ELF(44 (444@@6)6)0<<ؙؙ<<00<<``<`<Č<<Ptd<</usr/libexec/ld.soOpenBSDDm8kV|oMXwWiJBc'Tduv@Qqh"AtyY0\L36*x>rZ}f-_ %$( 7/!;HC1+9O, ^` bI RS.45s:#&<N2eEl~Kp{j[gF]U=)n?GzPa Q0&C .I-[{/ ?1@>F&GPo]<fD<n#$Q/ _ gw&(-[4?`<FPQZ!%CXJP )Q?)_;5dwHh< pJkPqw}~vng<<'%vY 2x<~N<g=,5h$? B 8*#~-<2 L9T ?D<EF-%5OIV%=:EzN;T$[e]k~q=q1x|zb D<$<$<#:@W:V#c xZ$t' X9zHvPx%VKlibssl.so.11.0SSL_set_fdSSL_set_connect_stateSSL_CTX_freememmoveX509_freeSSL_shutdown_DYNAMIC__errnoSSL_CTX_set_default_verify_pathsSSL_get_error__stack_smash_handlerqsortSSL_peekmemcpySSL_readSSL_newSSL_CTX_newSSL_library_initTLSv1_client_methodSSL_CTX_load_verify_locationsSSL_pendingSSL_CTX_set_verify__guardX509_verify_cert_error_stringstrrchrCRYPTO_freeSSL_load_error_stringsSSLv23_client_methodstrncmpX509_get_subject_namememsetSSL_CTX_ctrlSSLv3_client_methodSSLv2_client_methodSSL_CTX_use_PrivateKey_file_GLOBAL_OFFSET_TABLE_SSL_CTX_use_certificate_fileSSL_connectX509_get_issuer_nameSSL_freeSSL_get_peer_certificateSSL_get_verify_resultSSL_writelibcrypto.so.13.0RAND_load_fileioctlX509_NAME_onelinegetenvDES_set_odd_paritygetpidfgetsmallocOPENSSL_add_all_algorithms_noconfsocketfflushX509_NAME_get_text_by_NIDabortchmodacceptMD4_UpdatecallocRAND_egdbindsetsockoptRAND_file_namememchrMD4_FinalMD5_InitsignalRAND_statusstrncpy__assert2reallocDES_set_keyERR_error_stringlistenMD5_Final__sFsscanffreadfopenlocaltimefclosestrcmpERR_get_errorfputcMD4_InitfwriteDES_ecb_encryptatoistrchrfputsMD5_Updatevfprintflibc.so.43.0putcharstrcpysigsetjmp__divdi3utimerecvmemrchrgetopt_longmunmapsetitimerperrorreadlinkgetuidisattysiglongjmpoptargvsnprintfstrtollselectmmapstrncasecmpfreeaddrinforenamenanosleepgai_strerrorenvironfstatstrcatfseekooptindmktime__prognamelstatstrstrftellounlinkstrcasecmpstrtokfdopenforksrand48strdupsymlinkgettimeofdayfnmatch__swbuflrand48getpwuidfgetcatexitsetlocalegetpeernametimegmgetaddrinfostrftimelocaleconvstrptimefreopendrand48inet_ntop__moddi3strspnsetsidvasprintfmkdirstrpbrkgetsockname__got_start__got_end_edata__bss_start`</h<><W<q<<<<<<<< < < < < <<<<<<<<<<<<<<< << <!<"<# <$$<%(<&,<'0<(4<)8<*<<+@<,D<-H<.L<0P<1T<2X<3\<4`<5d<6h<7l<8p<9t<:x<;|<<<=<?<@<A<B<C<D<E<F<G<H<I<J<M<N<O<P<Q<R<S<T<U<V<X<Y<Z<\<]<^<_<`<a<b<c<d <e<f<g<h<i <j$<k(<l,<m0<n4<o8<p<<r@<sD<tH<uL<vP<wT<xX<y\<{`<|d<}h<~l<p<t<x<|<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<< <<<<< <$<(<,<0< 5<%<%vUUB҃v6,t1+t,*t't"=<u=t3tAt É1UWVS1]h DžTE كڸh EtEtTٽ^f^ f\٭\ەX٭^XP$$ <`٭\۝d٭^C `PjTVSG y 8tԍe[^_ÉUWVS]1h ك޸h `PjjRCSDž`Džd e[^_ÐUWVS } uPVWuu 8te[^_ÍvUWVS } uPVWuu 8te[^_ÍvU#vUWVS } ujVWuu U8te[^_ÉUS]S=z<u]ÃShP <S5<t&E;h%UWVSuE<"} ]"<'҉UCHCUSuEPEPWV uF}tFCHCxUe[^_Ív;C|} u߃Su׋UES)PjRN룐;C| iSu^EF/UWVS$huӉ8/tH8/tƿ< 므xù>uUVSu] Sut e[1^ÐV5ć<4$$U uh0F5ć<ÐUWVS <]u @ć<EP}WV5<蟏ttuSu e[^_ÐuStS5ć<tTV5< XuXu4$2v Sc PPVXZYP5<WEPS5ć<u' V& PVSZYP5ć<詐;S5ć<荑Xu4_u+볉 jć< jʓ<U" vC@uȃ @PFljt5ƒ w]$X<&AaAmApvA;CAue[^_&A#A3A2&AqAuAoAt뿍v&AA; Ph7 `w+Pdw TRPBHv5<\PKcGu E@ UTr$裙PXZsudXuojMA={<Dždƅ[4vCk[z@WC([=< EpTUJ_XPuc^Pd3t$dtdtE`[ =<t1t[v u؋=h< t@<9Ӌ <|09v*3U9tuh <e[^_ÉՐE@ 1҉EЉйFˉẺǹэT B~ B)ĉeԋ]Њe[^_h<$1jIQSu讒  S~XZEPu t(U;h jh<*E^Wj jV$`ƉЁ u}=z<EpEtL lj$EucNjlx ul 󥋅l@ $Ddt j$2cplǍu 󥋅p@ @뷃uuEZZYPh uDždDžhUKlt Pa u1Klt Pa u Klt Pa uJl l~hFt<\6u Uu(9ދEtF8uݸ@t Fe[^_1UWVSEXx u 1E@4ӉE>tY|6u UuF9tF8u޸t(UtUEtFUe[^_1UWVS]CE{ u 1[E4Љ]t0E\6u Uu%9ދEtF8uݸ@e[^_ËUWVS$]ECES ЉECPREC }fE$< MfEm[mu4$%M VhPM{]E9sJt; PU1u ׃9tETv9щtA8uSQ;]rEEe[^_MUWVSExp u 1ҋMI׉Mt2tv3u U9tC8uڸ@tE MJe[^_ËMA;A} @MAك QYExp u 1ҋMI׉M;t&t3u Uu9tC8uދMڋA뗋mUWVS(Exp u 1E@׉Et2tv3u U9tC8uں1B]UR UuE܋>^}ND9E܉tU܃U܃:tyUtUu}܃ 7VU1u Ӌ}Ttv9t%9щtAuu܋VQ}9}܉tE܃E܃8ue[^_Ë.vUS]C PhsJC]ÉUWVS EX@ <9s3vt PusRU u9t@u9r҉e[^_UUBM AB R‰A ÍvUS]SK 9svu 9r1[ÉBCBCUE@ÐUMSt"Atv)Au[ÍvUu u?JÉU hhpuÉUMS`Ph&̉UWVMS111;M s?BA w<\B1$u G;M r˃1[^_É.ut1t11UWVS Uu 19EEt<:119UshB a<to@[0 Áw=9s͉t 1})EMt1}tE}t1e[^_É`<7뜃:u8UuM1uӋEЉE늍v19t}E11n.u} VuuEaB9{<:qU<1VSut#VRÃ1t=z<u C؍e[^PSVh&<ŕUWVS Phmu~}ux~19}{u( Sσ 5<<h&QUWVSE@E}EEtV9} s)U `<@tE 9} sM `<@u;} v#G`<@tO;} vG`<@uEE EEE+E MQE9‰}9|9t,Ex yV06:UUJrMEU]9Es?<&< < AMCU9rҋURUM MEE)+} 9%+EMQA@9‰} v9|9t'Ex taV09UU rMUBMBEt%EUtv`<Bue[^_à V8 Mq1P(4E@ 눐}JMvWEP{EH VO8 Mq1P3E@ m+} EMQ9‰}9|9t,Ex V0f8UUJrMEQWEu uU3UBBr@9Ɖ}9|9t"My t-V18UUrMAA Vk7 Mq1P2E@ 뼃 VD7 Mq1P2E@ 2h`(t/u룉-tҀ ~t=t>t/uw-uBDh(-^UUM 9s-t$>t 9r1Àz-uz-uBvz-t19s-t>uŀz-ԉB19t-t>UWVS} ht*/t%G9 ~t=t >t/u9\`<@tG9`<@u苅t>t GPSuƅNDž`<@tG9+`<@u/> ~;t6=t1>t,/t'vG9 ~t=t >t/u95`<@tG9`<@u =>Pu A9ˉ} ;|;t1[P1[DjSODS!L)\ [ Pd0R P+ƅ/S>J=,G9`<@tG9`<@u"'`<@u>tG9sG`<@u>u9DžunDžƅu)hu므tG9}ɉ~11ɋD  D D Jt׃GP]G95`<@tG9`<@u>jSPƅG9DžEuF9s-tVWǃ99-uރVGPtىՐUVS j<11ېP$VuhL* FN 뵃 S빃tuEEe[^_ UWVS$j:h9]U`<E9]M`<ubAM뼍vE t h+<U USP]Cu ]] PUVSU u)֡hP1ۅt5D9sx t/9sx t!QPRWKCFTu̍e[^_HݐHΐUWVSjhJ><}W x:b`<@tG`<@u1tI`<t:11؉0G`<uЀ-t 1e[^_G`<tE pG11`<t:U؉֋E0GEE`<uɀ/uG`<xEpG*tC11`<t2؉0G`<u΋Ep GUWVS,] u! h<@MEN|.~$1U9tuh+ FP U ZY5 E pD=}<QM QA .=<u)=<u ={<u=<u=<hk<} wDÃF[0Pu vDhL PM A( h.<G(jjh.<$t.Pƅp pDhSh#.<h.< 8tjVh,=z< AXZXP_=^=u&Xu}m P 䋕XҸw.щ5< <<5<aB Ph 5=z<u(=<h,<$h.EP(@,84$C <u 5<#@mR[0P5t}|x11 tuQ!@uJ<W= <t4Åt.tt 8 S豇x|݅11< <h!@t}9M|9sGWVuPh8 Sjh<> S'}IQu>Y^uVS>XZVEP$> S'}IQuw> Sjh S'}IQuF>Y_VSY>XZVhPj$> SMj Q> Sjh<>< S'IQR= Sjh<= Shj P=Y_VS=XZV8V'} ʋ} ѡ<ǹ'򮡨<)ǹ')})ҋD <ҍX 'эD  PR Vu5<5Xu=<Q5<-PuhMt"RPhmRue[^-v뜐UWVSE UEUEUuEܢMC)9}  C)9|]CPuh.=<܉)ЍT0볃h{ u`p Ő؀=z< WHXZuu][<$em}<E0U WSh`$$ u Ph jjVE$>=z<u" PAXDA P# PPZYPh@1ۉh6YwXZj%w=M̅tuuGUątuuGEtuuGuAGu:u6U9Ut.U9UtEe[^_à u:vjWE9Etȃ u:Ӎv wA+vEtU9Ut u:E tE 01rCWS]6=t Eju<vCWS]=t EÊjuR<␃CWS]<t EȉÊju<␃CWS]<t EЉÊ6ju;␃CWS]f<tP9ut8M9Es*`<t!ETBЁU A9r֊jSr;ƃ랃ju^;XEj]uD;EؾMPu!1U؃BPW];ChPVC$7UX7UEe[^_v h1<74$UWVSuV1ۅt1ӋVt1э Vt1э [^_ÍvUWVS uVҋ] t#1/yPWRCS1Vt#1;yPWRCS1Vt1׹?IPQRCS1e[^_ÍvUWVS}Wƍ@$5XZSWBe[^_UVSSu L1=<UR?P0MQj1эL QSi EPj=<]u=<u={<u =<tJ Su(؋U;h9s$/tCF9s/t CF9sڀ;/u9sFCɊS/tu븀.uS/t{;uvN;uv~/t N;uv~/u끃}uVUHUS]S1҃J!‰$ZYPS!.t]ÃjSz-UWVS8Eu EV tue[^_* uyEعIMs1Ҁ}tÀ@W~ `tJEPSt2EPVtUE`<8`ue[^_hg"Uur#Št`<BuÉUWVS}u )FPv" VWPe[^_ÍvUWVS ]Etu 1e[^_Ð1E,t;CuUPVt"XZSWiUD뮍vuVH"YXSW=UBEUCƒ`<@tC`<@uqUE PuEP$xEÉK8 t1UWVS/Ê3tPu E<XSjEe[^_à UVS]۾t1t vFuFPSXu De[^ÍvUVS] SuVte[^ÐPhEƋU <EEUQu؉PRE]}EF9Ev܋U9Uw7EuEUu Wu؉PRE]udE9Ev݋u;u]ލvE QuUPRF.];uvoERPuEEu USMh<] Uw%E9tuhP= 0connect.cbind_localLocal socket fd %d bound. accept_connectionsocket_ip_addressconaddr is: %s Closed fd %d fd >= 0$tIconvert_all_linksScanning %s (from %s) Converting %s... nothing to do. wb%d-%d Skipping %s at position %d. Unable to delete `%s': %s .origwrite_backup_fileCannot back up %s as %s: %s %d; URL=%sreplace_attr_refresh_hack?#%local_quote_string/index.htmlfile != NULLconvert.cConverted %d files in %s seconds. will convert url %s to local %s will convert url %s to complete Apparently %s has been removed. TO_COMPLETE: to %s at position %d in %s. TO_RELATIVE: %s to %s at position %d in %s. Something strange is going on. Please investigate.Cannot convert links in %s: %s register_redirection L4LL4L4L4LK4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L4L8L4L8Lnoneinsecurepermanentsession (ANY)Discarded old cookie. res != 0cookies.cmax-age%lfparse_set_cookieexpirespathdomain.com.edu.net.org.gov.mil.int 8 7 5 3 2cdm: 1cookie_handle_set_cookiecookie_headerpos == result_sizeocnt == countTRUE# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. FALSE %s %s %s %.0f %s %s Done saving cookies. Error closing `%s': %s Error writing to `%s': %s Saving cookies to %s. Stored cookie %s %d%s %s <%s> <%s> [expiry %s] %s %s Deleted old cookie (to be replaced.) Syntax error in Set-Cookie: %s at position %d. Attempt to fake the path: %s, %s Cookie coming from %s attempted to set domain to %s Cannot open cookies file `%s': %s discard_matching_cookiecookie_header?byte==> LPSV ... ==> EPSV ... ==> PASV ... ftp_do_port==> LPRT ... ==> EPRT ... ==> PORT ... Length: %s (%s), %s (%s) remaining (unauthoritative) , %s remaininganonymous-wget@getftpsocket: %s ==> RETR %s ... %s (%s) - Data transfer aborted. Control connection closed. abaccept: %s ==> LIST ... No such file `%s'. done. ==> REST %s ... Invalid PORT. Bind error (%s). Cannot parse PASV response. ==> SIZE %s ... No such directory `%s'. ==> CWD %s ... Unix: '%s' VMS: '%s' *ntarget == '/'ftp.cchanging working directory ==> CWD not needed. ==> CWD not required. Logging in as %s ... Logged in! done. ==> TYPE %c ... new = '%s' old = '%s' ==> PWD ... ==> SYST ... Login incorrect. The server refuses login. Error in server greeting. con->target != NULLcon != NULLftp_loop_internalRemoving %s. unlink: %s %s URL: %s [%s] -> "%s" [%d] %s (%s) - `%s' saved [%s] --%s-- %s %s => `%s' (try:%2d).listingRemoved `%s'. ftp_retrieve_list%s: corrupt time-stamp. Creating symlink %s -> %s symlink: %s Skipping directory `%s'. f != NULLftp_retrieve_dirs%s/%s%s%s../No matches on pattern `%s'. Rejecting `%s'. getftpllHmlllllllmll=xrxlllllllllllllllllllllllllllllllllllllx;ylllllllyllllllllllllllllyzlllllllllllllll1z$~+elllll ~llllllllllllllllllllllllllllllll$D,,$D$$$$$D,,,D$,,$,l$$D,D$$$$$$$$,DD$$$$$$$$$$$$$,ftp_retrieve_listError in server response, closing control connection. %s (%s) - Data connection: %s; %s: %s, closing control connection. %s has sprung into existence. Lying FTP server found, adjusting. Write failed, closing control connection. No such file or directory `%s'. REST failed, starting from scratch. couldn't connect to %s port %d: %s trying to connect to %s port %d Cannot initiate PASV transfer. Changed file name to VMS syntax: Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' Unknown type `%c', closing control connection. Preprocessing the initial VMS directory Initial VMS directory not in the form [...]! Server error, can't determine system type. (cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0!((cmd & DO_LIST) && (cmd & DO_RETR))Removing file due to --delete-after in ftp_loop_internal(): File `%s' already there; not retrieving. Using `%s' as listing tmp file. Will not retrieve dirs since depth is %d (max %d). Unrecognized permissions for %s. %s: unknown/unsupported file type. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s The sizes do not match (local %s) -- retrieving. Remote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. Recursion depth %d exceeded max. depth %d. Not descending to `%s' as it is excluded/not-included. Composing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Error matching %s against %s: %s Wrote HTML-ized index to `%s' [%s]. Wrote HTML-ized index to `%s'. PASSftp_request--> PASS Turtle Power! --> %s 331 s/key 331 opiekey USERbuflen >= 6 * 4ftp-basic.caddr->family == AF_INETPORTftp_portaddr.family == AF_INET%d,%d,%d,%d,%d,%d,%d,%d,%dbuflen >= 21 * 4LPRTftp_lprt|%d|%s|%d|EPRTftp_eprtPASVport != NULLaddr != NULLLPSVftp_lpsvlpsv addr is: %s tmpprt[0] is: %d tmpprt[1] is: %d *port is: %d af == 6s != NULLEPSVrespline is %s respline != NULLip != NULLTYPECWDRESTRETRLIST -aLISTSYSTVMSUNIXWINDOWS_NTWINDOWS2000MACOSOS/400PWDSIZEtype= Detected newlines in %s "%s"; changing to %s "%s" %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%daddr.family == AF_INET || addr.family == AF_INET6buflen >= 4 + INET6_ADDRSTRLEN + 1 + 5ip_address_to_port_reprftp_portip_address_to_lprt_reprftp_lprtip_address_to_eprt_reprftp_pasvftp_lpsvftp_epsvJanFebMarAprMayJunJulAugSepOctNovDecrbtotalyear: %d (no tm); Skipping. Ignoring `.' and `..'; trailing `*' on exec. trailing `@' on link. trailing `/' on dir. -> link to: %s day: %d; month: %s; size: %s; implicit perms %0o; UNKNOWN; PLAINFILE; SYMLINK; DIRECTORY; :File, size %s bytes Directory Timestamp: %ld Name: '%s' wrong VMS permissons! JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDEC.DIR,permissions: %s -> 0%o date parsed day: '%s' second token: '%s' Getting additional line File file name: '%s' �Index of /%s on %s:%d� 

%d %s %02d %02d:%02d  Not sure    %s
(nil)-> %s (%s bytes)Link File Directory time unknown time: %02d:%02d:%02d (no yr); YYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d confusing VMS permissions, skipping line YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d nonsense in VMS listing, skipping this line confusing VMS listing item, leaving listing parser empty line read, leaving listing parser Unsupported listing type, trying Unix listing parser. bx}xbtoewrote `%s' to STORE skey_response );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[m@?address_list_address_ataddress_list_set_faultyaddress_list_from_addrinfoaccept_domainhost_cleanuppos >= al->faulty && pos < al->countReleasing 0x%0*lx (new refcount %d). Found %s in host_name_addresses_map (%p) failed: No IPv4/IPv6 addresses for host. host.cindex == al->faultyip - al->addresses == cntDeleting unused 0x%0*lx. Caching %s =>, ..., Resolving %s... u->host != NULLal->refcount == 1convert_and_copyadvance_declarationLL0W DWpp~~p~~~~~~~~~~~~~~~~~~p~i~~~~i~~~~~w~~~~~~~~~~~~~~~~Sto - (pool->contents + pool->tail) <= end - beghtml-parse.cch == '-'ch == '\'' || ch == 0x22ch == quote_charname_allowedmap_html_tagsappletareabasebgsoundembedfigformiframeimglayerlinkmetaobjectoverlayscripttabletdhrefbackgroundlowsrcrelhttp-equivcontentactionappending "%s" to urlpos. %s: merge("%s", "%s") -> %s %s: link "%s" doesn't parse. first != -1html-url.cstylesheetshortcut iconrefreshrobotsnofollowno-follow in %s: %d Loaded %s (size %s). %s: Invalid URL %s: %s %s: merged link "%s" doesn't parse. %s: Cannot resolve incomplete link %s. %s: no base, merge will use "%s". tag_find_urlscollect_tags_mapperrequest_set_user_headerrequest_sendp - request_string == sizehttp.cdone] [writing POST file %s ... written == promised_sizeHTTPNo headers, assuming HTTP/0.9print_response_lineskip_short_body] done. %.*sEOF received] aborting (%s). Skipping %s bytes of body: [contlen != -1filenamepersistent_available_p[%s][%s]:%dGETHEADReferer*/*AcceptHostContent-TypeContent-LengthProxy-AuthorizationProxy%2d %s Content-DispositionWWW-AuthenticateBasicNTLMAuthorization failed. gethttp(no description)LocationLast-ModifiedSet-CookieContent-Rangetext/htmlSaving to: `%s' STDOUTLength: ignoredunspecified.htm.%d.htmlapplication/xhtml+xml [following]Location: %s%s Malformed status lineKeep-AliveConnectionNo data received. Read error (%s) in headers. [POST data: %s] CONNECT?Proxy tunneling failed: %sproxy responded with: [%s] User-AgentWget/%sReusing fd %d. bytes=%s-no-cachePragmaPOSTwget_cookie_jar != NULLCannot write to `%s' (%s). http_loop%s ERROR %d: %s. %s: Remote file exists. %s URL:%s [%s] -> "%s" [%d] --%s-- %s %s --%s-- %s %a, %d %b %Y %T%A, %d-%b-%y %T%a %b %d %T %Y%a, %d-%b-%Y %T%s:%sBasic basic_authentication_encode0123456789abcdefrealmopaquenoncedigest_authentication_encode, opaque="Digestrequest_sendpost_fileskip_short_bodygethttphttp_loop$I?CC|???$I$IC$I$I$I$I$I$I$I$I$I$I$I$I$I$I>C>$I$ICC$I$I$I$I$I$I???C$I$I$IC$I$I$I$I??$IC?Failed writing HTTP request: %s. ---request begin--- %s---request end--- Auth-without-challenge set, sending Basic credentials. Host `%s' has not issued a general basic challenge. Found `%s' in basic_authed_hosts. Inserted `%s' into basic_authed_hosts Disabling further reuse of socket %d. Registered socket %d for persistent reuse. application/x-www-form-urlencoded%s request sent, awaiting response... Unknown authentication scheme. The file is already fully retrieved; nothing to do. File `%s' already there; not retrieving. ---response begin--- %s---response end--- Failed reading proxy response: %s Reusing existing connection to %s:%d. POST data file `%s' missing: %s Disabling SSL due to encountered errors. Unable to establish SSL connection. ERROR: Redirection (%d) without location. Remote file does not exist -- broken link!!! The sizes do not match (local %s) -- retrieving. Remote file exists and could contain links to other resources -- retrieving. Remote file exists but does not contain any link -- not retrieving. Remote file exists and could contain further links, but recursion is disabled -- not retrieving. Server file no newer than local file `%s' -- not retrieving. Remote file is newer, retrieving. %s (%s) - Connection closed at byte %s. %s (%s) - Read error at byte %s (%s).%s (%s) - Read error at byte %s/%s (%s). %s (%s) - `%s' saved [%s/%s] %s URL:%s [%s/%s] -> "%s" [%d] Last-modified header invalid -- time-stamp ignored. Last-modified header missing -- time-stamps turned off. Spider mode enabled. Check if remote file exists. Warning: wildcards not supported in HTTP. local_file == NULL || *local_file == NULLDigest username="%s", realm="%s", nonce="%s", uri="%s", response="%s"ntlm_inputsetup_des_keycalc_respmkhashNTLM ntlm_outputReceived a type-2 NTLM message. Unexpected empty NTLM message. Empty NTLM message, starting transaction. NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sCreating a type-1 NTLM message. NTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%cCreating a type-3 NTLM message. KGS!@#$%acceptaddhostdiralwaysrestauthnochallengebackupconvertedbindaddresscacertificatecadirectorycertificatetypecheckcertificateconnecttimeoutcontentdispositioncontinueconvertlinkscutdirsdebugdeleteafterdirprefixdirstructdnscachednstimeoutdotbytesdotsinlinedotspacingdotstyleegdfileexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftppasswdftppasswordftpproxyftpuserglobhtmlextensionhtmlifyhttpkeepalivehttppasswdhttppasswordhttpproxyhttpsproxyhttpuserignorecaseignorelengthignoretagsincludedirectoriesinet4onlyinet6onlykeepsessioncookieslimitrateloadcookieslogfileloginmaxredirectmirrornoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppostdatapostfilepreferfamilypreservepermissionsprivatekeyprivatekeytypeprogressprotocoldirectoriesproxypasswdproxypasswordproxyuserquietquotarandomfilerandomwaitreadtimeoutreclevelrecursiverefererrejectrelativeonlyremovelistingrestrictfilenamesretrsymlinksretryconnrefusedsavecookiessaveheaderssecureprotocolserverresponsespanhostsstrictcommentstimestampinguseproxyuseragentverbosewaitretryno_proxyHOMEWGETRC%s/.wgetrc%s: Error in %s at line %d. %s: Cannot read %s (%s). /tmp/wget/etc/wgetrcparse_lineSetting %s (%s) to %s init.csetoptvalval != NULL%s: %s: Invalid number `%s'. infpemasn1%s: %s: Invalid value `%s'. %s: %s: Invalid header `%s'. IPv4IPv6nocontroluppercaselowercasewindowsunixautosslv2sslv3tlsv1I=<<fP=<<< d ><<<j3><؈<<<<< d[><< df><<̉<ew><Ĉ<\f><Ԉ<f><<܈<f><<<<<<<<k><?<̈@<argtype != -1Startup: Logging and input file: Download: Directories: HTTP options: HTTPS (SSL/TLS) options: FTP options: Recursive download: Recursive accept/reject: %dd %dh %dm %dsGNU Wget %s %s: illegal option -- `-n%c' No URLs found in %s. openbsd4.3%s: missing URL SIGHUPSIGUSR1WTF?!init_switchesρׁڂڂZix6Usage: %s [OPTION]... [URL]... Mandatory arguments to long options are mandatory for short options too. -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print lots of debugging information. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --no-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O, --output-document=FILE write documents to FILE. -nc, --no-clobber skip downloads that would download to existing files. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1..SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. --no-proxy explicitly turn off proxy. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --no-dns-cache disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. --ignore-case ignore case when matching files/directories. -4, --inet4-only connect only to IPv4 addresses. -6, --inet6-only connect only to IPv6 addresses. --prefer-family=FAMILY connect first to addresses of specified family, one of IPv6, IPv4, or none. --user=USER set both ftp and http user to USER. --password=PASS set both ftp and http password to PASS. -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. --protocol-directories use protocol name in directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. --http-user=USER set http user to USER. --http-password=PASS set http password to PASS. --no-cache disallow server-cached data. -E, --html-extension save HTML documents with `.html' extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --max-redirect maximum redirections allowed per page. --proxy-user=USER set USER as proxy username. --proxy-password=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --no-cookies don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --keep-session-cookies load and save session (non-permanent) cookies. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. --content-disposition honor the Content-Disposition header when choosing local file names (EXPERIMENTAL). --auth-no-challenge Send Basic HTTP authentication information without first waiting for the server's challenge. --secure-protocol=PR choose secure protocol, one of auto, SSLv2, SSLv3, and TLSv1. --no-check-certificate don't validate the server's certificate. --certificate=FILE client certificate file. --certificate-type=TYPE client certificate type, PEM or DER. --private-key=FILE private key file. --private-key-type=TYPE private key type, PEM or DER. --ca-certificate=FILE file with the bundle of CA's. --ca-directory=DIR directory where hash list of CA's is stored. --random-file=FILE file with random data for seeding the SSL PRNG. --egd-file=FILE file naming the EGD socket with random data. --ftp-user=USER set ftp user to USER. --ftp-password=PASS set ftp password to PASS. --no-remove-listing don't remove `.listing' files. --no-glob turn off FTP file name globbing. --no-passive-ftp disable the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dir). --preserve-permissions preserve remote file permissions. -r, --recursive specify recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links make links in downloaded HTML point to local files. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut for -N -r -l inf --no-remove-listing. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . GNU Wget %s, a non-interactive network retriever. Copyright (C) 2008 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Originally written by Hrvoje Niksic . Currently maintained by Micah Cowan . Try `%s --help' for more options. Cannot specify both -k and -O if multiple URLs are given, or in combination with -p or -r. See the manual for details. WARNING: combining -O with -r or -p will mean that all downloaded content will be placed in the single file you specified. FINISHED --%s-- Downloaded: %d files, %s in %s (%s) Download quota of %s EXCEEDED! Removing file due to --delete-after in main(): DEBUG output created by Wget %s on %s. WARNING: timestamping does nothing in combination with -O. See the manual for details. Cannot specify both --inet4-only and --inet6-only.Can't timestamp and not clobber old files at the same time.Can't be verbose and quiet at the same time.?search_netrc.netrcaccountdefaultmacdefmachine%s: %s:%d: warning: "%s" token appears before any machine name %s: %s:%d: unknown token "%s" -Dddotbar %*s[ skipping %sK ] %6sKdp->dots < opt.dots_in_lineprogress.c %4.*f%c=%ss%3d%%binarymegagigaK/sM/sG/s%2d%% in %4.*f%sinsz <= dlszdlsz <= progress_size100%percentage <= 100 TERMforceemacs%dd%s%dh%dd%dh%s%dm%dm%s%dsdot_create eta %screate_imageB@@@X@= ףp#@A?333333?Gz?Invalid dot style specification `%s'; leaving unchanged. ?Enqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d --delete-after--spiderrecursive rejection criteria%s: %s. url_parsed != NULLrecur.cAlready on the black list. Decided NOT to load it. Decided to load it. The domain was not accepted. new_parsed != NULLorig_parsed != NULLretrieve_treedescend_redirect_pRemoving %s since it should be rejected. Removing file due to %s in recursive_retrieve(): Not descending further; at depth %d, max. %d. Already downloaded "%s", reusing it from "%s". download_child_p: parent->url is: `%s' Not following non-HTTP schemes. Not following %s because robots.txt forbids it. This is not the same hostname as the parent's (%s and %s). %s (%s) does not match acc/rej rules. %s (%s) is excluded/not-included. Going to "%s" would escape "%s" with no_parent on. It doesn't really look like a relative link. Deciding whether to enqueue "%s". Redirection "%s" failed the test. wgetj == cntres.cIgnoring malformed line %ddisallow!EOL (p)Cannot open %s: %sAllowingRejectingres_register_specsres_get_specs/robots.txtprune_non_exactres_parseIgnoring unknown field at line %d%s path %s because of rule `%s'. Loading robots.txt; please ignore errors. deferring a %.2f ms sleep (%s/%.2f). sleeping %.2f ms for %s bytes, adjust %.2f ms Error in proxy URL %s: Must be HTTP. Error parsing proxy URL %s: %s. Removing file due to --delete-after in retrieve_from_file(): sleep_between_retrievals: avg=%f,sleep=%f ffffff?zD:50fd_read_hunkcalc_rateretrieve_urlremain >= 0retr.cmaxsize >= bufsizeKB/sMB/sGB/s%.*f %sbytes >= 0secs >= 0%d redirections exceeded. mynewloc != NULLRetrying. Giving up. rotate_backups%s.%dftp_proxyhttp_proxyhttps_proxyCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~print_broken_linksFound no broken links. Found %d broken link. Found %d broken links. num_elems > 0spider.cinit_prngOpenSSL: %s Closed %d/SSL 0x%0*lx SSL handshake failed. Initiating SSL handshake. ssl_ctx != NULLopenssl.cERRORssl_check_certificateWARNINGconn != NULLCould not seed PRNG; consider using --random-file. Handshake successful; connected socket %d to SSL handle 0x%0*lx To connect to %s insecurely, use `--no-check-certificate'. X509 certificate successfully verified and matches host %s %s: certificate common name `%s' doesn't match requested host name `%s'. %s: cannot verify %s's certificate, issued by `%s': Unable to locally verify the issuer's authority. Issued certificate not yet valid. Issued certificate has expired. Self-signed certificate encountered. certificate: subject: %s issuer: %s %s: No certificate presented by %s. ssl_connectssl_check_certificateeo|||||||Ihttp://httpshttps://ftp://p2 - newstr == newlen@/?#;:/http://%s0123456789ftp://%sNo errorUnsupported schemeInvalid host nameBad port numberInvalid user nameIPv6 addresses not supportedInvalid IPv6 numeric address*p == 0append_uri_pathel%2E%2Eq - TAIL (dest) == outlenurl_file_name*password*p - result == sizescheme_str != NULLstr && *stru1 && u2url_escape_1reencode_escapesurl_parseurl_errorappend_uri_pathelurl_stringgetchar_from_escaped_stringare_urls_equalUnterminated IPv6 numeric addresserror_code >= 0 && error_code < countof (parse_errors)Removing %s because of directory danger! %Y-%m-%d %H:%M:%S/dev/nullforkutime(%s): %s Unlinking %s (symlink). unique_name_1make_directory%.*f%csig == SIGALRMutils.cstable_sort%.3f%.1g%.1f%.0fContinuing in background, pid %d. Output will be written to `%s'. Failed to unlink symlink `%s': %s (knNabort_run_with_timeoutABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123fffff#@MbP?Mb@?1.11.4%s: %s: Failed to allocate %ld bytes; memory exhausted. malloccallocreallocstrdupptr != NULLxmalloc.cchecking_free;?t?@1<V<[<`)<E)<K)<L<N)</<N)<a)<S)<N)<a)<a)< a)< a)< N)< ^)< a)< a)< a)<*P<a)<a)<S)<S)<S)<e)< ><܀<><#N<4N<3><>N<<><><><<<><>< O<><O<?<(O<?<6O<5?<@O<>?@<\P<R@N^n~  . > N ^ n ~         !!.!>!N!^!n!~!!!!!!!!!"".">"N"^"n"~"""""""""##.#>#N#^#n#~#########$$.$>$N$^$n$~$$$$$$$$$%%.%>%N%^%n%~%%%%%%%%%&&.&>&N&^&n&~&&&&&&&&&''.'>'N'^'n'~'''''''''((.(>(N(^(n(~(((((((.shstrtab.interp.note.openbsd.ident.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.data.eh_frame.dynamic.gotpad0.got.ctors.dtors.gotpad1.bss '- P 5= 88 F XX( OJ` U((H[0)0)a<0 i<w</ }<X<<`<4<4<<<D<``<`Č `