pc@At(#A:|@C @Ht|c|z.pc@A48t:|@@$|"|".p@A:|@K~@A8x48,8K AbHLb:~@@||".pA:~@K(-@b:~@Kb@Hu|c|z.pc@A4b:~@@$d|c|z.pc@A:~@K|@LBBAu(:A,,A8x@cK !`b;K:|@@u|c|z.pc@A4b:|@@d|c|z.pc@A:|@Kb@b~( @`b8\8 KAA,@D,@@,@|bc8@8AKA,A;;H(@Lb8h8K݀A,@0@,AAccbdb8KI;Hx(@Tb8p8KA,@8@,A8|@@8AccbdbKK,A8x|cK`b;Kd,A,ccKM8!cc|} aN {|@ {T8K `{8!cc|} aN bKHbK|`|z.bpc@(-@@88,@H@("@88,@H ( @88,@8dKM``d8&9q,9 u9@o9`t9;;#;3;`2A,;@l; g;a:m:p,&/ ,A@l88(<88@EfHD%fH48888H 8,A,&/ ,8|:G89C8eT>|"Ԙ9(T>|"D8F9H8T>|2ԘT>|2ԘcTc>|`cԘh8eT>8|:g89i9(T>|*ԘT>|*ԘcTc>|D8FT>|2ԘT>|2Ԙ88T>|*Ԙ98hT>8|*E8I&U)>} J)ԙ'89gT>|2&ԙ(D9'9UJ>}@RJԙCdTc>|`cԘed8Tc>|`cԘg8gT>|289#T>|:ԘT>|:Ԙ8T>|*Ԙ98cT>8|*E8FT>|2ԘT>|2&88(D9c9#UJ>9}@RJԙCdTc>|`cԘefTc>|`cԘg8T>|*ԘT>|*ԘT>|*Ԙ N 0,D`d|A|*.p@A48c||*.p@A8c||*.p@K,(G+-++A<@(M@(TA A@ |`|.pA 8`N 8`N |;}&9T !`.`?,`|`8;@@: ; :!A,@A:99A  $(cH<@:,A : H D,@@,A:(A$|K)``ebH<H cKY``ebH;@8 8H9pA888H9ـ{|||A0K``d8w(K)``e848H9,@DD8w<K``e8D8H9a8P8X8H9MH4,A8D8H9-8P8X8H9(,|8HHD8D8Hh`D,@,@lDH,@,@pH,A(,A (,@|H29Tv> |K%`|0`8:~cbKyA04|Vc8T: |c|d.bK۩``e8\8H8-@8d8p8H70,A8b0 c8H``e8|8H7@,@D,A888H7~@,A0KŀA|mp`naaKQ`H~DK`,`m`@L8|@@@Db8cKA`f8`8bK`99aaK`K``e88H6~,A4,A(:H5:|.,@,<`0| |&|!9W`9c| D_(|&,$8AT~,A,@,f(,A,A H9`e88H5:@x 88AHU,AhV6$vK-``e 8`8KI`,A8w(cDKq`%,A 8H3yHA,@l,@(x H``z,A8,AcDH0/A@,A<,A8w8K`@7cCH`/H4$D,T`>| LFAcCH+i/A(A8L8`8LK5`H8T8`8LK`99:` :@40TcC H)]`d|qyA,A8wtK `b#H'M8L8LH!E`p,@PL,A(KY``f8`8bKu`H<8\8`8bKY`H 8`8KE`88H D,@P\,A48888H#,A88DHm,@cKu`{DH,@|{DK`,Ah*,Aph,A8`{H,A(HL,@0{D8K``o{D|@A K=`D8`{H,A܈I,@ЁDaKŀA`e c,Tc6|n<9@9AHaaKہ`(! aL$(,|@@8`h8!`}N aLLBAKvA,,8@8A@H`,aL8@ Hm8`h8!`}HK?]`|}y8@8@ 8`h8!`}HLK=`T~>cKc;8|@,|,@8|`@|,K,AT:c#Ki`~`y.;Z,A( @( A( A|8 cKbA,A ;c8 ( AH(cKbAc8 ( A( Ac;8|KK8x|8@(|,@8|@|,K,AT:c#Km`~`yhW:c!.}8!`N |!8<HKm`H8!@}N 0`|@,|@`!`88T@ AcHxMA,c@|,|~8A;|@||i8@C@\H$@@( AA;( ( + C @@( ApAT;( @$( ( @( A@A$;8`( @,( @ 8X8!P}N 8X8!P}N T|@}&!;aD,``;`;@H8gA K`"@aH8KaA|xy~aL@$8!8`|} N 0p@,@~@@d8w(8L8 HvA,z||dp| 98(A@|@@`{ceaDHg``pZ,|NAT>| @~@A8N@~@@8w(8L8 KdH,@~@aLK9A88@<8`8!|} N aLKA8`H88y88A KuA8y,A K=`8`8!|} N KɝAK" $|0!aD,@8`Kщ`DK!`,aD@DK``dc8K]`b@D8c(,A Kq`X8!P}N |0!LHaD]``g,P/,;@`A@8ehA K`;aHLH @`eaP88HHlAHK`,b@D,8cA$AKʼn`;aHLH AKb@D8c,A KU`ch8!`}N `|c!,A K` ;;,|`@$H! ;; ||cA,A KM`cKA`X8!P}N |#;`~!pD`?c#K[A`x~K[A~ 8 ;@,@@~:vK[mA`wv K[]A;Z|8|A |Tc6;||n;A@cCc$cK`:; ;9bKZA`vc#bbK`@|y8c|T|U ;# ::,: :`:9 @~~C~#.b#KZA`pc#bb$Km`|yc8c;#2b#KZQA`rc#bEb$K1`|y8c: ;#: |@~~C~#.b#Kl8||8 8 88wA8gKA8wcD,A KQ`87cDDHa`|~yD@ H_A``e8`8DK`c!}N "!| !`,;D;`@H|.KZ]A ,aD; A8;|@|.K8`h8!`}N cH 8 c8||(8 @Kq` 8 8`K |!`aH8:`?cKXA|}y |Tc6ccA|n8a@@K`8bD@;c|ᮈ||".p@A4;||".p@A;||".p@K@K-``dHc8H-!}N !|`}|+y,/!``;`;@`@@A@KM`h8!`A}N c#H.H ,8@8|.KX%A;Z,cA ;{ |(8AЀ}|| AKy`} 8  |.h8!`}N AH8!`N $|`!,,//AAA A,<8!@N K `H(K`HK`K`H8!@}N cN N |8`!K``88``K `cH8!@}N P0|!,@HR`4,,LFBAHE`8H8!@}N l| }&@*!`;88A0KRA,D@A\|`|.p@@H@*8c8A4KR=A,bD@ A||".p@A;cTX8!P|} N |A!`?DaHKSmA`~;DKSYA@8|"|`zT6|!n;a@8PccHDKA8~|<`UU8UV`H1T|"ccT:c T6|)n;@cKa`8}Xc8K`!A}N !"C|!})P9`H8, B,DA A0KŀAH8!@}N `8!@h`K8!@KH8!@}N xDT>`G`|R|*.p@A48F|R|*.p@A8F|R|*.p@K`, @8`N ,+=|2Al|@|*.p@@\`LZ3AP8E, (=|R @A4|2.p@LFBLZA 8E, (=|R @KА| 8@`@ 8`N |2|".p@A48|2|".p@A8|2|".p@K耂@|@,+=8A@(|D|E|@@88`N 8`@l|2|".p@A48|2|".p@A8|2|".p@K("`8@ؐ`,("AA08,("AA8,("K8`AĐ|2|".p@A48|2|".p@A8|2|".p@K,|@`AA8,|@@AA8`N `,|@LFA48,|@LFA8,|@LFK|P@8AP8|*|*.p@A8|P@8A(|P@|2|2.p@A8K܈|@@88`N |8a!pah;8`HeAA@al8`8He)Ab4;|8@;T||; ah;`8@HeAK,;{ah(|8@@D@||8@K8`lHdAc8!a}N 8a@KJ``K 0|!,A K`,A HJm`H8!@}N P|b0!cH8,AH:`H8!@}N 8!@N D||+y}&`~!p```a;@; ;::):::A H,A@8 '8d08KAbsh,A@(-@(,@_]0,A(H K`]0,AK ,A,~K`,A8`@8\KY`B@sh9`8@,9|||8|!AK`a:H$\,@cK6`a:.AxaK`,Ad*,AXh,@L8`8Kq`a`Ke`,A`:H p9: \,@@\,@:,A0\,@$cK5`K`,A:.-ԁ؁:1b#K`8`KـAK`a$9,A,@8`8K}`,A|c8K7`,`fa(a,@88a 8b%K̀A8`8Ȁ$8 (K`H8`8؀$K`a,K`A(,@ `t,AhHTt,AL,ADa8KaA,@(T&(@aTaPH(,@a@DTaPH APATA ,A,@$`c8@ccfKH Tvc8@ccfK`n8`KAK`a0a`,AK`}8(4T:|r|jAh| N b#Km`H8`8 K}`aH,@ l8`8 KU`:"H:HKAA| A; ,@4c8K5``y8`c%8 K`| @,l,A ,@; ,@HЈ9.,A@@c8K55`|yyNc#H_`8`8 K}`H0lahK5``g8`8 D0cKM`8`8Ku`:"A`c#K`HP,@؀ad; ,,A@8`8 XK)`H8A4K `t,@8`8 K`pA;Ap,AЀ,Ad,A,A|A|HL,@ |@ALa|0@ |@A4KZ``e8`8 K1`8`8KY`H<8`8 K `:H88`8 @K-`8`8K`89,A,s| ,AH@,8`8 dK`:: TH8`8 K`:H@8`8 Ke`:H8`8 `KM`K,A@aHDL|@ |(@A X,@,@||@@t9h,Ap,A`H,AD,A,ad,A ,AK,A`tabK`apt!xK]`a4a@H!x*D|L@ |(@A,X/@|@@@A|@HKXi``g8`8 x04K `b#K`,@HPT|(@ |@AK̀A,@HĀpApKW``h8`8 04cK`a@DKW``g8`8 0cb)KI`a@D8|(p |)A`8`K`K@KW1``g\8`8 04K`b#K`,@HpAKV`Ha8L`KV``i8`8 04c8KY`a@DKV`Ha<L`KVq``h!8`8 (0cPP.|3xTBTF>PP.|3xTBTF>PP.|3x `TBTF>PP.|3x N x|!`D||c(8|@<#88c@8A#xcK=`|~|8TZ|"P8P.8P^>cT~Q8UZPQ.Q^>HEcDKh8!`}N A|e``~ |e,| `!||(88ccAh*cK]`{(@Wz2cD8|c@(HW{|88ceK`(@W2ccc@HQW,8ccAK`X8!PA}N T:}2|| @|h@!0%E 8@@88D@ ,}+Rx}X88cTF>TBP}]xP.}Jx}gcxTBTF>PP.}gcx}~=kc88lx}U8>U|BQ|B8}?xU~F>}Q|.x8f=l9kV}RU`>gBxUBQU{F>Q.xf8}xx|l9TB8fPTF>P.x|c:gxlxF |c;|g88:x;}bWzBSz=|9Sz.WlF>LcxW8>_|gx}g88:xf}xWYBSY}k:=kGSY.9k*}kUk`>W\F>WBSWF>S.}Z}8xx}Zx|?G8;W>WBSb8S.WF>}yx|cxbxfZ8W\BS\S\.?i;ޘW8>W[F>x '88}xW;BS;F S;.xW:F>{x?E;f$}|ZgUz`>^$]8WkBSkxSk.?W|F>;[}bU>}kxf(gx}}8;xf(U{BQ{UyF>Q{.|c}cb,}x}c8WBSCx|gS.g;x8c"0|c;Tc8>}~bx|Z&0|8}xWBS?S.WF>;qx;4W`>_f4|Zx8}{x|xc8?yW[B;C}bW_F>S[S[.U>xll88|bx}bl=I9!}lZUl>aDXx8}xZ?;%b|T(>T''xg88:x|b@Y:'x88':x|<&^8ZQ|:Tp>a|~~x'88G:x|<8Ǫ|:T>hxG88~:x|!d~~x~88:x|<D8S|:TH>AP~:~x88~:x|<آ8|:Tp>L~g~gx~88~:x|<8|:T>x~~x~88~g:x|t~'~'x~g88~:x|<78|:TH>`~:~'x~88~':x|<8 |:Tp>aH}ǂA\}ǂx~'88~:x|~r~rx~88}:x|<8|:T(>~'p~'x}88~:x|<8|:TH>~:~'x~88~':x|}ǂ}ǂx~'88~:x|z<*8L|:T>~r~rx~:x|:<89B|:T >~'~'x}:x|:~:~'x~:x|:}ǂ}ǂx~':x|:<88 |:T>~r~rx~:x|:<礿8D|:T >~'~'x}:x|:~:~'x~:x|:<8K`|:T>}ǂ}ǂx~':x|:<8p|:T>~r~rx~:x|:<(8~|:T >~'~'x}:x|:<8'|:TX>~:~'x~:x|:<80|:T>}ǂ}ǂx~':x|:<8|:T>~r~rx~:x|:<89|:T >~'~'x}:x|:<8|:TX>~:~'x~:x|:<8||:T>}ǂ}ǂx~':x|:<Ĭ8Ve|:T>~r~8}:x|:<)8"D|:T0>Ǣs8~:x|:~^:~G8:x|:<竔8#|:Tx>8~G:x|:<89|:T>8:x|:8:x|:< 8̒|:TP>~:~8:x|:<8}|:Tx>8~:x|:<煄8]|:T>}g}g8:x|:Z8}g:x|:<-8|:TP>:[8:x|:<8C|:Tx>}}8:x|:}gb}g8}:x|:Z|c8}g:x|:<;85|:TP>:}_R[8:x|:<*8һ|:Tx>|}'J|8bx}b=9ӑ}kbUk>|:}B@}+Rx}X88cKE %8!N  8@N @xstrcat8c,M |yM |yKN 4|``,!,8`Ad@X~,AK`,`A K`~,A4K`bH8c$||H( cK5``~bH8c$||X8!P}N ̾a|;;H!paLD8D@K/]A,@Tb8@hcK/aA`g8@8HcLK/mAa@8!}N caPcKj`|zyA"@hDL;cTc,AL|d"|.p@A@p|@A<\ |{K$ `,@{K#`,A$8 |@A|d|e`H`; |@A|<*8`H1T|cp|ch8!`!}N ࿡|!K#Q``}K#=`,AcX8!P}N \|!H`T>DaH,,A8`h8!`}N  aD| @AԀ,(A@@K#A,@aHH,,AA~8`h8!`}N ĿA|`c`!;`Kq`,c@X8!Pc}N H,c8.;`@ H`{c;cKM`,;Z|8.A };c@K!%A;KcX8!PA}N ؈T>8|(@,A4,@H@8|(@,@@8`N P!|H````H-0|`H8!@}N 4|!HaD`K QA`aDcHK1A,8`@8X8!P}N `|`}&`~,!`8exA Kq`cH,c`,cA(K`h8!`}|`4T~N 8eA K`ccK ŀA,b`,8cAA K`cc8K^`,b`c,;`;@; @ 8`dh8!`|} H;8c(.@;A Km`8|,;,/.AHA ;ZH A,A,cX;@;{@,;,/.Kb`,8cA K`b`.8cA4,A K`dc8;`;@ha@H`|8@8X8P8;K`P,X\,LFAKki`|PTKkU`|8@8X8P8;KȽ`,b`Bh;ûA0\X88|(@|K̀A,X\T|@\P,| @LFA,A`Kqy`PT(.@ 8cPKj`|H`(88@hKEA,X\T|@HP,| @LFAl,A`Kp`PTKj`|H(@88KрA,@P,AT|@A| T6`|n8a@DKk-`DɮDKʵ`,Ap< |g9|< @Tg  8@8X8;8PK`HHX\|(@88K A,@̀P`,ADT|@A8| T6`|n8a@HKja`H88`ɮHH̀A˟`A| dyll< h*<*Kk`|@`g  8@8X8;8PK`HT\X|(@(88 KA,@ d@ 8@8X8;8PKŕ`,A \X88|(Kc@,ADc,@,K{}`@``e8`8|K`cH8`!}H"!T|!`cLKm`,8@cLAH@|~y8,8D8AAHlDKU`,`808dH8T@ Kk%AD,@ K`aDKmq`H K`cH适b`8c`,A K~`h8!`}N h8!`}N $a|`}`c!8@8DKm`,8Hcc8AH}H,@,`DA`AHH }D`8c,}8eAHK}`Dc}Km`H8H Kl}`aD`dc}K5`}`,8c; ;~ 9^4Ax ,| A;A;A;~(,AKe``j8~cccia<8K|`h8!`a}N a|`c`!K`|}y;A`ccK`,@,K`,@|A8ccc,@8`~X8!Pa}N cK `c|,!A KjQ`,A Kj=`,A Kj)`,A Kj`cKj `H8!@}N h8`,| LB#BM 8`N (|!8` HKj`8H8!@}N 0|aܐ!`<C0P`~l,Ab`8cDKz`8`KeAh`}al8\KEA|{y@@b8cKUA`f8`8 lKz`8!a}N 8|`cdK{A}Kb``ecc8xK!A8|cdK{ŀA~8@Km`8a@K`,AD䃡D@,A c t@<,AK=,8`.cd@ t @ HAcdcK{9Acc8,A KiA} lc| aT]8ccP *8@8t8t!X@H8|8t!X@8|X!\KAp @P,Ac tK8a@K`,AD@,KԠp A,b8cKiA`f8`8̀lKy`ccKzA,@,b8cK-A`f8`8耡lKx`,A8|Kw`8!}aN "|Kὡ`! ad<C0h`8XPKqA|cyal@@b8cK}A`f8`8 hKx`8!}N 8`K}!AhalKK`|~yÃDí䃍|8;`@c,A`||".p@A}&!`aH`?LP`K 1A T68/|n;@@8aAcK]`cL8.K8cTd:H|ЀLT6|)n`78@K|zyN@$!8`|} N 8`Kw%Ah;; :d@;<LPc,c9cgADHA;99Km,LP,cccg@A;9:|@(LPc,c9cgK,A y;Tc6:`|n;@@:<:< L~,Pcb9@cgATK,A$uKiAt@; LPc,bcg9@@:s|@, L~,Pcb9@Kx|A`88d8TK[Acc$K`}`dtc8 HA,;@; @`;4c;} xKA:xK}A;9||Z@ xK||z;CcCK_9`< `x:::=:`;:@ bKA`qyK A`p|xbb%KW`~~:|xbKW`|:|8~|p@~x~X:@< bKx8|عA`8$8d8TKZ9Ac!|} N 8|`;CcCK^)``x:K #D|!aD`?`H`L8`KsuAhdcK̀A T68/|n;@@8aAcK`cL8K9|}yHAxc,@HHK\ `,P,} d LF At}8/,@HlK1,H@LKhQ`P`Kh=```f8`P8KmU`}K[%`Kh}8/,@TcKA,8cA(KT%`} DcTA|HpK[%`}HLcK,b`c8d@(,ADKk`c,AA,,=A$/A A,O,@ 8`N /F@,QL3LFA8`N h|,!8`@,8@8H@8@HՀA`~HD@8HA`~I,8`,L/AtH0K\AI,8`,L/ADc@0A Km``dbx8cKZ`8`H K\1Ah8!`}N x8|d?!8a\@A$K,8N8`8@@<8@a\8HHAa``d8~h,A KY`a`x8!p}N "a|`c`!8;H@88HA||y<888@8@x8!p}8`N H}Abx8aHc||K8aHK`ec8HHmA,8{c@$cK8`x8!pa}H,A KX`8aH,@dKaD8Dc8HH1A,8aH8cAKc,A K!``d8{0KX5`8cH̀A,cAHx8!pa}N |}&|+y!plapNAK`at``c`K5`,xct8lA@KS `x`e8`t8llKX!`8aHplKH 8`KX`8aHplKaI88HQA|y8~생M|,A |<|(/8@c888A(9@( @@@@HA8aX,,A4Ky,8aXA$K`ec8XHA,A8aHKi`e>c8HKQ,x8M8d8AP@ KBMAbxA88`KV`,Acbx8cKU`cHDA cKA(}KـAx`e8`8KVq`8`8!|} } N "h|!aPL8K ``,8D8@AK`D@c|c@HK1`LPK!|~ycc@lK`@;cc|AcK`,cA|K`aP8Ka``,8D8@A(KXcKY`cK`cH<@x8`P8耥KU`8`HcKU`8`h8!`}N P|A L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N ĐA L| N ȐA L| N ̐A L| N АA L| N b|!cH,AK`H8!@}N 8!@N ,|(A`H$8H 8T>,|(A ||sK``8`cdK6`pA~Ki`89,@4a@DK ``h8`8ccgK;`,@l,@`a8K`a܀@Da`K``g8`8؀؀chcIK;A`aK)`pAD| ,@b@D|8|A8H|9,@(bD,@|@|18At,A8xK9`8`88ceK:u`ccKQQA,A0b8cKҡA`e8`8HK:=`H,A`8`HT48`Ha@DA | |(@@AcCK{`,@;ZcCK<|@;ZcCK(~,A pAK`88`)$(8! |} !N "<||;y}&`}8! ``?``9>;::l:@88d8K$IA,@88d8K$%A  W :p, M@88d8K#As @88d8K#ՀA,(}8D@D8@8KA`@,@bx,@l@,@b9@D,@b|,@pD,@b8$D:`H:@  A >H|~ ,A HA # H= A a8$8K ``obb$K-``q,@$!8`|} N ,@@b8cKڕ`,8`@܀!8`|} N s A >H~@K1``e8`8(K6`,A8`8K4`Db#aHU``n ,AaK$E`,/ ,AA, , AAX@8`8K4i`8`8@K4Y`b#Kё`!~8` |} N 8`8K4`8`8\K4 `b#KA`!~8` |} N ,@d8`8pK3`,@H8`8|K5i`H4,4AA,K6UA,@8`8|K55`8b#HI`,, t.ADAAK6A,@dH08`8K3`8`8K3 `,@4A8`8K2`,@8`8K4`8b#HG-`,, x/AHAAK5eA,@xH4~,A K"`8tK"i`~,@D8[aK}A|oyNA8o8]KaA`nH9A ,@,,A8tK3`,@H,A,8tK2`,A8t0K2`8o8/|p@ 8@h|p8o||*8C@((.@C HC (.@,A,H,A8t@K2%`,@8`80K0`}HCy`To>,@8`8PaK2`b#aHL`,, /4/`nAA Kg` H$*Ki`,ApAbK%A,@hb8cKA`f8`8$cK#`b#K`~bCK`8`!|H.@HbCK``g8`8LK#-`,A8`8K!I`bCK`8Pb#HEQ`, AHA8`8lK"`8`8xK `b#K1`~8`HTP(2A@Km`A8`8lK"u`8`8K `8`HK1`@ 8`!|Hs @b#K`~,ApA~K`~8KA,@b8cKA`f8`8cK!`8`'!|HX8`8K`8`8K`b#K`~bCK`HK`aH8`8Kq`8`88K!%`bCK`HK`aH8`8K-`}$K``e8`8K `bCKE`HK9`aH`8`8K`8`8TK`b#K`~bCK`HK`a!|} } N 8`8Kq`8`8Ka`b#K`~bCK`HK}`a!|} } N 8`8K`b8cK A`e8`8K`bCK`a!|} } N 8`8K`8`8K`Kx8`8K}`8`8 Km`KT8`8KY`8`8@aK `b#K}`!~a|} } N 8`8K`8`8K`b#K)`!~x|} } N 8`8K`8`8K`b#K`!~t|} } N 8`8KY`8`8TKI`b#K`!~a|} N 8`8K `8`8pK`b#K1`!~a|} N 8`8K`8`8K`b#K`!~a|} N K `|~yAc8KA|@@d( A ( @P`d8c|@@<( @8c|@K( @`d8c|@KcKu``e8`8,K`cK e`KQ`|~yAc8KHK)A8`'!|} } } N !|} N !|} } N "#XA|```!T>`K`B`e8`8HK`,cc@(A K``e8`8TKm`,|||cc@p@(AHKy`aDccKE``f8`8\DK `8`,A4H,K5``e8`8pK`8`,A;ZcDK`h8!`A}N 8|!耢XaHD8`8,@ K`aHDH7`X8!P}N X|!XaDHL88,8`@ K1`aDHLH4`X8!P}N `|!axDXax,((`dAA 8cax,((AK8c8x8 A̐axKeAaDaxH`f,|"A|*.p@A,8cax,|"A||*.p@AKAh| (bA((`dKT88KA,Aax,((`dK$aDHh8!`}N 8`8K <|}&;``p`T>9~ !8H|9a\||;8Hc$\P`Ahc8@8H8,cLFA4KՃb,. `z8@{9@,,| {h/LFBAA$K``y@cH`H0ad,@cKI``y@cH`. h`z,,LBBAl@Tc#8pK-A,@HccKE``f8`8 c%K`H8`8 c%K`c#K`a@K1H,A08/cKA,@cKI`Tf>,@0,@0b,A<88HcKH8H88HcK`z. Hc88HKօ`z. @$;@`aP,A0H$,@`aP,A KE`a`,A K`ad`,A Ky`8!cC|} N A L| N A L| N A L| N A L| N |!a8KрA,@Db8cKA`f8`8pKy`8!8`}N a;;;K`,A K`aK`,A K`aK`,A K`aK`|{yAB";@::>*:TccH],A\cc8H!A|sy@cs,A8DbdK`bc,(;A8A8bd8c,(;AA8c,(;K@bcKŀA`r:3|c8XK`,@҉bcK5`aD`d,A8`K!`,|,@<@HLA@8lK`HL8`8H AH0@A8xK`HL8`8HрA|dy@`,A8K`ccK`aK``s|{yAH,Abc8HqA`d,A8K-`8`8HEA`d|syAЈ,A8K`bcH=A`s8`8HA|ryA: 0bCKI`,A<: 4bCK-`,A : 8bCK`,A: |jFp?cc88KA8|8|X8!P}N |8a샢 |#y!aH;8`?ccAKA,cbAKuA cTc6c|n8a@@K`8 @,( + A$A@,( + @c,AaPTK`,@(aTK1`8`4x8!p}N aTK `8@aPH}, @a@(2A$K`8`$x8!p}N 8,ATD||2.p@<`8,|A(|2.p@8,|K@8`#x8!p}N 98} 89C8D$`9}iJ}eZ.qkAX9)l 8}iZ}g1*Ul>}iJ}eZ.qkA,9)l 8}iZ}g1*Ul>}iJ}eZ.K( ,,8@ 8C xHKС`8`#H/ ,A8A8@8|f;HmTc:c|.8a@8!|,>/ ,A8A8@8|f;HTc:c|.8a@8,|,>/ ,A8A8@8|f;HTd:8a@| .87|,/,A;A;@;||;H]Tc:|.8k c,A K`ch8!`a}N |p<| 989'T8|8}@| |cHP@.|*Q@. |c$0|0|c8N P|a!`?`~`\K0%`|cЀTc6|n;@cK/`\Ko=A`d\cK/}``KoA`d`cK/]`;Hc8HK/`,HPLT;@|xH|*xL|D|E@l;cK/9`8@8cK.`c8HK.`,HLP;T|xH|*xL|D|EAb08@K!a}N !XDA L| N HA L| N LA L| N |bTX\;!`8dKՀA,8`(-++@$; cX8!P}Hd8@$; cX8!P}N A cX8!P}N  cX8!P}N \T!(``@|@@T:e8c}%}J}k}(8|`U:T:H@}(8|`U:T:c~ZaGJ@4)@C |8(H0,aLI@C }|@At|e|fd!N `e,| @AM 8c,| @@8`N 4|T}&`9 !`,`}````D?dA,@ H 8KM`{8\ ,A,@|@ c |@ cm ,@||AAcKŃH A ~@W:||.(-@,@`W:;~||@H(-A;~K,@W:;~||K cH~AhW:X||.8Ki`,@D8x ~|A|AcKHm~cc@8 |AT8!|8`} N W:||.(-@,@@ ,A8T|8!} 8`N ,8c8A(-@8 H,AT:||.(-A0D,A\,@ccK, @<c::,::`AD(=A?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123wbw,.IBsig == SIGALRMIutils.c%H:%M:%SIBM%Y-%m-%d %H:%M:%SIBwget-logIBMforkIBMContinuing in background, pid %d. IOutput will be written to `%s'. IBM/dev/nullrutime(%s): %s IUnlinking %s (symlink). IBMFailed to unlink symlink `%s': %s IrbIhtmlIBMhtm1IB%dIE0Y:A %.*f%cIBM I0ـYIt$ـNnk(@#fffff%.0fIBM?ffffff%.1fIBM?PbM%.1gIBM?@bM%.3fC0Aaw0123456789ABCDEFIBMbase == 8 || base == 16log.cIBwget-logIBM %s received, redirecting output to `%s'. I %s received. I%s: %s; disabling logging. %s: %s: %s ptr != NULLxmalloc.cIB%s: %s: Failed to allocate %ld bytes; memory exhausted. IBMmallocIcallocIreallocstrdup );Ok[WQ  /?"!,i9Ka~֝jבe  7CA f!*7ΑH^P}zdK5 _U^/%=kO[G)6F\I (QۚK5ަ5)n>5#F[umY?@?ـ eta %sdotbar B/sK/sM/sG/s --.-K/s IB %*s[ skipping %sK ]IBM %6sK,dp->dots < opt.dots_in_lineprogress.cI%ds%dm%s%dsIBM%dh%s%dmIBM%dd%s%dhIBM%ddIBM E0YB%3d%%IB@X@#p = %4.*f%cIBM IBMA? %sA =%s=%ssIBM0ـ.IB IdefaultbinaryImegaIBMgigaIBMInvalid dot style specification `%s'; leaving unchanged. IBpercentage <= 100IB%2d%% I100%IBMYdlsz <= progress_sizeIBinsz <= dlszIBM %4.*f%sIBM@@IBM ?zG in I%ssـ IBM ?333333@??əTERMIBMforceIBemacsUnknown hostTemporary failure in name resolutionUnknown errorIBcount > 0IBhost.cICaching %s =>IB %s IBReleasing 0x%0*lx (new refcount %d). IBDeleting unused 0x%0*lx. IBFound %s in host_name_addresses_map (%p) IBResolving %s... IBMfailed: %s. IBMfailed: timed out. , I, ...IBpos >= al->faulty && pos < al->countIBMindex == al->faultyu->host != NULLal->refcount == 1  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~B/sKB/sMB/sGB/sGiving up. Retrying. E0YIBM ?əDzdeferring a %.2f ms sleep (%s/%.2f). IB sleeping %.2f ms for %s bytes, adjust %.2f ms ?IBM 0ـ?ffffffmaxsize >= bufsizeIretr.cIremain >= 0http_proxyIftp_proxyIB%s: %s. IBMmynewloc != NULLIBM%d redirections exceeded. IError in proxy URL %s: Must be HTTP. IBError parsing proxy URL %s: %s. IBMRemoving file due to --delete-after in retrieve_from_file(): IBRemoving %s. IBunlink: %s secs >= 0IBbytes >= 0IDI:N50@X@#p =%.*f %sYsleep_between_retrievals: avg=%f,sleep=%f Iـ%s.%dhttphttp://ftpftp://0123456789ABCDEFNo errorUnsupported schemeInvalid host nameBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric address%2E%2Eindex.html*password*Istr && *strurl.ccu1 && u2IBMp2 - newstr == newlenIBscheme_str != NULLIp - result == size@/?#;IB*p == 0error_code >= 0 && error_code < countof (parse_errors)Iq - TAIL (dest) == outlenIB..IRemoving %s because of directory danger! IB%s: %sI:/I0123456789Iftp://%sIBMhttp://%s;Zx0N<[y1O?YIt$ـaappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaobjectoverlayscripttabletdthhrefcodesrcbackgroundlowsrcdatarelhttp-equivnamecontentactionI%s: %s Loaded %s (size %s). IB%s: Invalid URL %s: %s 1IBno-follow in %s: %d IBM%s: no base, merge will use "%s". I%s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. IB%s: merge("%s", "%s") -> %s IBM%s: merged link "%s" doesn't parse. IBMappending "%s" to urlpos. Ifirst != -1html-url.cIstylesheetIshortcut iconIBrefreshrobotsInoneIBMnofollowIBMt != NULLto - (pool->contents + pool->tail) <= end - beghtml-parse.cIBM,L Lx@Xch == '-'IBch == '\'' || ch == 0x22IBMch == quote_char--delete-after--spiderrecursive rejection criteriaRemoving %s. Removing %s since it should be rejected. IBDeciding whether to enqueue "%s". Idownload_child_p: parent->url is: `%s' Already on the black list. Not following non-HTTP schemes. IBMIt doesn't really look like a relative link. IBThe domain was not accepted. IBGoing to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. I%s (%s) does not match acc/rej rules. IThis is not the same hostname as the parent's (%s and %s). IBMNot following %s because robots.txt forbids it. IBMDecided to load it. IBMDecided NOT to load it. IBMorig_parsed != NULLrecur.cnew_parsed != NULLIRedirection "%s" failed the test. IDequeuing %s at depth %d IBQueue count %d, maxcount %d. IBEnqueuing %s at depth %d IB%s: %s. IBMAlready downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. Iurl_parsed != NULLIRemoving file due to %s in recursive_retrieve(): IBunlink: %s AllowingRejectingIBwgetIBMj == cntIBMres.cIB!EOL (p)IBMIgnoring malformed line %dIuser-agentIallowIBdisallowIBMIgnoring unknown field at line %dIBCannot open %s: %sI%s path %s because of rule `%s'. IB/robots.txtLoading robots.txt; please ignore errors. ..//index.htmlfile != NULLIBMconvert.cIB%d; URL=%sI?#%origIBM.origIBCannot back up %s as %s: %s IBMConverting %s... IBnothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s IwbISkipping %s at position %d. IBTO_COMPLETE: to %s at position %d in %s. IBTO_RELATIVE: %s to %s at position %d in %s. IBMSomething strange is going on. Please investigate.%d-%d IApparently %s has been removed. IBMScanning %s (from %s) Iwill convert url %s to local %s IBMwill convert url %s to complete IBMConverted %d files in %s seconds. HTTP/1.0 EOF receivedGETHEADPOST%s[%s]%s:%d[%s]:%dProxyHTTP.origunspecified [following]ignoredSTDOUT%a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %T0123456789abcdefrealmopaquenonceCbytesIBInserted `%s' into basic_authed_hosts I%s:%sIBBasic I:IBDigest username="%s", realm="%s", nonce="%s", uri="%s", response="%s"IB, opaque="I"IBBasicIBDigestIcontlen != -1IBhttp.cISkipping %s bytes of body: [IBM] aborting (%s). IB%.*sIBM] done. IBMDisabling further reuse of socket %d. IRegistered socket %d for persistent reuse. filenameIBM%s%s IBNo headers, assuming HTTP/0.9IB[writing POST file %s ... IrbIwritten == promised_sizeIBMdone] Ip - request_string == sizeI ---request begin--- %s---request end--- IBFailed writing HTTP request: %s. IBAuth-without-challenge set, sending Basic credentials. Found `%s' in basic_authed_hosts. IHost `%s' has not issued a general basic challenge. IBMAuthorizationIBRefererPragmaIno-cacheIBMbytes=%s-IBRangeIBWget/%sUser-AgentIAcceptI*/*HostIBMConnectionIKeep-AliveICookieIContent-TypeIBMapplication/x-www-form-urlencodedIBPOST data file `%s' missing: %s IBMContent-LengthIProxy-AuthorizationReusing existing connection to %s:%d. IReusing fd %d. [POST data: %s] IBM%s request sent, awaiting response... I ---response begin--- %s---response end--- %2d %s IB IContent-DispositionWWW-AuthenticateIBMNTLMIBMUnknown authentication scheme. Authorization failed. IMalformed status lineIB(no description)IBMLocationIBMLast-ModifiedIBwget_cookie_jar != NULLSet-CookieIContent-RangeIBtext/htmlIBapplication/xhtml+xmlIB.htmIBM.htmlIB.%d.htmlIBM The file is already fully retrieved; nothing to do. ILength: IBM (%s)IB, %s (%s) remaining, %s remainingI [%s] IabIwbI%s has sprung into existence. I%s: %s Saving to: `%s' IBMLocation: %s%s File `%s' already there; not retrieving. INo data received. IRead error (%s) in headers. IBM%s: unable to resolve host address `%s' IBMlocal_file == NULL || *local_file == NULLIBWarning: wildcards not supported in HTTP. ISpider mode enabled. Check if remote file exists. I(try:%2d)IB--%s-- %s %s --%s-- %s ZSPSPSdZS|SSSPSSSSSSSSSSSSSSZTSPZTSSSPSPSSSSSSZPSSPSSSSPSSSSZZSSPZUnable to establish SSL connection. IBMERROR: Redirection (%d) without location. I%s: IBMRemote file does not exist -- broken link!!! IB%s ERROR %d: %s. IBLast-modified header missing -- time-stamps turned off. IBMLast-modified header invalid -- time-stamp ignored. IBMThe sizes do not match (local %s) -- retrieving. IBServer file no newer than local file `%s' -- not retrieving. IRemote file is newer, retrieving. IRemote file exists and could contain links to other resources -- retrieving. IRemote file exists but does not contain any link -- not retrieving. IBRemote file exists and could contain further links, but recursion is disabled -- not retrieving. IRemote file exists. IB%s (%s) - Connection closed at byte %s. IBM%s (%s) - `%s' saved [%s] %s URL:%s [%s] -> "%s" [%d] IBM%s (%s) - Read error at byte %s (%s).IB%s (%s) - `%s' saved [%s/%s] I%s URL:%s [%s/%s] -> "%s" [%d] Cannot write to `%s' (%s). %s (%s) - Read error at byte %s/%s (%s). 1.11.4loginpasswordmacdefaccountrIB%s: Cannot read %s (%s). IB\%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" I%s/%sIB.netrc (ANY)permanentsessionsecureinsecurenone.com.edu.net.org.gov.mil.intFALSETRUEIBMdomainIpathIBMexpiresmax-age%lfYSyntax error in Set-Cookie: %s at position %d. ـDeleted old cookie (to be replaced.) IB Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s Ires != 0IBMcookies.cIBDiscarded old cookie. Icdm: 1I 2I 3I 4I 5I 6I 7I 8ICookie coming from %s attempted to set domain to %s IBMAttempt to fake the path: %s, %s IBocnt == countIBpos == result_sizeIrIBCannot open cookies file `%s': %s ISaving cookies to %s. IwIB# HTTP cookie file. IBM# Generated by Wget on %s. # Edit at your own risk. I:%d %s %s %s %.0f %s %s IBError writing to `%s': %s IError closing `%s': %s Done saving cookies. Closed fd %d IB%s: unable to resolve bind address `%s'; disabling bind. IBConnecting to %s|%s|:%d... Connecting to %s:%d... sock >= 0IBconnect.cIBconnected. Created socket %d. failed: %s. IBM%s: unable to resolve host address `%s' IBMLocal socket fd %d bound. Ibinding to address %s using port %i. IBYIt$ـAccepted client at socket %d. Iconaddr is: %s fd >= 0Found %d broken link. Found %d broken links. IBMFound no broken links. IBMnum_elems > 0IBspider.cIBM%s (unauthoritative) anonymous-wget@%s done. I==> PASV ... IBLength: %sI (%s)IB, %s (%s) remaining, %s remainingIbyteIBM==> PORT ... IBcon != NULLftp.cIBcon->target != NULL!((cmd & DO_LIST) && (cmd & DO_RETR))IB(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0IBM@IBLogging in as %s ... IBThe server refuses login. ILogin incorrect. IBLogged in! ==> SYST ... IBServer error, can't determine system type. done. IB==> PWD ... I/Initial VMS directory not in the form [...]! IBPreprocessing the initial VMS directory IBM old = '%s' IB new = '%s' I==> TYPE %c ... IBMdone. ==> CWD not needed. IBMchanging working directory Prepended initial PWD to relative path: IBM pwd: '%s' old: '%s' new: '%s' I*ntarget == '/'Changed file name to VMS syntax: IB Unix: '%s' VMS: '%s' IB==> CWD %s ... Write failed, closing control connection. IError in server response, closing control connection. INo such directory `%s'. IB==> CWD not required. I==> SIZE %s ... IBMtrying to connect to %s port %d IBMcouldn't connect to %s port %d: %s Invalid PORT. Isocket: %s ==> REST %s ... IBM REST failed, starting from scratch. IB==> RETR %s ... IBM==> LIST ... IBLying FTP server found, adjusting. accept: %s abIwbI%s has sprung into existence. I%s: %s %s: %s, closing control connection. IBM%s (%s) - Data connection: %s; %s (%s) - IControl connection closed. Data transfer aborted. rIBNo such file or directory `%s'. .No such file `%s'. IBMBind error (%s). IBCannot initiate PASV transfer. Cannot parse PASV response. IBMUnknown type `%c', closing control connection. Error in server greeting. IFile `%s' already there; not retrieving. IB IBM(try:%2d)IB--%s-- %s %s => `%s' IBMD%s (%s) - `%s' saved [%s] %s URL: %s [%s] -> "%s" [%d] IBRemoving file due to --delete-after in ftp_loop_internal(): IBMRemoving %s. IBunlink: %s .listingIBMUsing `%s' as listing tmp file. IBMRemoved `%s'. I%s%sIBM%s/%sIBComposing new CWD relative to the initial directory. IB odir = '%s' f->name = '%s' newdir = '%s' IBMNot descending to `%s' as it is excluded/not-included. Recursion depth %d exceeded max. depth %d. f != NULLIBRemote file no newer than local file `%s' -- not retrieving. IBRemote file is newer than local file `%s' -- retrieving. IThe sizes do not match (local %s) -- retrieving. I%s: unknown/unsupported file type. %s: corrupt time-stamp. IBMUnrecognized permissions for %s. IBInvalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s Isymlink: %s IBMSkipping directory `%s'. IBWill not retrieve dirs since depth is %d (max %d). ../Rejecting `%s'. IBMError matching %s against %s: %s IBNo matches on pattern `%s'. IBMWrote HTML-ized index to `%s' [%s]. IBMWrote HTML-ized index to `%s'. JanFebMarAprMayJunJulAugSepOctNovDecJANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDEC(nil)IBwbI%s: %s :@ �IBIndex of /%s on %s:%d�IB

IBM

IB  I%d %s %02d %02d:%02d         time unknown       Not sure    IBMLink        IBM%sIBM IB (%s bytes)-> %sIB
Directory IBMFile IBMrbItotal UNKNOWN; IBSYMLINK; IBimplicit perms %0o; IBMperms %0o; size: %s; Imonth: %s; day: %d; IByear: %d (no tm); Itime: %02d:%02d:%02d (no yr); I%s Skipping. I -> IBMlink to: %s I...I Ignoring `.' and `..'; IBMtrailing `/' on dir. IBtrailing `@' on link. Itrailing `*' on exec. IDIRECTORY; PLAINFILE; wrong VMS permissons! Ifile name: '%s' IBM.DIRIBMName: '%s' Directory IFile IBGetting additional line IBMsecond token: '%s' -IBday: '%s' Idate parsed IBMYYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ITimestamp: %ld ,)confusing VMS permissions, skipping line IBpermissions: %s -> 0%o nonsense in VMS listing, skipping this line IBMconfusing VMS listing item, leaving listing parser empty line read, leaving listing parser IMYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d IFile, size %s bytes IBMUnsupported listing type, trying Unix listing parser. 331 s/key 331 opiekey LIST -aLISTIBMtype=IB%s I Detected newlines in %s "%s"; changing to %s "%s" IBPASSIBM--> %s --> PASS Turtle Power! IBM --> %s IBMUSERIBMaddr->family == AF_INETftp-basic.cbuflen >= 6 * 4%d,%d,%d,%d,%d,%dIBaddr.family == AF_INETIPORTIBMaddr != NULLIBMport != NULLIBMPASVIBMTYPEIBMCWDRETRIBMRESTIBMSYSTIBMVMSUNIXIBMWINDOWS_NTIWINDOWS2000MACOSIBOS/400IPWD"IBSIZEwrote `%s' to STORE IBMPOSIXLY_CORRECT--I%s: option `%s' is ambiguous IB%s: option `--%s' doesn't allow an argument IBM%s: option `%c%s' doesn't allow an argument IBM%s: option `%s' requires an argument IB%s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c IB%s: invalid option -- %c IB%s: option requires an argument -- %c I%s: option `-W %s' is ambiguous IBM%s: option `-W %s' doesn't allow an argument acceptappend-outputauth-no-challengeauthnochallengebackgroundbackup-convertedbackupconvertedbackupsbasebind-addressbindaddresscacertificatecadirectorycachecertificatecertificatetypecheckcertificateclobberconnect-timeoutconnecttimeoutcontinueconvert-linksconvertlinkscontent-dispositioncontentdispositioncookiescut-dirscutdirsdebugdelete-afterdeleteafterdirectoriesdirstructdirectory-prefixdirprefixdns-cachednscachedns-timeoutdnstimeoutdomainsdont-remove-listingdot-styledotstyleegd-fileegdfileexclude-directoriesexcludedirectoriesexclude-domainsexcludedomainsexecutefollow-ftpfollowftpfollow-tagsfollowtagsforce-directoriesforce-htmlforcehtmlftp-passwordftppasswordftp-userftpuserglobheaderhelphost-directoriesaddhostdirhtml-extensionhtmlextensionhtmlifyhttp-keep-alivehttpkeepalivehttp-passwdhttppasswordhttp-passwordhttp-userhttpuserignore-caseignorecaseignore-lengthignorelengthignore-tagsignoretagsinclude-directoriesincludedirectoriesinput-fileinputkeep-session-cookieskeepsessioncookieslevelreclevellimit-ratelimitrateload-cookiesloadcookiesmax-redirectmaxredirectmirrornono-clobbernoclobberno-parentnoparentoutput-documentoutputdocumentoutput-filelogfilepage-requisitespagerequisitesparentpassive-ftppassiveftppasswordpost-datapostdatapost-filepostfileprefer-familypreferfamilypreserve-permissionspreservepermissionsprivatekeyprivatekeytypeprogressprotocol-directoriesprotocoldirectoriesproxyuseproxyproxy__compatproxy-passwdproxypasswordproxy-passwordproxy-userproxyuserquietquotarandom-filerandomfilerandom-waitrandomwaitread-timeoutreadtimeoutrecursiverefererrejectrelativerelativeonlyremove-listingremovelistingrestrict-file-namesrestrictfilenamesretr-symlinksretrsymlinksretry-connrefusedretryconnrefusedsave-cookiesTsavecookiessave-headerssaveheaderssecureprotocolserver-responseserverresponse|span-hostsspanhostsspiderhstrict-commentsstrictcommentstimeouttimestampingtriesusertuser-agentuseragentxverboseversionwait|waitretry $Mandatory arguments to long options are mandatory for short options too. Startup:  -V, --version display the version of Wget and exit.  -h, --help print this help.  -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print lots of debugging information. -q, --quiet quiet (no output).  -v, --verbose be verbose (this is the default). -nv, --no-verbose turn off verboseness, without being quiet.  -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused.  -O, --output-document=FILE write documents to FILE. -nc, --no-clobber skip downloads that would download to existing files. X -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type.  -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response.  --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS.  --connect-timeout=SECS set the connect timeout to SECS.  --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval.  --random-wait wait from 0...2*WAIT secs between retrievals. --no-proxy explicitly turn off proxy.  -Q, --quota=NUMBER set retrieval quota to NUMBER.  --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. d --limit-rate=RATE limit download rate to RATE.  --no-dns-cache disable caching DNS lookups. 8 --restrict-file-names=OS restrict chars in file names to ones OS allows. --ignore-case ignore case when matching files/directories.  --user=USER set both ftp and http user to USER. --password=PASS set both ftp and http password to PASS. Directories:  -nd, --no-directories don't create directories.  -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. d --protocol-directories use protocol name in directories.  -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options:  --http-user=USER set http user to USER. --http-password=PASS set http password to PASS. --no-cache disallow server-cached data.  -E, --html-extension save HTML documents with `.html' extension. --ignore-length ignore `Content-Length' header field.  --header=STRING insert STRING among the headers.  --max-redirect maximum redirections allowed per page.  --proxy-user=USER set USER as proxy username. --proxy-password=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. p --no-http-keep-alive disable HTTP keep-alive (persistent connections).  --no-cookies don't use cookies.  --load-cookies=FILE load cookies from FILE before session.  --save-cookies=FILE save cookies to FILE after session. --keep-session-cookies load and save session (non-permanent) cookies. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL).  --auth-no-challenge Send Basic HTTP authentication information without first waiting for the server's challenge. FTP options: de --ftp-user=USER set ftp user to USER. g --ftp-password=PASS set ftp password to PASS. oa --no-remove-listing don't remove `.listing' files. --no-glob turn off FTP file name globbing. r --no-passive-ftp disable the "passive" transfer mode. -- --retr-symlinks when recursing, get linked-to files (not dir). --preserve-permissions preserve remote file permissions. enRecursive download: cep -r, --recursive specify recursive download. epa -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). mm --delete-after delete files locally after downloading them. -k, --convert-links make links in downloaded HTML point to local files. T -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -p, --page-requisites get all images, etc. needed to display HTML page. g --strict-comments turn on strict (SGML) handling of HTML comments. -hRecursive accept/reject: fo -A, --accept=LIST comma-separated list of accepted extensions. ve -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. , --exclude-domains=LIST comma-separated list of rejected domains. g --follow-ftp follow FTP links from HTML documents. te --follow-tags=LIST comma-separated list of followed HTML tags. --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. la -X, --exclude-directories=LIST list of excluded directories. . -np, --no-parent don't ascend to the parent directory. -Mail bug reports and suggestions to . tio0--1-nab wb/SIGHUPbSIGUSR1WTF?!IB?%dd %dh %dm %ds%dh %dm %ds%dm %ds%ssUsage: %s [OPTION]... [URL]... opt->argtype != -1Imain.cIo <= countof (long_options)Try `%s --help' for more options. IxD4 Can't be verbose and quiet at the same time. IBCan't timestamp and not clobber old files at the same time. IBMCannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. IBM%sIWARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. IBMWARNING: timestamping does nothing in combination with -O. See the manual for details. IBMFile `%s' already there; not retrieving. IB%s: missing URL IBMDEBUG output created by Wget %s on %s. IBMaix4.3.3.0IRemoving file due to --delete-after in main(): Removing %s. IBunlink: %s No URLs found in %s. IBFINISHED --%s-- Downloaded: %d files, %s in %s (%s) IBMDownload quota of %s EXCEEDED! %s: illegal option -- `-n%c' IBGNU Wget %s, a non-interactive network retriever. IGNU Wget %s IBCopyright (C) 2008 Free Software Foundation, Inc. ILicense GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. IBM Originally written by Hrvoje Niksic . Currently maintained by Micah Cowan . @(#)61 1.13 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos43N 3/25/99 13:50:27 > d >p >| > > > > >? 6677(7l7768848h8899X99:6:d:p:;;D;<>P>>?8?x?@@P@@A4A|6AABB\BBC$6CtCCCD8DDEEXEEF F`FGG4G|GHH`HI@6IJ JDJJKKLK6KKL4LLM$MpMN 6N\NxNO OpOP P\PPQ4QxQ6R-A--a---b--K---.B.. ..(.8.D.D.L.X.h.|...c..k.....// /d///,/8/D/PP/d/p/|///D///////X/00 00e080D0P0\0hx/D0|F0000000000h >000E1 111$141D1P1`1P1p1|1111111I12i2 22,2@l2H2T2`2l2|222m22n22222O23o3 3p3$343<3H3T3T3`3l3x3333333334440484DY484T4d4t4d444q44Q44444444r4555 R5 5L5 505@5P5d5x555555556S66(H646@6@6H6X6hT6h6pN6p6t6666U66v6666V >6w666P > >~X >@` > >t >\ > > > >-0 >5 >2 >1 >- >0 >, >58 >3 >+ >+p >0 >* >2\ >*T >) >4 >), >& >&@ >% >% > >H >G >Gt >Fx >CX >= > > >l >= > >; >l >` >Ԑ > >l >< > > >0 > > >h > > Bx  t B| B B D` @P p x | 8 > H0  >   >, >8  >D  H @  >P$h S) H+ P  8 >X 1P > 1+ 1 1 1-@ >qh?3?errno@chmod@ close@ getpid@ mkdir@ readlink@ rename@ select@ setsid@ @ symlink@ unlink@ socket@ bind@ listen@ naccept@ recv@ @ @ ,@ ;@__mulh1@__mull1@__divss2@__divus2@__quous3@_iob@exit@ free@ malloc@ strlen@ S@ fopen64@ open64@ isatty@ realloc@ fprintf@ getenv@ _@ atoi@ strchr@ strtok@ abort@ printf@ write@ fclose@ fflush@ __flsbuf@ m@ vfprintf@ snprintf@ sprintf@ fwrite@ y@ read@ strncmp@ strrchr@ fputc@ fgets@ sscanf@ signal@ perror@ memchr@ getuid@ @ fread@ getpwuid@ strdup@ calloc@ fgetc@ lstat64@ fstat64@ stat64@ bzero@ fputs@ fseeko64@ strspn@ strpbrk@ @ mktime@ time@ @ ftello64@ @ ioctl@ qsort@ fork@ strstr@ memcmp@ fdopen@ __assert@ @ utime@ strerror@ strftime@ @ strptime@ srand48@ lrand48@ drand48@ fnmatch@ connect@ @ @ @ @  @ strtoll@ @ __divi64@ (@ __crt0v@__start  > >  > > >  >$ >, >0 >8 >< >D >H >P >T >X >\ >d >h >p >t >| > > > > > > > > > > > > > > > > > > > ? ?r ?  ?$ ?(q ?, ?0; ?4 ?8 ?<+ ?@! ?D ?H ?L ?Pl ?T# ?X ?\ ?`` ?d' ?h ?l^ ?t ?xb ?|] ? ?  ?8 ? ? ?g ? ? ?- ? ?M ?1 ?4 ?3 ?0 ? ?% ? ? ?F ?& ?  ?G ?Q ?a ?5 ?C ? ?? ?S ? ?d @f @e @W @ p @ @ @ @ @  @$ @( @, @0$ @49 @8 @<= @@\ @D @HN @LU @PI @TK @X @\_ @`Y @d@ @h. @l  @p" @t @x( @| @ @6 @ @ @ @ @k @m @j @i @ @ @P @ @A @O @ @) @ @7 @ @T @  @ @ @ @ @ @ @ @ @ A A A A  A A A A A 2 A$ A( A,: A0 A4 A8 A< A@ AD AH AL APX AT AX A\ A`> Ad< Ah Al Ap At/ Ax A|h A A AL A  A A A A A A A An A A A[ AD AV Ac A A A A A A AZ A A A A  A A A B, B* BR B H B B B B B  B$ B( B, B0 B4 B8o B<B B@E BD BH BL BP BT BX B\ B` Bd Bh Bl BpJ Bt/usr/lib:/liblibc.ashr.o sigprocmask setsockopt ngetsockname ngetpeername_system_configuration freopen64 strncasecmp vsnprintf localeconv nanosleep localtime gettimeofday setlocale setitimer fp_raise_xcp inet_addr inet_ntoah_errno_which strcasecmpgethostbyname __f64toi64rz __mod_init