mariadb-client-10.6.15-150400.3.29.3<>,e p9|JxgK܌gapg&LlB>>[C \q9QR;i_UgVLj`"X𑼗/V)S C1/QAQ ʟ1 N?o<}00}eXcuvvgb7=X`5P=˿qtN.srzX>d 8.0=͎j+)$V9`f3Ia?]7x(Q@뱑;mEN@d@}rb}>FE?Ed ' :tx 17=!@! ! ! H!  i!  ! l! !  ! d % \%C%(89:=4~B4F4G4!H5,!I5!X5Y5Z68[6<\6D!]6!^8b9"c9d:Me:Rf:Ul:Wu:h!v:wB !xB!yC(zE8EHELERECmariadb-client10.6.15150400.3.29.3Client for MariaDBThis package contains the standard clients for MariaDB.e s390zl38SUSE Linux Enterprise 15SUSE LLC SUSE-GPL-2.0-with-FLOSS-exceptionhttps://www.suse.com/Productivity/Databases/Clientshttps://www.mariadb.orglinuxs390x/usr/sbin/sysusers2shadow mysql-user.conf <<"EOF" || [ -f /.buildenv ] u mysql 60 "MySQL database admin" /var/lib/mysql EOF B?>@L(>8>΀9CX   M))(*($1>Bc9zlAA큤e e He De He He He Fe Ee e e e e e e e "e e &e He e e e e e e dEdEdEdEdEdEdEff2618c4242f48e7a984cc0c95bbac507a4732f043e21f140a95cc87c26a093ad16c1b364741aa364f72774f19c77f130a3a5253845ba4e74d8a5c720e645c5462e5717a3f5971e7eea6970b1158d2643c56e7a6e1fd7a9f73789f9cbf11514d9e40a88a4ab6a060fb17cb165b25dc5cfdbff61de86e14f1cadf49529f83815423f3add49b66f20bf0384cfbcb59f99b00ef6002ddb610385f8b5890eb65e7e9b308f8559d40ee52f4655693e415b71c9cd7f82120f4c2d0a5a0604b35543a8e32914fc8a77f63b22063671e84c3fc3f7de8d6c729f970f485848402e87522bf9c7f4ce86c322ccf2700a1481cabc5d5e571addc9b4d520876bf9ca588cfc5653ca8ece4659a9e724f8ff4fa607797b31d9dd45af1aa1a508127c9d8b465ceba8840767a39d521b63d6f71ecfc53013aeef14b8d32ab4e2c22aa807ec3e51ee9e1be4318acaa2e00a39edf548e9d5ae129fa7f0dfb66ad1e63b824a6df9f03f44c2ccaa9faf36cf2867e67e2cdf1a1d8ebab0d285930b55da375ae964894a7eea7987e92c69f5547d59d33de9b4724121ceb65f3ff50c5bce5ae6b01fd0a80239c692557c1f2bd8f2e981cae9a934da46e5ac1cf8c57c728c51a53b107f334e71e18157e03db02c9b73c81ac192d173ff85a6847f601493f66f087b76855fe9032d683106781bedcbdca6c0398206fd74191991b8feb11568100b4eee81665e5e8dd90090149be367d766a5b7c37c56b305a14a4ac0429741138a026a3340b619784e7cacec5ba1a01c97bc87415744f7e81f9ed4b887bfd218a8b9716a85fdad366e217a42b72fc291de8402ac10fce0abf04a784d06516b45ad0e37c6da433d68c9c81c53efc57a6f91c11d7349ee72f35ca1969be5302f4a0a8982e0e9f66a3208f5bddce11a58c0e8ee2ec9b6d08fbff015783aaaae441c1cf107776aca9877df1ae9bf5f01835c0d992702ab77834e9f4d1acbcad8aa814c25231502c2e3149d4658900193f2cd2e36ad457974fcaf53bc4ae8f3ccc9cd07b27f878e73c67b8c86b2814c58e58f0745019b3b9438018b9a21aa3936c49c8b734b7bd07f9mariadbmariadb-adminmariadb-checkmariadbd-safe-helpermariadb-dumpmariadb-importmariadb-showrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmariadb-10.6.15-150400.3.29.3.src.rpmconfig(mariadb-client)group(mysql)mariadb-clientmariadb-client(s390-64)mysql-clientuser(mysql)@@@@@@@@@@@@@@@ @@@@@@@@@@@@@     /bin/shconfig(mariadb-client)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2)(64bit)libedit.so.0()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libmariadb3libncurses.so.6()(64bit)libncurses.so.6(NCURSEST6_5.7.20081102)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)libz.so.1()(64bit)mariadb-errormessagesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysuser-shadow10.6.15-150400.3.29.33.010.6.153.0.4-14.6.0-14.0-15.2-13.2mysql-client4.14.3dddlcc*c @bkb'E@b @a@a@aKaKaW@aba@a~@a^@a]aHwa6a@aG```KW`*b@`@`@_ǁ_#__N7_N7_3_'@^y^א^^Ǿ^@^@^v^y@^V]^U @^U @^O@^=Q@^:@^9\^9\^6^*@^,]@]@]M@]@]p]L]J@]D%]D%]9]8H@]\]@\ڭ\N\@\v{\n\j@\f\eX@\b@\-@\@\w[@[G[t[Q@[9@[[ @[M@[WZ@Z@Z@ZZ@ZH@Z$ZZaZOhZKt@Z;@ZZ@Z@YeYeY@YYcl@Y-^X@X,XpXXbWXAb@X W]NW+5V@V\:@UM@U@U@U>U@UJ@U-@U-@U@U.@T@TPT7T@TT_W@danilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comgmbr3@opensuse.orgdanilo.spinella@suse.comdanilo.spinella@suse.comsuse-beta@cboltz.dedanilo.spinella@suse.comjsegitz@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comrpm@fthiessen.dedimstar@opensuse.orgkstreitova@suse.comkstreitova@suse.commrueckert@suse.demrueckert@suse.demrueckert@suse.dekstreitova@suse.commarec@detebe.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgkstreitova@suse.comdimstar@opensuse.orgguillaume.gardet@opensuse.orgpgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comidonmez@suse.commliska@suse.czkukuk@suse.comschwab@suse.depgajdos@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comstefan.bruens@rwth-aachen.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.commliska@suse.czkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comsuse+build@de-korte.orgrick.salevsky@suse.comtbechtold@suse.comnicolas.bock@suse.comkstreitova@suse.comkstreitova@suse.comadrian.glaubitz@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkukuk@suse.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comro@suse.dersalevsky@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.orgkstreitova@suse.comrhafer@suse.devcizek@suse.comkstreitova@suse.comvcizek@suse.combwiedemann@suse.comvcizek@suse.comkstreitova@suse.comfvogt@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.org13ilya@gmail.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commichal.hrusecky@opensuse.orgmichal.hrusecky@opensuse.orgdvaleev@suse.comsweet_f_a@gmx.demichal.hrusecky@opensuse.orgmgorse@suse.comxrigou@otenet.grxrigou@otenet.grmichal.hrusecky@opensuse.orgledest@gmail.com- Update to 10.6.15: https://mariadb.com/kb/en/mariadb-10-6-15-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-15-changelog/ * fixes for the following security vulnerabilities: 10.6.15: none- Update to 10.6.14: https://mariadb.com/kb/en/mariadb-10-6-14-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-14-changelog/ * fixes for the following security vulnerabilities: 10.6.14: none- Update to 10.6.13: https://mariadb.com/kb/en/mariadb-10-6-13-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-13-changelog/ * fixes for the following security vulnerabilities: 10.6.13: CVE-2022-47015 (bsc#1207404) - Update list of skipped tests- Update to 10.6.12: https://mariadb.com/kb/en/library/mariadb-10612-release-notes https://mariadb.com/kb/en/library/mariadb-10612-changelog https://mariadb.com/kb/en/library/mariadb-10611-release-notes https://mariadb.com/kb/en/library/mariadb-10611-changelog * fixes for the following security vulnerabilities: 10.6.12: none 10.6.11: none - Update mariadb.keyring - Update list of skipped tests- Update to 10.6.10: https://mariadb.com/kb/en/library/mariadb-10610-release-notes https://mariadb.com/kb/en/library/mariadb-10610-changelog * fixes for the following security vulnerabilities: 10.6.10: none- Update to 10.6.9: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1069-release-notes https://mariadb.com/kb/en/library/mariadb-1069-changelog * fixes for the following security vulnerabilities: 10.6.9: CVE-2022-32082 (bsc#1201162) CVE-2022-32089 (bsc#1201169) CVE-2022-32081 (bsc#1201161) CVE-2022-32091 (bsc#1201170) CVE-2022-32084 (bsc#1201164) CVE-2022-38791 (bsc#1202863) * The package is not affected by the following security vulnerabilities: CVE-2018-25032 (bsc#1197459) - Update mysql-systemd-helper to be aware of custom group, bsc#1200105 - Update list of skipped tests- Update to 10.6.8 (bsc#1199928): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1068-release-notes https://mariadb.com/kb/en/library/mariadb-1068-changelog * fixes for the following security vulnerabilities: 10.6.8: CVE-2021-46669 CVE-2022-27376 (bsc#1198628) CVE-2022-27377 (bsc#1198603) CVE-2022-27378 (bsc#1198604) CVE-2022-27379 (bsc#1198605) CVE-2022-27380 (bsc#1198606) CVE-2022-27381 (bsc#1198607) CVE-2022-27382 (bsc#1198609) CVE-2022-27383 (bsc#1198610) CVE-2022-27384 (bsc#1198611) CVE-2022-27386 (bsc#1198612) CVE-2022-27387 (bsc#1198613) CVE-2022-27444 (bsc#1198634) CVE-2022-27445 (bsc#1198629) CVE-2022-27446 (bsc#1198630) CVE-2022-27447 (bsc#1198631) CVE-2022-27448 (bsc#1198632) CVE-2022-27449 (bsc#1198633) CVE-2022-27451 (bsc#1198639) CVE-2022-27452 (bsc#1198640) CVE-2022-27455 (bsc#1198638) CVE-2022-27456 (bsc#1198635) CVE-2022-27457 (bsc#1198636) CVE-2022-27458 (bsc#1198637) CVE-2022-32088 (bsc#1201168) CVE-2022-32087 (bsc#1201167) CVE-2022-32086 (bsc#1201166) CVE-2022-32085 (bsc#1201165) CVE-2022-32083 (bsc#1201163) - Update list of skipped tests - The following issue is not affecting this package: * CVE-2022-21427- Build mariadb-galera on SLE (jsc#SLE-22245) - Add dependency on galera-4 for mariadb-galera - Remove old constraints for mariadb-galera- Update to 10.6.7 (bsc#1196016): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1067-release-notes https://mariadb.com/kb/en/library/mariadb-1067-changelog https://mariadb.com/kb/en/library/mariadb-1066-release-notes https://mariadb.com/kb/en/library/mariadb-1066-changelog * fixes for the following security vulnerabilities: 10.6.7: CVE-2021-46665 CVE-2021-46664 CVE-2021-46661 CVE-2021-46668 CVE-2021-46663 10.6.6: CVE-2022-24052 CVE-2022-24051 CVE-2022-24050 CVE-2022-24048 CVE-2021-46659, bsc#1195339 - Skip failing tests for s390x, fixes bsc#1195076 * suse_skipped_tests.list - Remove upstreamed patches: * mariadb-10.0.15-logrotate-su.patch * mariadb-10.1.1-mysqld_multi-features.patch - Refresh mariadb-10.2.4-logrotate.patch - The following issues have already been fixed in this package but weren't previously mentioned in the changes file: CVE-2021-46658, bsc#1195334 CVE-2021-46657, bsc#1195325- The following issues have already been fixed in this package but weren't previously mentioned in the changes file: bsc#1189320 CVE-2021-2154, bsc#1185872 CVE-2021-2166, bsc#1185870 CVE-2021-27928, bsc#1183770 MDEV-23851- Fix rpmlint errors - Run spec-cleaner- Enable LZ4 compression for INNODB and ROCKSDB, fixes bsc#1186031- Revert systemd hardening * Remove harden_mariadb.service.patch- Add CONFIG parameter to %sysusers_generate_pre- Update to 10.6.5 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1065-release-notes https://mariadb.com/kb/en/library/mariadb-1065-changelog * fixes for the following security vulnerabilities: 10.6.5: none - Not affected by [CVE-2021-35604], bsc#1192497 - Drop upstreamed patch: * mariadb-10.2.19-link-and-enable-c++11-atomics.patch- Use pam macros instead of hardcoding directories, fixes bsc#1191038 - Add fix-pamdir.patch- Add func_math_tests_MDEV-26645.diff to avoid test failures in the func_math test on Tumbleweed s390x and ppc64 until MDEV-26645 gets fixed upstream- Fix socket address in mariadb@.socket file- Added hardening to systemd service(s) (bsc#1181400). Added patch(es): * harden_mariadb.service.patch Modified: * mariadb.service.in- Replace %{_rpmconfigdir}/macros.d with %{_rpmmacrodir}, remove ownership of this directory. Fixes boo#1182218 - Run spec-cleaner- Update to 10.6.4 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1064-release-notes https://mariadb.com/kb/en/library/mariadb-1064-changelog https://mariadb.com/kb/en/library/mariadb-1063-release-notes https://mariadb.com/kb/en/library/mariadb-1063-changelog https://mariadb.com/kb/en/library/mariadb-1062-release-notes https://mariadb.com/kb/en/library/mariadb-1062-changelog https://mariadb.com/kb/en/library/mariadb-1061-release-notes https://mariadb.com/kb/en/library/mariadb-1061-changelog https://mariadb.com/kb/en/library/mariadb-1060-release-notes https://mariadb.com/kb/en/library/mariadb-1060-changelog * fixes for the following security vulnerabilities: 10.6.4: CVE-2021-2372 CVE-2021-2389 - Removed support to tokudb as it has been removed from upstream - Refresh mariadb-10.2.4-fortify-and-O.patch - Add new systemd socket from upstream- Support both rpmlint 1.x and 2.x.- Update rpmlint rules in order to work with rpmlint2 (bsc#1179049).- Update to version 10.5.10 * Fix CVE-2021-2154 * Add ST_DISTANCE_SPHERE for calculating the spherical distance between two geometries (point or multipoint) on a sphere * Fix: Crash with invalid multi-table update of view in 2nd execution of SP * Fix: Incorrect name resolution for subqueries in ON expressions * Fix: Complex query in Store procedure corrupts results * Fix: DELETE HISTORY may delete current data on system-versioned table * Fix: Crashes with nested table value constructors * Fix: Server crashes in thd_clear_errors() * Fix: The statement set password=password('') executed in PS mode fails in case it is run by a user with expired password * Full changes: https://mariadb.com/kb/en/mariadb-10510-changelog/ - Drop mariadb-10.5.9-cmake-3.20.patch, applied upstream- Add mariadb-10.5.9-cmake-3.20.patch: Fix syntax error which is exposed by cmake 3.20.- Update to 10.5.9 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1059-release-notes https://mariadb.com/kb/en/library/mariadb-1059-changelog * fixes for the following security vulnerabilities: 10.5.9: none - Tracker bug: [bsc#1182739] - Update fixes [bsc#1182255] (MDL BF-BF Conflict caused by TRUNCATE TABLE) - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - remove fix-lock-rollback-assert-abort.patch (applied upstream)- update the list of the skipped tests- exclude galera files if we build without this feature. - switch from 664 to 644 for my.cnf configuration file (probably a typo)- added fix-lock-rollback-assert-abort.patch fix an abort when a transaction is rolled back - track all patches in a series so we can easily set up a quilt tree without requiring all the devel packages- switch to bcond_with to make it easier to enable galera support via the prjconfig - fix non galera case for building- Update to 10.5.8 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1058-release-notes https://mariadb.com/kb/en/library/mariadb-1058-changelog * fixes for the following security vulnerabilities: 10.5.7: CVE-2020-14812, CVE-2020-14765, CVE-2020-14776, CVE-2020-14789 10.5.8: none - tracker bugs: [bsc#1177472] and [bsc#1178428] - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - update suse_skipped_tests.list- update to 10.5.6 * release notes and changelog https://mariadb.com/kb/en/mariadb-1056-release-notes https://mariadb.com/kb/en/mariadb-1056-changelog * fixes for the following security vulnerabilities: 10.5.6: CVE-2020-15180 < 10.5.6: none - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - drop mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch - mariadb now builds against pcre2 - added binaries aria_s3_copy and mariadb-conv to tools subpackage - added type_test.type_test_double to list of skipped tests- Using basic.target dependencies is not needed with any systemd release unless DefaultDependencies is disabled, remove from unit files- Mariadb uses hrtimers with absolute CLOCK_REALTIME values, this won't work correctly if the clock isn't set and will do funny things if it goes backward after starting the server as POSIX says that the new clock value shall influence them, start the service after time-sync.target to workaround the problem.- Update to 10.4.14 [bsc#1175596] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10414-release-notes https://mariadb.com/kb/en/library/mariadb-10414-changelog * fixes for the following security vulnerabilities: none * the update fixes [bsc#1174559] and [bsc#1173516] (MariaDB crashes at db_sync from Keystone) - refresh mariadb-10.2.4-fortify-and-O.patch - fix patch sequence - run spec-cleaner - build galera for openSUSE only - update suse_skipped_tests.list - tune the testsuite to avoid randomly failing tests- Fix installed .service files to follow the /usr/lib -> /usr/libexec move (boo#1174811).- Update _constraints to make it more readable and request more memory for aarch64 to avoid occasionnal OOM errors on %check- rpm macros: $TEST_USER identified by $TEST_PASS is actually user of the database for which client conf should be made for - rpm macros: database name or names can be specified as a %mysql_testserver_start and %mysql_testserver_cconf parameter - modified sources % macros.mariadb-test- Build with oqgraph by default for all codestreams [jsc#SLE-12253]- Update to 10.4.13 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10413-release-notes https://mariadb.com/kb/en/library/mariadb-10413-changelog * fixes for the following security vulnerabilities: CVE-2020-2752, CVE-2020-2812, CVE-2020-2814, CVE-2020-2760, CVE-2020-13249 - fixes [bsc#1168380] (the same as [bsc#1166781]) MDEV-21244 mysql_upgrade creating empty global_priv table support upgrades from 5.2 privilege tables - drop specfile "hacks" as things work correctly in upstream now: * renaming tmpfiles.conf -> mariadb.conf * installing pam_user_map.so to /lib64/security for non 32bit architectures * sysusers.conf was renamed to mariadb.conf - update suse_skipped_tests.list- move mariadb-client-test from client subpackage to test subpackage so the symlink from mariadb-client-test -> mysql_client_test works [bsc#1170204]- Add oqgraph.social to the suse_skipped_tests.list (reported upstream as MDEV-22280) [bsc#1169369]- Add -Wl,-Bsymbolic -Wl,-Bsymbolic-functions to linker flags so that symbols are resolved locally if possible, this will avoid https://bugs.kde.org/show_bug.cgi?id=391362- Add mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch in order to fix boo#1158405 (MDEV-21248).- Cleanup mysql user creation/handling and use sysusers.d- Bump disk constraint to 18Gb- test macros: clarify who is admin and user of the database, fix build with 10.4 - modified sources % macros.mariadb-test- remove @VERSION@ from mariadb.service and mariadb@.service- disable testing with rpm macros as it does not work as for 10.4, needs to be investigated- update suse_skipped_tests.list for ppc- rename mariadb.rpmlintrc to mariadb-rpmlintrc - for ppc install pam_user_map.so in /lib/security- rename mariadb-10.2.12-harden_setuid.patch to mariadb-10.4.12-harden_setuid.patch to match the correct version number. - add mariadb-10.4.12-fix-install-db.patch to improve default behaviour of mysql_install_db. This prevents performing security sensitive actions to be performed but instead only warns the caller (bsc#1160868).- update to 10.4.12 [jsc#SLE-8269] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10412-release-notes https://mariadb.com/kb/en/library/mariadb-10412-changelog https://mariadb.com/kb/en/library/mariadb-10411-release-notes https://mariadb.com/kb/en/library/mariadb-10411-changelog * fixes for the following security vulnerabilities: CVE-2020-2574 * don't let mysql_install_db set SUID bit for auth_pam_tool in rpm/deb packages CVE-2020-7221 [bsc#1160868] - add mariadb-10.2.12-harden_setuid.patch to harden auth_pam_tool setuid-root binary [bsc#1160285] - pack pam_user_map.so module in the /%{_lib}/security directory and user_map.conf configuration file in the /etc/security directory - fix race condition with mysql_upgrade_info status file by moving it to the location owned by root (/var/lib/misc) CVE-2019-18901 [bsc#1160895] - move .run-mysql_upgrade file from $datadir/.run-mysql_upgrade to /var/lib/misc/.mariadb_run_upgrade so the mysql user can't use it for a symlink attack [bsc#1160912] - change -DWITH_COMMENT and -DCOMPILATION_COMMENT to be SUSE/openSUSE independent- enhance mariadb.service and mariadb@.service with various options (Documentation=, User=, Group=, KillSignal=, SendSIGKILL=, Restart=, RestartSec=, CapabilityBoundingSet=, ProtectSystem=, ProtectHome=, PermissionsStartOnly= and UMask=) [bsc#1160878] - mysql-systemd-helper: use systemd-tmpfiles instead of shell script operations for a cleaner and safer creating of /run/mysql [bsc#1160883]- update to 10.4.10 * changes and improvements for 10.4 https://mariadb.com/kb/en/changes-improvements-in-mariadb-104/ * fixes for the following security vulnerabilities: none - pack mariadb variants of the mysql binaries (e.g. mariadb-dumpslow is a symlink to mysqldumpslow and the like) - refresh mariadb-10.2.4-fortify-and-O.patch - update suse_skipped_tests.list - _constraints: increase physicalmemory value - package auth_pam_tool setuid binary properly - add cracklib-password-check subpackage but do not build it right now (cracklib-dict-full >= 2.9.0 is not available yet) - add rcmariadb compat link - add mariadb.rpmlintrc file - do not move my_safe_process to bindir but use rpmlint arch-dependent-file-in-usr-share exception for it (this file is used just for the testing and it doesn't have to be in bindir- added rpm test macros: %mysql_testserver_start, %mysql_testserver_cconf, %mysql_testserver_stop First two consuments are python-sortinghat and python-mysqlclient.- update the list of the skipped tests- update to 10.3.20 * notable changes for 10.3.20 * MDEV-20987: InnoDB fails to start when FTS table has FK relation * notable changes for 10.3.19 * MDEV-20864: Debug-only option innodb_change_buffer_dump for dumping the contents of the InnoDB change buffer to the server error log at startup. * MariaBackup: * MDEV-18438: mbstream recreates xtrabackup_info on same directory as backup file * MDEV-20703: mariabackup creates binlog files in serve binlog directory on --prepare --export step * FULLTEXT INDEX: * MDEV-19647: Server hangs after dropping full text indexes and restart * MDEV-19529: InnoDB hang on DROP FULLTEXT INDEX * MDEV-19073: FTS row mismatch after crash recovery * MDEV-20621: FULLTEXT INDEX activity causes InnoDB hang * MDEV-20927: Duplicate key with auto increment * ALTER TABLE: * MDEV-20799: DROP Virtual Column crash * MDEV-20852: BtrBulk is unnecessarily holding dict_index_t::lock * System-Versioned Tables: * MDEV-16210: FK constraints on versioned tables use historical rows, which may cause constraint violation * MDEV-20812: Unexpected ER_ROW_IS_REFERENCED_2 or server crash in row_ins_foreign_report_err upon DELETE from versioned table with FK * Galera wsrep library updated to 25.3.28 * Fixes for the following security vulnerabilities: CVE-2019-2974, CVE-2019-2938 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10320-release-notes https://mariadb.com/kb/en/library/mariadb-10320-changelog https://mariadb.com/kb/en/library/mariadb-10319-release-notes https://mariadb.com/kb/en/library/mariadb-10319-changelog - remove mariadb-10.3.17-fix_ppc_build.patch (applied upstream) - refresh * mariadb-10.2.4-logrotate.patch * mariadb-10.0.15-logrotate-su.patch- update to 10.3.18 * notable changes * Connect updated to Connect 1.06.0010 * MDEV-20066: This bug could cause a table to become corrupt if a column was added instantly * MDEV-15326: A race condition in InnoDB transaction commit that affects record locking was fixed * MDEV-17187: Table doesn't exist in engine after ALTER of FOREIGN KEY * MDEV-20301: InnoDB's MVCC has O(N^2) behaviors * MDEV-18128: Simplify .ibd file creation * MDEV-20060: Failing assertion: srv_log_file_size <= 512ULL << 30 while preparing backup * MDEV-20247: Replication hangs with "preparing" and never starts * MDEV-17614: Remove unnecessary locking for INSERT...ON DUPLICATE KEY UPDATE * MDEV-20311: row_ins_step accesses uninitialized memory * MDEV-19947: Repositories for RHEL 8 ppc64le added * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10318-release-notes https://mariadb.com/kb/en/library/mariadb-10318-changelog- Use instead of for _constraints, increasing the worker pool on x86_64 from 6 to >700.- remove sql_mode from my.ini/my.cnf as NO_ENGINE_SUBSTITUTION and STRICT_TRANS_TABLES are already set by default from version 10.2.4 [bsc#1144314]- add mariadb-10.3.17-fix_ppc_build.patch to fix a compilation failure for ppc if ${CRC32_LIBRARY} target has no COMPILE_FLAGS yet. Then GET_TARGET_PROPERTY returns COMPILE_FLAGS-NOTFOUND, which doesn't work very well when it's later fed back into COMPILE_FLAGS. - _constraints: increase the memory because of the ppc build - adjust mysql-systemd-helper ("shutdown protected MySQL" section) so it checks both ping response and the pid in a process list as it can take some time till the process is terminated. Otherwise it can lead to "found left-over process" situation when regular mariadb is started [bsc#1143215]- update to 10.3.17 [bsc#1141798] * notable changes: * MDEV-19795: Merge upstream MyRocks. * MDEV-17228: Encrypted temporary tables are not encrypted. * MDEV-18328: Disks Plugin is now stable and requires the FILE privilege. * Merge relevant InnoDB changes from MySQL 5.7.27 * Adjust spin loops to the x86 PAUSE instruction latency * CREATE TABLE: MDEV-19292, MDEV-20102 * ALTER TABLE: MDEV-15641, MDEV-19630, MDEV-19916, MDEV-19974 * Indexed virtual columns: MDEV-16222, MDEV-17005, MDEV-19870 * FULLTEXT INDEX: MDEV-14154 * Encryption: MDEV-17228, MDEV-19914 * Galera + FOREIGN KEY: MDEV-19660 * Recovery & Mariabackup: MDEV-19978 * MDEV-19781: Add page id matching check in innochecksum tool * MDEV-20091: DROP TEMPORARY table is logged despite no CREATE was logged * MDEV-19427: mysql_upgrade_service throws exception upgrading from 10.0 to 10.3 * MDEV-19814: Server crash in row_upd_del_mark_clust_rec or Assertion * MDEV-17363: Compressed columns cannot be restored from dump * fixes for the following security vulnerabilities: CVE-2019-2805, CVE-2019-2740, CVE-2019-2739, CVE-2019-2737, CVE-2019-2758 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10317-release-notes https://mariadb.com/kb/en/library/mariadb-10317-changelog - add "BuildRequires: python3" as some tests and myrocks_hotbackup script need python3. Make the PYTHON_SHEBANG value configurable [bsc#1142909] - remove "innodb_file_format" option from my.ini (my.cnf) file that was removed in MariaDB 10.3.1. Also remove "innodb_file_per_table=ON" option that is by default ON and it's redundant now. - remove mariadb-10.2.9-galera_cnf.patch as it's not clear what the correct path to galera wsrep provider is while users can use galera 3, galera 4 or galera compiled on their own - add "Requires: python3-mysqlclient" that is needed by myrocks_hotbackup script- Use FAT LTO objects in order to provide proper static library.- remove client_ed25519.so plugin because it's shipped in mariadb-connector-c package (libmariadb_plugins)- removal of SuSEfirewall2 service, since SuSEfirewall2 has been replaced by firewalld, see [1]. [1]: https://lists.opensuse.org/opensuse-factory/2019-01/msg00490.html- update to 10.3.16 [bsc#1108088] * notable changes: * MDEV-19490: show tables fails when selecting the information_schema database * MDEV-19491: multi-update with triggers and stored routines * MDEV-19541: InnoDB crashes when trying to recover a corrupted page * MDEV-19725: Incorrect error handling in ALTER TABLE * MDEV-19445: FULLTEXT INDEX fix * MDEV-19486: System Versioning fix * MDEV-19509: InnoDB skips the tablespace in rotation list * MDEV-19614: SET GLOBAL innodb_ deadlock due to LOCK_global_system_variables * MDEV-17458: Unable to start galera node * MDEV-17456: Malicious SUPER user can possibly change audit log configuration without leaving traces * MDEV-19588: Wrong results from query, using left join * MDEV-19258: RIGHT JOIN hangs in MariaDB * Virtual columns fixes: MDEV-19027, MDEV-19602 * Crash recovery fixes: MDEV-13080, MDEV-19587, MDEV-19435 * MDEV-11094: Fixed row-based event applying with an error anymore when the events aim at the blackhole engine and row annotation is enabled * MDEV-19076: Fixed slave_parallel_mode=optimistic did not always properly order replication events on temporary tables in some case to attempt execution before a parent event has been already processed * MDEV-19158: Fixed duplicated entries in binlog occurred in combination of LOCK TABLES and binlog_format=MIXED when a being locked table was under replication unsafe operation * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10316-release-notes https://mariadb.com/kb/en/library/mariadb-10316-changelog - fix reading options for multiple instances if my${INSTANCE}.cnf is used. Also remove "umask 077" from mysql-systemd-helper that causes that new datadirs are created with wrong permissions. Set correct permissions for files created by us (mysql_upgrade_info, .run-mysql_upgrade) [bsc#1132666] - remove mariadb-5.5.28-install_db-quiet.patch and add "--rpm" option to the mysql_install_db script that does basically the same [bsc#1080891] - remove mariadb-10.1.12-deharcode-libdir.patch because it's not needed - we don't build libmariadb library in mariadb package anymore so we don't need to take care about LIBDIR and PLUGINDIR here. Moreover we shouldn't (and we don't) touch *_RPM variables as they are internal) [bsc#1080891] - update suse_skipped_tests.list- update to 10.3.15 * see changes in 10.3 series https://mariadb.com/kb/en/library/changes-improvements-in-mariadb-103/ * fixes for the following security vulnerabilities: [CVE-2019-2503] (the rest was already applied for 10.2) - remove mysql-community-server-5.1.45-multi-configuration.patch as we have the same configuration in /etc/my.cnf and it doesn't make any sense to keep it twice. Moreover the patched file support-files/my-medium.cnf.sh was removed in upstream - remove mariadb-5.2.3-cnf.patch as all patched files were removed upstream - refresh mariadb-10.2.4-fortify-and-O.patch - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch and use a simplified version from Debian - refresh README.install and suse-test-run - remove caching_sha2_password.so as it's shipped in mariadb-connector-c package (libmariadb_plugins) - rename libmysqld subpackage (embedded library) to libmariadbd as libmysqld.so was renamed to libmariadbd.so (MDEV-14953) - simplify removing static libs (we don't need to have .static) - add perl(Memoize) and perl(Symbol) to BuildRequires and Requires that are needed for tests - replace Requires pwdutils with shadow - build RocksDB only for x86_64 as other platforms are not supported - remove xtrabackup scripts as we already removed xtrabackup requires and it doesn't work for MariaDB 10.3 anyway - run spec-cleaner - tracker bugs for version updates in between: * 10.2.25 tracker bug [bsc#1136035] * 10.2.29 tracker bug [bsc#1156669]- update to 10.2.24 GA [bsc#1122198] * notable changes: * MDEV-18968 - Both (WHERE 0.1) and (WHERE NOT 0.1) return empty set * MDEV-18466 - Unsafe to log updates on tables referenced by foreign keys with triggers in statement format * MDEV-18899 - Server crashes in Field::set_warning_truncated_wrong_value * MDEV-18298 - Crashes server with segfault during role grants * MDEV-17610 - Unexpected connection abort after certain operations from within stored procedure * MDEV-19112 - WITH clause does not work with information_schema as default database * MDEV-17830 - Server crashes in Item_null_result::field_type upon SELECT with CHARSET(date) and ROLLUP * MDEV-14041 - Server crashes in String::length on queries with functions and ROLLUP * MDEV-18920 - Prepared statements with st_convexhull hang and eat 100% cpu. * MDEV-15837 - Assertion item1->type() == Item::FIELD_ITEM && item2->type() == Item::FIELD_ITEM * MDEV-9531 - GROUP_CONCAT with ORDER BY inside takes a lot of memory while it's executed * MDEV-17036 - BULK with replace doesn't take the first parameter in account * Bug#28986737 - RENAMING AND REPLACING MYSQL.USER TABLE CAN LEAD TO A SERVER CRASH * MDEV-19350 - Server crashes in delete_tree_element / ... / Item_func_group_concat::repack_tree * MDEV-19188 - Server Crash When Using a Trigger With A Number of Virtual Columns on INSERT/UPDATE * MDEV-19352 - Server crash in alloc_histograms_for_table_share upon query from information schema InnoDB * InnoDB persistent corruption fixes: MDEV-19426, MDEV-19022, MDEV-19241, MDEV-13942 * InnoDB recovery fixes and speedup: MDEV-18733, MDEV-12699, MDEV-19356, MDEV-19426 * MDEV-14398 - innodb_encrypt_tables will work even with innodb_encryption_rotate_key_age=0 * MDEV-17036 - BULK with replace doesn't take the first parameter in account * MDEV-14784 - Slave crashes in show_status_array upon running a trigger with select from I_S * MDEV-19060 - mariabackup continues, despite failing to open a tablespace * MDEV-18686 - Add option to PAM authentication plugin to allow case insensitive username matching * bugfix - multi-update checked privileges on views incorrectly * MDEV-19276 - during connect, write error log warning for ER_DBACCESS_DENIED_ERROR, if log_warnings > 1 * MDEV-17456 - Malicious SUPER user can possibly change audit log configuration without leaving traces. * fixes for the following security vulnerabilities: [CVE-2019-2614], [CVE-2019-2627], [CVE-2019-2628] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10224-release-notes https://mariadb.com/kb/en/library/mariadb-10224-changelog - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch- remove %{extra_provides} definition and Provides/Obsoletes where it was used. It's just a remnant and it's no longer needed.- update to 10.2.23 GA * notable changes: * InnoDB ALTER TABLE fixes: MDEV-18016, MDEV-18630, MDEV-18775, MDEV-18732, MDEV-18749, MDEV-18637, MDEV-13818, MDEV-17595 * MDEV-18878: InnoDB Purge: Optimize away futile table lookups * MDEV-14984: Regression in connect performance * MDEV-18936: Purge thread fails to exit on shutdown * MDEV-18272: InnoDB fails to rollback after exceeding FOREIGN KEY recursion depth * MDEV-9519: Data corruption on Galera cluster size change * MDEV-18204: fix incremental MyRocks backup * MDEV-18611: mariabackup terminated while copying InnoDB redo log * MDEV-18669: mariabackup writes timestamp in version line * MDEV-18855: Mariabackup should fetch innodb_compression_level from running server * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10223-release-notes https://mariadb.com/kb/en/library/mariadb-10223-changelog - remove mariadb-10.2.22-fix_path.patch that is no longer needed (applied upstream)- add mariadb-10.2.22-fix_path.patch to fix a path to resolveip in mysql_install_db script [bsc#1127027] MDEV-18526- my.cnf/my.ini: move slow_query_log example to the error log so it's logically together- fix references path below legacy directory /var/run -> /run- remove xtrabackup requirement as MariaDB ships a build in mariabackup so xtrabackup is not needed unless a user specificaly wants to use xtrabackup as sst method (also solves [bsc#1122475]- add slow_query_log example to my.cnf and adjust the logrotate configuration to rotate all /var/log/mysql/*.log files . This is useful when the slow query log is enabled. In that case, this log file should also be rotated (bsc#1112767)- update to 10.2.22 GA * notable changes: * Backport Information Schema CHECK_CONSTRAINTS Table. * MDEV-17475: Maximum value of table_definition_cache is now 2097152 * InnoDB ALTER TABLE fixes: MDEV-16499, MDEV-18186, MDEV-18237, MDEV-18222, MDEV-18256, MDEV-18016, MDEV-16849 * Mariabackup fixes: MDEV-18185, MDEV-18201, MDEV-18194 * Galera crash recovery fix: MDEV-15740 * Encryption fixes: MDEV-18129, MDEV-18183, MDEV-18279 * Fixes for the following security vulnerabilities: * CVE-2019-2510, CVE-2019-2537 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10222-release-notes https://mariadb.com/kb/en/library/mariadb-10222-changelog- update to 10.2.21 GA * notable changes: * MDEV-17589 - Stack-buffer-overflow with indexed varchar (utf8) field * MDEV-16987 - ALTER DATABASE possible in read-only mode (forbid ALTER DATABASE in read_only) * MDEV-17720 - slave_ddl_exec_mode=IDEMPOTENT does not handle DROP DATABASE * MDEV-6453 - Assertion `inited==NONE || (inited==RND && scan)' failed in handler::ha_rnd_init(bool) with InnoDB, joins, AND/OR conditions * MDEV-18105 - Mariabackup fails to copy encrypted InnoDB system tablespace if LSN>4G * MDEV-18041 - Database corruption after renaming a prefix-indexed column [bsc#1120041] * MDEV-17470 - Orphan temporary files after interrupted ALTER cause InnoDB: Operating system error number 17 and eventual fatal error 71 * MDEV-17833: ALTER TABLE is not enforcing prefix index size limit * MDEV-17989: InnoDB: Failing assertion: dict_tf2_is_valid(flags, flags2) * MDEV-17765: Locking bug fix for SPATIAL INDEX * MDEV-17923, MDEV-17904, MDEV-17938: Fixes for FULLTEXT INDEX * Fixes for regressions introduced in MariaDB Server 10.2.19 by the backup-safe TRUNCATE TABLE (MDEV-13564, innodb_safe_truncate=ON) and innodb_undo_log_truncate: * MDEV-17780, MDEV-17816, MDEV-17849, MDEV-17851, MDEV-17885 * Several improvements to MariaDB Server and backup for dealing with encrypted or page_compressed pages: * MDEV-12112: corruption in encrypted table may be overlooked * MDEV-17958: On little-endian systems, remove bug-compatible variant of innodb_checksum_algorithm=crc32 * MDEV-17957: Make innodb_checksum_algorithm stricter for strict_* values * MDEV-18025: Mariabackup fails to detect corrupted page_compressed=1 tables * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10221-release-notes https://mariadb.com/kb/en/library/mariadb-10221-changelog https://mariadb.com/kb/en/library/mariadb-10220-release-notes https://mariadb.com/kb/en/library/mariadb-10220-changelog - update suse_skipped_tests.list- remove PerconaFT from the package as it has AGPL licence [bsc#1118754] - use a new syntax for cmake variables that specify which plugin will be built- Add patch to link against libatomic where necessary and use C++11 atomics instead of gcc built-in atomics * mariadb-10.2.19-link-and-enable-c++11-atomics.patch - Add two tests to suse_skipped_tests.list for ppc * encryption.innodb-bad-key-change2 * encryption.innodb-bad-key-change4- update to 10.2.19 GA [bsc#1116686] * notable changes: * innodb_safe_truncate system variable for a backup-safe TRUNCATE TABLE implementation that is based on RENAME, CREATE, DROP (MDEV-14717, MDEV-14585, MDEV-13564). Default value for this variable is ON. If you absolutely must use XtraBackup instead of Mariabackup, you can set it to OFF and restart the server * MDEV-17289: Multi-pass recovery fails to apply some redo log records * MDEV-17073: INSERT…ON DUPLICATE KEY UPDATE became more deadlock-prone * MDEV-17491: micro optimize page_id_t * MDEV-13671: InnoDB should use case-insensitive column name comparisons like the rest of the server * Fixes for indexed virtual columns: MDEV-17215, MDEV-16980 * MDEV-17433: Allow InnoDB start up with empty ib_logfile0 from mariabackup --prepare * MDEV-12547: InnoDB FULLTEXT index has too strict innodb_ft_result_cache_limit max limit * MDEV-17541: KILL QUERY during lock wait in FOREIGN KEY check causes hang * MDEV-17531: Crash in RENAME TABLE with FOREIGN KEY and FULLTEXT INDEX * MDEV-17532: Performance_schema reports wrong directory for the temporary files of ALTER TABLE…ALGORITHM=INPLACE * MDEV-17545: Predicate lock for SPATIAL INDEX should lock non-matching record * MDEV-17546: SPATIAL INDEX should not be allowed for FOREIGN KEY * MDEV-17548: Incorrect access to off-page column for indexed virtual column * MDEV-12023: Assertion failure sym_node->table != NULL on startup * MDEV-17230: encryption_key_id from alter is ignored by encryption threads * fixes for the following security vulnerabilities: CVE-2018-3282 [bsc#1112432], CVE-2016-9843 [bsc#1013882], CVE-2018-3174 [bsc#1112368], CVE-2018-3143 [bsc#1112421], CVE-2018-3156 [bsc#1112417], CVE-2018-3251 [bsc#1112397], CVE-2018-3185 [bsc#1112384], CVE-2018-3277 [bsc#1112391], CVE-2018-3162 [bsc#1112415], CVE-2018-3173 [bsc#1112386], CVE-2018-3200 [bsc#1112404], CVE-2018-3284 [bsc#1112377] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10219-release-notes https://mariadb.com/kb/en/library/mariadb-10219-changelog - do not pack libmariadb.pc (packed in mariadb-connector-c)- add "Requires: libmariadb_plugins" to the mariadb-test subpackage in order to be able to test client plugins successfuly [bsc#1111859] - don't remove debug_key_management.so anymore [bsc#1111858]- update to 10.2.18 GA * notable changes: * MDEV-15511 - if available, stunnel can be used during Galera rsync SST * MDEV-16791 - mariabackup: Support DDL commands during backup * MDEV-13564 - Refuse MLOG_TRUNCATE in mariabackup * MDEV-16934 - add new system variable eq_range_index_dive_limit to speed up queries that new long nested IN lists. The default value, for backward compatibility, is 0 meaning "unlimited". * MDEV-13333 - errors on InnoDB lock conflict * Report all InnoDB redo log corruption * MDEV-17043 - Purge of indexed virtual columns may cause hang on table-rebuilding DDL * MDEV-16868 - corruption of InnoDB temporary tables * MDEV-16465 - Invalid (old?) table or database name or hang in ha_innobase::delete_table and log semaphore wait upon concurrent DDL with foreign keys * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10218-release-notes https://mariadb.com/kb/en/library/mariadb-10218-changelog - refresh mariadb-10.2.4-fortify-and-O.patch- add ssl tests that are failing with OpenSSL 1.1.1 to suse_skipped_tests.list [MDEV-17184]- update to 10.2.17 GA * notable changes: * New variable innodb_log_optimize_ddl for avoiding delay due to page flushing and allowing concurrent backup * InnoDB updated to 5.7.23 * MDEV-14637 - Fix hang due to DDL with FOREIGN KEY or persistent statistics * MDEV-15953 - Alter InnoDB Partitioned Table Moves Files (which were originally not in the datadir) to the datadir * MDEV-16515 - InnoDB: Failing assertion: ++retries < 10000 in file dict0dict.cc line 2737 * MDEV-16809 - Allow full redo logging for ALTER TABLE * Temporary tables: MDEV-16713 - InnoDB hang with repeating log entry * indexed virtual columns: MDEV-15855 - Deadlock between purge thread and DDL statement * MDEV-16664 - Change the default to innodb_lock_schedule_algorithm=fcfs * Galera: MDEV-15822 - WSREP: BF lock wait long for trx * fixes for the following security vulnerabilities: CVE-2018-3064 [bsc#1103342], CVE-2018-3063 [bsc#1101677], CVE-2018-3058 [bsc#1101676], CVE-2018-3066 [bsc#1101678], CVE-2018-3060 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10217-release-notes https://mariadb.com/kb/en/library/mariadb-10217-changelog- switch to libedit as control sequences were already fixed there so we don't have to avoid it [bsc#1098683]- update to 10.2.16 GA * notable changes: * MDEV-13122: mariabackup now supports MyRocks * MDEV-13779 - InnoDB fails to shut down purge workers, causing hang * MDEV-16267 - Wrong INFORMATION_SCHEMA.INNODB_BUFFER_PAGE.\ TABLE_NAME * MDEV-13834 - Upgrade failure from 10.1 innodb_encrypt_log * MDEV-16283 - ALTER TABLE...DISCARD TABLESPACE still takes long on a large buffer pool * MDEV-16376 - ASAN: heap-use-after-free in gcol.innodb_virtual_debug * MDEV-15824 - innodb_defragment=ON trumps innodb_optimize_fulltext_only=ON in OPTIMIZE TABLE * MDEV-16124 - fil_rename_tablespace() times out and crashes server during table-rebuilding ALTER TABLE * MDEV-16416 - Crash on IMPORT TABLESPACE of a ROW_FORMAT=COMPRESSED table * MDEV-16456 - InnoDB error "returned OS error 71" complains about wrong path * MDEV-13103 - Deal with page_compressed page corruption * MDEV-16496 - Mariabackup: Implement --verbose option to instrument InnoDB log apply * MDEV-16087 - Inconsistent SELECT results when query cache is enabled * MDEV-15114 - ASAN heap-use-after-free in mem_heap_dup or dfield_data_is_binary_equal (fix for indexed virtual columns) * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10216-release-notes https://mariadb.com/kb/en/library/mariadb-10216-changelog - refresh mariadb-5.5.28-install_db-quiet.patch - refresh mariadb-10.2.9-galera_cnf.patch - pack wsrep_sst_rsync_wan file to galera subpackage - update suse_skipped_tests.list- Don't require systemd explicit, spec file can handle both cases correct and in containers we don't have systemd.- update to 10.2.15 GA * notable changes: * PCRE updated to 8.42 * The embedded server library now supports SSL when connecting to remote servers [bsc#1088681], [CVE-2018-2767] * MDEV-15325 - Incomplete validation of missing tablespace during recovery * MDEV-15720 - ib_buffer_pool unnecessarily includes the temporary tablespace * MDEV-15764 - InnoDB may write uninitialized garbage to redo log * MDEV-15553 - Virtual Columns: Assertion failed in dict_table_get_col_name * MDEV-14705 - slow innodb startup/shutdown can exceed systemd timeout * MDEV-15507 - Assertion failed in dict_check_sys_tables on upgrade from 5.5 * MDEV-15916 - Change buffer crash during TRUNCATE or DROP TABLE * encryption fixes - MDEV-12632, MDEV-13516, MDEV-15752, MDEV-15566, MDEV-16092 * temporary table ROLLBACK fixes - MDEV-15826, MDEV-15374 * applicable changes from 5.7.22 - MDEV-16142 * fixes for the following security vulnerabilities: CVE-2018-2786, CVE-2018-2759, CVE-2018-2777, CVE-2018-2810, CVE-2018-2782, CVE-2018-2784, CVE-2018-2787, CVE-2018-2766, CVE-2018-2755, CVE-2018-2819, CVE-2018-2817, CVE-2018-2761, CVE-2018-2781, CVE-2018-2771, CVE-2018-2813 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10215-release-notes https://mariadb.com/kb/en/library/mariadb-10215-changelog - update suse_skipped_tests.list and add tests that are failing with GCC 8 [bsc#1092544], MDEV-16127 - do not build TokuDB as a build without jemalloc is not supported upstream- update suse_skipped_tests.list and add failing tests for s390- update to 10.2.14 GA * notable changes: * MyRocks is now Gamma (RC) * MDEV-14533 - Added the DISKS plugin, for monitoring disk space * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY. * MDEV-15333 - MariaDB (still) slow start * MDEV-12255 - Wrong result with innodb_prefix_index_cluster_optimization * MDEV-12396 - IMPORT TABLESPACE cleanup * MDEV-14648 - Restore fix for MySQL BUG#39053 - UNINSTALL PLUGIN does not allow the storage engine to cleanup open connections * MDEV-15249 - IMPORT fixes * MDEV-14988 - innodb_read_only tries to modify files if transactions were recovered in COMMITTED state * MDEV-14773 - DROP TABLE hangs for InnoDB table with FULLTEXT index (fixing a recent regression from upstream) * MDEV-15529 - IMPORT TABLESPACE unnecessarily uses the doublewrite buffer * MDEV-15554 - InnoDB page_cleaner shutdown sometimes hangs * MDEV-14545 - Mariabackup - Backup fails due to MLOG_INDEX_LOAD record * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10214-release-notes https://mariadb.com/kb/en/library/mariadb-10214-changelog - remove the following patches * mariadb-10.2.14-xtrabackup-v2.patch (applied upstream, MDEV-15254) * mariadb-10.2.13-aarch_compilefix.patch (applied upstream, MDEV-14318) * mariadb-10.2.10-disable_openssl_compatibility_check.patch (fixed upstream in https://github.com/MariaDB/server/pull/558) * mariadb-10.2.8-systemd-cmake.patch and DWITH_SYSTEMD=ON compile option that are no longer needed - systemd is detected correctly now (discussed in [bsc#1080891] and MDEV-8379) * mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch (fixed upstream in 52516706c86f9f66c76836eabde7e2477694bac3) * remove mariadb-10.2.3-group.patch that was just a half solution of the group support (missing server part) and moreover using a group option in mysql-systemd-helper was removed few years ago as it caused troubles because MariaDB resolved it as 'group_concat_max_len option' (see https://github.com/openSUSE/mysql-packaging/issues/15) - remove jar files from the tarball (used for testing from the source) - build TokuDB without the jemalloc support for now. Jemalloc 5 is not backwards compatible which leads to the errors in the testsuite at least (MDEV-15034) - update suse_skipped_tests.list- change %{extra_provides} macro from "mariadb_102" to "mariadb-102" and use this macro in Provides/Obsoletes for mariadb, test, tools, bench and errormessages subpackages to ensure a smooth transition from SLE12 to SLE15 [fate#323756] - remove "Provides: mariadb-errormessages = 10.1.25" that shouldn't be needed anymore- fix build on aarch64: compile a few more files with -O0 from https://jira.mariadb.org/browse/MDEV-14318 add patch mariadb-10.2.13-aarch_compilefix.patch- add mariadb-10.2.14-xtrabackup-v2.patch (bsc#1083087)- update to 10.2.13 GA * notable changes * InnoDB updated to 5.7.21 * Galera wsrep library updated to 25.3.23 * MDEV-13869 - MariaDB slow start * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY * MDEV-15249 - Crash in MVCC read after IMPORT TABLESPACE * Foreign key bugs: * MDEV-15199 - Referential integrity broken in ON DELETE CASCADE/MDEV-14222 Unnecessary 'cascade' memory allocation for every updated row * MDEV-15219 - FOREIGN KEY CASCADE or SET NULL operations will not resume after lock wait * MDEV-15042 - INSERT ON DUPLICATE KEY UPDATE produces error 1032 (Can't find record) * MDEV-13205 - InnoDB: Failing assertion: !dict_index_is_online_ddl(index) upon ALTER TABLE * MDEV-14958 - Merge new release of InnoDB MySQL 5.7.21 to 10.2 * MDEV-15165 - InnoDB purge for index on virtual column is trying to access an incomplete record * MDEV-15143 - InnoDB: Rollback of trx with id 0 completed * MDEV-11415 - Remove excessive undo logging during ALTER TABLE…ALGORITHM=COPY * MDEV-15016 - multiple page cleaner threads use a lot of CPU * MDEV-14941 - Timeouts on persistent statistics tables caused by MDEV-14511 * MDEV-14985 - innodb_undo_log_truncate may be blocked if transactions were recovered at startup * MDEV-14441 - InnoDB hangs when setting innodb_adaptive_hash_index=OFF during UPDATE * MDEV-14887 - On a 32-bit system, MariaDB 10.2 mishandles data file sizes exceeding 4GiB * fixes for the following security vulnerabilities: * CVE-2018-2562, CVE-2018-2622, CVE-2018-2640, CVE-2018-2665, CVE-2018-2668, CVE-2018-2612 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10213-release-notes/ https://mariadb.com/kb/en/library/mariadb-10213-changelog/ * fixes [bsc#1058729] and [bsc#1068906] - refresh mariadb-10.2.10-disable_openssl_compatibility_check.patch - refresh mariadb-10.2.3-group.patch- add dependency on which for galera scripts- change owner of mysql-test directory from root to mysql. It also fixes sys_vars.secure_file_priv running under mysql user (e.g. if ít's started via suse-test-run script) that needs to be able to create a test file there during its run [bsc#1012075]- update to 10.2.12 GA * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10212-release-notes/ https://mariadb.com/kb/en/library/mariadb-10212-changelog/ - remove mysql-community-server-5.5.6-safe-process-in-bin.patch becuase this moving is done in the specfile - get rid of the archive with patches (remove mysql-patches.tar.xz and series files), handle patches in the standard way mysql-community-server-5.1.45-multi-configuration.patch mariadb-10.2.4-logrotate.patch mariadb-5.5.28-install_db-quiet.patch mariadb-10.1.1-mysqld_multi-features.patch mariadb-5.2.3-cnf.patch mariadb-10.2.3-group.patch mariadb-10.1.12-deharcode-libdir.patch mariadb-10.0.15-logrotate-su.patch mariadb-10.2.4-fortify-and-O.patch mariadb-10.2.8-systemd-cmake.patch mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch mariadb-10.2.9-galera_cnf.patch mariadb-10.2.10-disable_openssl_compatibility_check.patch - add comments to the section with removing unused files (based on https://lists.launchpad.net/maria-developers/msg11028.html) - put rm statements together - install the new upstream systemd-tmpfiles configuration file 'tmpfiles.conf' and rename it to 'mariadb.conf' in order to follow the manual - remove the new upstream systemd-sysusers configuration file as we handle creating of mysql user in the specfile - mysql.service: remove calling of the wait function and let systemd to do this job. Switch from 'Type=simple' to 'Type=notify' and add TimeoutSec=300 - rename unit files from mysql to mariadb and add mysql alias for the backward compatibility [bsc#1067443] * mysql.service -> mariadb.service * mysql.target -> mariadb.target * mysql@.service -> mariadb@.service - remove configuration-tweaks.tar.xz and move configuration to my.ini/my.cnf file (omit default_plugins.cnf as all configuration here was commented out) - add a numeric prefix for galera.cnf file in order to allow users to speficy in which order the configs will be loaded within the my.cnf.d directory [bsc#1055268] - add 'bind-address = 127.0.0.1' as a default option to my.cnf file for security reasons (disable MariaDB to listen for TCP/IP connections by default) [bsc#1058374] - update my.cnf file and add a section with SSL configuration [bsc#1058374]- switch from deprecated 'net-tools' to 'iproute2' for mariadb-galera subpackage. This dependency switch is sufficient for making wsrep_sst_rsync.sh script to use 'ip' instead of 'ifconfig' command- Do not manually delete %{_localstatedir}/adm/update-messages/%{name}-%{version}-%{release}-something: The file is listed as ghost and thus properly owned by the package. - Use %tmpfiles_create which can cope with transactional updates.- update to 10.2.11 GA * release notes and changelog: * https://mariadb.com/kb/en/library/mariadb-10211-release-notes/ * https://mariadb.com/kb/en/library/mariadb-10211-changelog/ - pack additional mroonga/groonga files - change default charset to utf8mb4 for full Unicode support [fate#324329] - remove mariadb-10.2.10-wsrep_sst_common.patch as it's no longer needed- Added mariadb-10.2.10-wsrep_sst_common.patch (bsc#1069401). Upstream bug: https://jira.mariadb.org/browse/MDEV-14256- Disable openssl compatibility checking * the check uses CRYPTO_set_mem_functions() to set debugging memory allocation function. The setting only succeeds if no allocation was done before. Our fips self-tests, which are run from the library constructor, however, do allocate memory, so the subsequent call to CRYPTO_set_mem_functions causes the compatibility check to fail * add mariadb-10.2.10-disable_openssl_compatibility_check.patch- update to 10.2.10 GA * release notes and changelogs https://downloads.mariadb.org/mariadb/+releases/ * fixes for the following security vulnerabilities * 10.2.10: CVE-2017-10378, CVE-2017-10268, CVE-2017-15365 * 10.2.8: CVE-2017-3636, CVE-2017-3641, CVE-2017-3653, CVE-2017-10320, CVE-2017-10365, CVE-2017-10379, CVE-2017-10384, CVE-2017-10286, CVE-2017-3257 * 10.2.6: CVE-2017-3308, CVE-2017-3309, CVE-2017-3453, CVE-2017-3456, CVE-2017-3464 * 10.2.5: CVE-2017-3313, CVE-2017-3302 * [bsc#1042632], [bsc#1043328], [bsc#1019948], [fate#323738] - refresh and rename the following patches: * mariadb-10.1.4-group.patch to mariadb-10.2.3-group.patch * mariadb-10.1.16-systemd-cmake.patch to mariadb-10.2.8-systemd-cmake.patch * mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch * mariadb-10.1.12-fortify-and-O.patch to mariadb-10.2.4-fortify-and-O.patch * mysql-community-server-5.1.46-logrotate.patch to mariadb-10.2.4-logrotate.patch - add mariadb-10.2.10.tar.gz.sig signature and mariadb.keyring files - start building without client library part, use mariadb-connector-c for getting libmariadb libraries. Remove libmysclient* packages - remove baselibs.conf because we no longer build client libraries here - update %{soname} to 19 (libmysqld soname) - change '=' to '>=' in Requires:mariadb-errormessages for libmysqld%{soname}. Versioned libraries shouldn't require regular packages with '='. It also causes problems during update (Problem: libmysqld18-10.1.25-3.1.x86_64 requires mariadb-errormessages = 10.1.25, but this requirement cannot be provided). Also add "Provides: mariadb-errormessages = 10.1.25" for errormessages subpackage that solves this problem for the current update. - pack new files, remove mysql specific files - remove README.SUSE as it was outdated - package cleaning * run spec-cleaner * renumber sources * reorganize subpackages order and update summaries, descriptions and groups * tweak and add some comments to the specfile * remove warning about mysql-packaging repository that is no longer used for this package * remove checks whether we build mysql or mariadb (we build mariadb only) - add galera subpackage * add missing "Requires:" (lsof, net-tools, rsync, socat, xtrabackup) for proper wsrep scripts functionality * add mariadb-10.2.9-galera_cnf.patch that enhances galera.cnf configuration file (add wsrep_on=OFF and set the location of the wsrep library) * rename README-wsrep to README.wsrep so it corresponds with the other README names * move galera_new_cluster, galera_recovery, use_galera_new_cluster.conf, wsrep_* scripts to the galera subpackage - remove the following macros definitions: * %{_tmpfilesdir} - it's been defined in systemd macros since openSUSE 13.2 * %{preferred} - we no longer need to distinguish between preferred and not preferred version (we build mariadb only) * %{with_mandatory_lz4} - mysql specific * %{build_extras}, %{pretty_name}, %{build_readline}, %{builtin_plugins} and {libname} - they are no longer needed - add the following macros * %{run_testsuite} macro that controls the run of the regression testsuite * %{ignore_testsuite_result} macro - when set to 1 it ignores results from the regression testsuite (debug purposes) * %{with_mroonga} macro (enable mroonga build for x86_64 archs only) - rename %{with_jemalloc} to %{with_tokudb} and enable tokudb for x86_64 architectures for openSUSE and SLE15 [fate#323280]. Don't enable it for SLE12 (missing jemalloc dependency) - add the following BuildRequires: * unixODBC-devel to allow ODBC support for Connect engine [bsc#1039034] * krb5-devel to build auth_gssapi.so plugin * libarchive-devel * use libboost_headers-devel instead of boost-devel for TW. Boost package has been split up and will migrate to using multibuild. This results in packages that unnecessarily build require boost-devel to cause major bottlenecks [bsc#1062583] - do not use "BuildRequires: lzo-devel" for i586 and arm because it makes build fail - add the following Requires: * hostname - as mariadb_install_db depends on this tool [bsc#1060110] * libaio-devel for libmysqld-devel because libmysqld depends on libaio - tweak build options: * remove "DWITH_ASAN=OFF" - this option was added because of mysql and it's no longer needed * switch from "-DWITH_JEMALLOC=auto" to "-DWITH_JEMALLOC=system" * use "DCMAKE_SKIP_INSTALL_RPATH" - this allows to link with -rpath during build and fixes quite a few test suite failures. When installing the file -rpath is still disabled, so this should not have any effect on the installed binaries * add "-DWITH_LIBARCHIVE=ON" and "-DWITH_MARIABACKUP=ON" * remove -DWITH_BOOST=../boost/ as we use system boost now - enable OQGRAPH to build (openSUSE only, SLE is missing Judy requirement) - disable Cassandra storage engine build as it's no longer actively being developed (See MDEV-4695) [bsc#1055165] * Remove "BuildRequires: libthrift-devel" and %{with_cassandra} macros that are no longer needed now - disable make test (Connector/C unit tests) as it requires a running server. These tests are part of mysql-test-run now (MDEV-12470) - add suse_skipped_tests.list - the list of the tests that we want to skip (they fail correctly or the fix is in progress) * adjust mysql-test-run options to skip tests listed there [bsc#1041891] - remove mytop utility that is packaged separately - remove *.jar files from mysql-test - remove python scripts remains from tokudb upstream - remove generating of the MySQL NDB Cluster filelists - remove removing of manpages for MySQL Carrier Grade Edition - provide a symlink for the my_safe_process executable that was moved from its location to bindir - update filename in /var/adm/update-messages to match documentation and build-compare pattern - README is now README.md - fix "file listed twice" build error- Also Require: libopenssl-1_0_0-devel from the libmysqlclient-devel package- Drop INFO_BIN from package because it is not needed and differs for every build (boo#1047218)- Explicitly require libopenssl-1_0_0-devel, to successfully build once we switch openssl to 1.1 (bsc#1042632)- update to MariaDB 10.1.25 GA * notable changes * MariaDB can no longer be compiled with OpenSSL version 0.9.8 and below. The last 0.9.8 release was in December 2015, it is out of support and is no longer getting security fixes. * MariaDB Backup is now beta * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10125-release-notes * https://mariadb.com/kb/en/mariadb/mariadb-10125-changelog * refresh mariadb-10.1.12-fortify-and-O.patch * remove mariadb-10.1.22-xtradb_null_checks.patch (MDEV-12358), a fix was merged upstream * update file lists for new man-pages and tools - switch from 'Restart=on-failure' to 'Restart=on-abort' in mysql.service in order to follow the upstream- Add mariadb-10.1.22-xtradb_null_checks.patch (boo#1041525) (See also https://jira.mariadb.org/browse/MDEV-12358) - switch from '/var/run' to '/run' as /var/run is just a symlink to /run - fix permissions for /var/run/mysql that were wrongly set to 700 instead of 755 due to added umask. This prevented non-root from connecting to the database [bsc#1038740] - change permissions of the configuration dir/files to 755/644. Please note that storing the password in the /etc/my.cnf file is not safe. Use for example an option file that is accessible only by yourself [bsc#889126] - set the default umask to 077 in mysql-systemd-helper [bsc#1020976]- increase required physical memory in _constraints from 5 GB to 7 GB in order to try to fix i586 build that fails because of "Out of memory" error- update to MariaDB 10.1.22 GA * notable changes * XtraDB updated to 5.6.35-80.0 * TokuDB updated to 5.6.35-80.0 * PCRE updated to 8.40 * MDEV-12160: ed25519 authentication plugin * MDEV-11842: Fix a 10.1.21 regression with failed INSERT, BEFORE INSERT triggers, and columns with no default value * MDEV-12075: Fix a 10.1.21 regression in the InnoDB data file extension code * MDEV-11027: better InnoDB crash recovery progress reporting * MDEV-11520: improvements to how InnoDB data files are extended * Improvements to InnoDB startup/shutdown to make it more robust * MDEV-11233: fix for FULLTEXT index crash * MDEV-9734: systemd compatible bintar files now available * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10122-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10122-changelog/ * fixes the following CVEs: * CVE-2017-3313 [bsc#1020890], CVE-2017-3302 [bsc#1022428] - refresh mysql-community-server-5.1.46-logrotate.patch - refresh mariadb-10.1.16-systemd-cmake.patch - remove mariadb-10.1.20-incorrect_list_handling.patch that is no longer needed [bsc#1022428] [CVE-2017-3302]- update to MariaDB 10.1.21 * notable changes: * Innodb updated to 5.6.35 * Performance Schema updated to 5.6.35 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10121-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10121-changelog/ * fixes the following CVEs: CVE-2017-3318 [bsc#1020896], CVE-2017-3317 [bsc#1020894], CVE-2017-3312 [bsc#1020873], CVE-2017-3291 [bsc#1020884], CVE-2017-3265 [bsc#1020885], CVE-2017-3258 [bsc#1020875], CVE-2017-3257 [bsc#1020878], CVE-2017-3244 [bsc#1020877], CVE-2017-3243 [bsc#1020891], CVE-2017-3238 [bsc#1020882], CVE-2016-6664 [bsc#1008253] - add mariadb.te file to the filelist - add mysqld_safe_helper to the filelist - refresh mariadb-10.1.4-group.patch - add mariadb-10.1.20-incorrect_list_handling.patch to fix incorrect linked list handling in mysql_prune_stmt_list() function that can cause use-after-free error [bsc#1022428]- Replace systemd and systemd-devel BuildRequires with pkgconfig(libsystemd), which matches what the build system is actually looking for.- update to MariaDB 10.1.20 * notable changes: * XtraDB updated to 5.6.34-79.1 * TokuDB updated to 5.6.34-79.1 * HeidiSQL updated to 9.4 * The limit for the table_open_cache system variable has been increased to 1024K * Galera wsrep library updated to 25.3.19 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10120-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10120-changelog/- update to MariaDB 10.1.19 * notable changes: * XtraDB updated to 5.6.33-79.0 * TokuDB updated to 5.6.33-79.0 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10119-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10119-changelog/ * fixes for the following security vulnerabilities: CVE-2016-7440 [bsc#1005581] CVE-2016-5584 [bsc#1005558] - add mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to fix mysql_install_db.sh script to find data files in mariadb directories when a user uses "--basedir" option [bsc#1006539] - switch to xz compression instead of bz2 for the following tarballs: * mysql-patches.tar.bz2 renamed to mysql-patches.tar.xz * configuration-tweaks.tar.bz2 renamed to configuration-tweaks.tar.xz replace occurrences of "bzip2" with "xz" in README.debug- update to 10.1.18 * Release notes: https://mariadb.com/kb/en/mariadb/mariadb-10118-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10117-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10116-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10115-release-notes/ * Changelog: https://mariadb.com/kb/en/mariadb/mariadb-10118-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10117-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10116-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10115-changelog/ * fixed CVE's: CVE-2016-8283, CVE-2016-6663, CVE-2016-5629, CVE-2016-5626, CVE-2016-5624, CVE-2016-5616, CVE-2016-3492, CVE-2016-6662, CVE-2016-5440, CVE-2016-3615, CVE-2016-3521, CVE-2016-3477 * fix: [bsc#1005582], [bsc#1001367], [bsc#1005569], [bsc#1005566], [bsc#1005564], [bsc#1005562], [bsc#1005555], [bnc#998309], [bsc#989926], [bsc#989922], [bsc#989919], [bsc#989913] * refresh mariadb-10.1.4-group.patch * refresh mariadb-10.1.12-fortify-and-O.patch - requires devel packages for aio and lzo2 - remove mariadb-10.0.21-mysql-test_main_bootstrap.patch that is no longer needed [bnc#984858] - append "--ignore-db-dir=lost+found" to the mysqld options in "mysql-systemd-helper" script if "lost+found" directory is found in $datadir [bnc#986251] - remove syslog.target from *.service files [bsc#983938] - add BuildRequires: systemd-devel - make some dependecies switchable - add systemd to deps to build on leap and friends - add mariadb-10.1.16-systemd-cmake.patch to allow more (case-insensitive) values for 'WITH_SYSTEMD' variable in systemd.cmake - replace '%{_libexecdir}/systemd/system' with %{_unitdir} macro - remove useless mysql@default.service [bsc#971456] - replace all occurrences of the string "@sysconfdir@" with "/etc" in mysql-community-server-5.1.46-logrotate.patch as it wasn't expanded properly [bsc#990890]- update to 10.1.14 * What is MariadDB 10.1: https://mariadb.com/kb/en/mariadb/what-is-mariadb-101/ * CVEs fixed in 10.1.x branch CVE-2016-2047, CVE-2016-0668, CVE-2016-0651, CVE-2016-0650, CVE-2016-0649, CVE-2016-0646, CVE-2016-0644, CVE-2016-0642, CVE-2016-0641, CVE-2016-0640, CVE-2016-0616, CVE-2016-0610, CVE-2016-0609, CVE-2016-0608, CVE-2016-0606, CVE-2016-0600, CVE-2016-0598, CVE-2016-0597, CVE-2016-0596, CVE-2016-0546, CVE-2016-0505, CVE-2015-7744, CVE-2015-4913, CVE-2015-4895, CVE-2015-4879, CVE-2015-4870, CVE-2015-4866, CVE-2015-4864, CVE-2015-4861, CVE-2015-4858, CVE-2015-4836, CVE-2015-4830, CVE-2015-4826, CVE-2015-4819, CVE-2015-4816, CVE-2015-4815, CVE-2015-4807, CVE-2015-4802, CVE-2015-4792 * adjust mysql-patches.tar.bz2 archive for mariadb-101 * pack new MariaDB 10.1.x files - remove '%define _rundir' as 13.1 is out of support scope - temporarily disable OQGraph It seems to need the boost library with the version not earlier than 1.40 and not later than 1.55 (MDEV-9479) - add "BuildRequires: systemd-devel" for SLE12, openSUSE 13.2 and openSUSE Leap in order to enable systemd features during the build of mariadb-101 for these products. Otherwise we get "Performing Test HAVE_SYSTEMD - Failed" and systemd files aren't installed. - re-enable profiling support - don't remove HandlerSocket plugin [bnc#979524] - add 'log-error' and 'secure-file-priv' configuration options (added via configuration-tweaks.tar.bz2) [bsc#963810] * add '/etc/my.cnf.d/error_log.conf' that specifies 'log-error = /var/log/mysql/mysqld.log'. If no path is set, the error log is written to '/var/lib/mysql/$HOSTNAME.err', which is not picked up by logrotate. * add '/etc/my.cnf.d/secure_file_priv.conf' which specifies that 'LOAD DATA', 'SELECT ... INTO' and 'LOAD FILE()' will only work with files in the directory specified by 'secure-file-priv' option (='/var/lib/mysql-files'). - run 'usermod -g mysql mysql' only if mysql user is not in mysql group. Run 'usermod -s /bin/false/ mysql' only if mysql user doesn't have '/bin/false' shell set. - don't delete the log data when migration fails- fix constraints conditions for 32bit architectures- fix information leak via mysql-systemd-helper script [CVE-2015-5969], [bnc#957174]- update to 10.0.22 * Release notes: https://kb.askmonty.org/en/mariadb-10022-release-notes/ * Changelog: https://kb.askmonty.org/en/mariadb-10022-changelog/ * fixed CVEs: CVE-2015-4802, CVE-2015-4807, CVE-2015-4815, CVE-2015-4826 CVE-2015-4830, CVE-2015-4836, CVE-2015-4858, CVE-2015-4861 CVE-2015-4870, CVE-2015-4913, CVE-2015-4792 * remove the following patches (applied upstream) * mysql-community-server-5.6.12-srv_buf_size.patch * mariadb-10.0.16-header_files_const_warnings.patch - add mariadb-10.0.21-mysql-test_main_bootstrap.patch that fix main.bootstrap test (change default charset to utf8 in test result) [bnc#937787] - add mariadb-10.0.22-fix_build_denabled_profiling_off.patch to fix compilation with '-DENABLED_PROFILING=OFF'- update to MariaDB 10.0.21 * changes: * https://mariadb.com/kb/en/mariadb/mariadb-10021-release-notes * the following patches were processed upstream and are no longer needed: * mariadb-5.5.28-hotcopy.patch * mariadb-5.1.50-strncat-overflow.patch * mysql-community-server-5.1.51-mysql_config.patch * mariadb-5.5.32-upgrade-exit-status.patch * mariadb-5.5.41-mariadb-admincrash.patch - use syntax in mysql-systemd-helper that is accepted by both mariadb and mysql [bnc#937767] - fix spurious macro expansion in comment in specfile - install INFO_BIN and INFO_SRC, noticed in MDEV-6912 - replace readline-devel for readline5-devel (MDEV-6912) [bnc#902396] - use spec-cleaner - Tweak some cmake switches to enable more things * WITH_ASAN=OFF adress sanitization WITH_LIBWRAP=ON tcp wrappers ENABLED_PROFILING=OFF profiling disable (for mysql) ENABLE_DEBUG_SYNC=OFF debug testing sync disable (for mysql) WITH_PIC=ON by default we want pic generated binaries (for mysql) - set cmake options for MariaDB Galera Cluster - remove superfluous '--group' parameter from mysql-systemd-helper - make -devel package installable in the presence of LibreSSL - cleanup after the update-message if it was displayed - add 'exec' to mysql-systemd-helper to shutdown mysql/mariadb cleanly [bnc#943096] - remove redundant entry from %{_tmpfilesdir}/mysql.conf. Using both 'x' and 'X' options is redundant and causes a warning message. Leaving only the 'x' line fixes this problem. [bnc#942908]- Sync to git state, fixes bnc#937754 too- Sync to git state fixing few triv issues- Enable testsuite- Update to 10.0.20: https://mariadb.com/kb/en/mariadb/mariadb-10020-release-notes/ * Fixes bnc#934789 Logjam Attack using 512bit dh groups in ssl - Sync the package to git state, redoing initscripts to be more robust- Update to 10.0.19, sync to git state of repository: https://mariadb.com/kb/en/mariadb/mariadb-10019-release-notes/- fix parent directory has insecure permissions error- disable optional features for mariadb * still possible to use them from mariadb_100 package- Adjust _constraints. 11GB is not enough for ppc64 builds, increase to 13GB- fix build for openSUSE 13.2 ppc bnc#921955- Updated to the version 10.0.17 * Release notes: http://kb.askmonty.org/v/mariadb-10017-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10017-changelog - merged patches to packaging git and regenerated * few fixes mainly to upgrades- README.SuSE is now README.SUSE; fix name in some places.- Fix undefined initial status in systemd script (boo #914370)- Fix include dir in alternative cnf files (bnc #859345)- run spec cleaner on spec - update to 10.0.15 * Release notes: http://kb.askmonty.org/v/mariadb-10015-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10015-changelog - conditionally enable more storage engines - updated packaging to the latest templates- fix bashism in posttrans script/bin/shmysql-clients390zl38 1695151374  !10.6.15-150400.3.29.310.6.15-150400.3.29.310.6.15-150400.3.29.310.6.1510.6.15mysqlaccess.confmariadbmariadb-adminmariadb-checkmariadb-dumpmariadb-importmariadb-showmariadbd-safe-helpermysqlmysqladminmysqlcheckmysqld_safe_helpermysqldumpmysqlimportmysqlshowmysql-user.confmysqlplugindialog_examples.somariadb-admin.1.gzmariadb-check.1.gzmariadb-dump.1.gzmariadb-import.1.gzmariadb-show.1.gzmariadb.1.gzmariadbd-safe-helper.1.gzmysql.1.gzmysqladmin.1.gzmysqlcheck.1.gzmysqld_safe_helper.1.gzmysqldump.1.gzmysqlimport.1.gzmysqlshow.1.gz/etc//usr/bin//usr/lib/sysusers.d//usr/lib64//usr/lib64/mysql//usr/lib64/mysql/plugin//usr/share/man/man1/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:30339/SUSE_SLE-15-SP4_Update/ab0091404d14e741bd181ce92145794a-mariadb.SUSE_SLE-15-SP4_Updatedrpmxz5s390x-suse-linux ASCII textELF 64-bit MSB shared object, IBM S/390, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=8f43e024184afba141f8a2521d0cccc21cf2f9c9, for GNU/Linux 3.2.0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=7f22bec7545c6b827a24cf11c94f00e2ce0f6b7f, for GNU/Linux 3.2.0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=e3d5c7a8388d5504e81689c8bbcfc18cdf9338bd, for GNU/Linux 3.2.0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=62140432c548493706b53b096c5a119a01fdc180, for GNU/Linux 3.2.0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=d26296cf9497de29ce507f2492f7867906802d8f, for GNU/Linux 3.2.0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=3c3c667960a170b52da3e16deb51934fc3476f79, for GNU/Linux 3.2.0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=154f474b673fda3e735b4735b5098e69512175a2, for GNU/Linux 3.2.0, strippeddirectoryELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=45605237490500b43803ccd6b04ec33fb31110e7, strippedtroff or preprocessor input, ASCII text, with no line terminators (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix).@Rdv~RRRR R RRRRRR RRRRRRRRRR RRR RRRRR RRR RRRRRRRRRRR RR RR RRR RRRRRRRRRRR RR RR RRR RRRRRRRRRRR RR RR RRR RRRRRRRRRRR RR RR RRR RRRRRRRRRRR RR RRRRRRRRRPPRRRRzsԩጷutf-859c6bd42bb89dea3d159241718725ff3af77daa1171183071e537eaac91005f0?7zXZ !t/ (]"k%hASDui0o%HQԥ/8E. ena3`J!W^]t%Oy˥6AD:hm%ټ4> 0`(dGZfɊ,!':krRڟ f-Ri&nM]BAWoԀ8K3K$bC>8X"J5wtnBcNW9<}572M&:}={TieLbfHeM1 =@ZS[|$*p7= ?K]9v|r _u0!n-Kge+tv;b qKqRU t &%Dc$1TNj`-ULWb6&v> Q 6/@dO@m7hv񩥰k&`XMQKqq^P'sdHQ]bW(5lc * \\DYcD/P>gٻ/"2t>qȸ%^^u͖ƣ^;XSzfD0YKSERk%DU)>nZ U*hI}#1<򓛭zCjyr3<@L&j}zHcl~CIc3ڄq.&<2'V#';^TT+BۂLqFoLY&hwս1.a\ 5Vz5AJo1'"W!"Az!HAty$]?:7E[ :zypU%+verFAx/ lIH:QRsP?;j)tI5?|>6<}m&g/,y }l2(^Wi?6޲kCI R$) &,"://9@S࿢T:~ᮉ|hI>b]Ү z˷ Ɖj.zj3P|vGl_7ܯJWR$ȮYNgU$j4X))Q|?أ݂7=jjtG Zn!#~\>jNA6C/;ӻ X^%tyr-|h 0[d?# 4[lSH^j~E2zYS>YNZ!I3>!Fl;:3 tN I@IO*`1 uj-J7X0%URzف\}Gr]ba@6x(W$qr#3WD9B,3z̗\In]&CxĠXV"Rlnf:VW5⸔,„\F*`4ZF*y^Oz;5[1?(㉳xwh DJn?`'fz]ʌ14ô[u/:v/HH"rAd@C&B) _!8 0[F:C`ЖYZþQ 0C r>E/(R*tSa&2{S{Nȟ*k~s1wuG/6Wawo`DgTWq_̌~S/fO{o:ITxD:{ s[Xm&2x|-]t H_[ Alk&ٌ܊GUuYP] (\?ұgjg%>e5417u\䀠Nj}j$mza"3 PG›8#jxbhރb&: 1L) ր\mޠF=0aɺpWn 't~TռjҋׇZL Mr Y/#pW֮G.R//'+y1JpWa%nϵ0D#'A筌.IԴ|AS M*@3-uڍNYftђ(.XۓBw=zA;5GحeTbe}9by j#hP@nQ^a~nq?"1Èڰ]`"Da$@:bvįdVGx{TLw{x@cmyM¿QGoWiiߞ mSDW/~Oifs*;8p2a3]{9'r,aA>T{G.e4%En+ZN;(ݩOtXe 1k~BMKM2VMlFpqgH+a2ۯ\)v~q(21^^  Ǐ8ls{gh6_.gu밻B%]h5}u&Џ|fszҪúx^댠nBx2TEQ;NG6"I۳k5?)Eͅ犡W%S2h DR͛QIPP)A"mq@g ' }&U} QErumF4|ȪyR1#iHz :!v21c" {sS|lp8_ SID,BkaWSUxQ.2Gu$=wS,÷8*i]~B0B1-npqc> H5x,[}Nsruʙ͏vX[r]GS#8E&4_NKU\c~MԝV]m@'F)15S,Sݐp " nXJ= LHKKB|V?FH셁$Hھ$ʎXx\Dj ^fL&#q }^VQ +{Cג*d8chS qhkE1Hv0 3rR4l/a|Q|'#nD'7R/N~GN0Ȃe ?L`$B|mׂAo;C%VOk| Y8 H]әʱ D,JNx'MRZϔGsh "1Yf,r?~i G{i\|)aB[0NhlfiT0 -XzTj*SNa#m(k&ډ! #Ml%_,GY=,b3cWGdvN] Ai 'n6]Ҫ^ʲMz_IYX4o7~Ю-?@qk-M0rgNAFG:,QK}ؒ#;d1өNE | Y<nD&0xfI5Gi^rJɓV:E;.kx2 =v̞8,`Η> [04XujC!}Z?])b&[WHFHuBٺWd5In[cwEo^+m"IYzj.4Q֓_F$'`I`N籪1,5Ħ?}ƼcY jNUDj1g|Z^yL dHfo\(NCp;p ?~J5uÁjBuȗlB$jUݑ[V\.Dc^JMq5 _-T_ff0w߇r2uh-εoֆqYtlxM,TU\{PZB_m_?Sx*=:RDʼѺ*si<捉{M~q|S=VmM Yq8U̽e|[8·p)maJFWzt@QGV[|H_ B_RΔg7-K[S|Ļlgj!4 ǟdUy>1r:7Lͪ^TͬzWx|s.3-:>w O: 6G,yź6EeV' kBB5틊0E\֔qmJ н+TWj#eN>dwca nh?Ĕ9I ߱6a9iD?CNQ(KqܙxO);LNKgP8UXfx݅W&p7h^/ ގ/rLfhu;7g?YۨŸhV:^\5H2P;=SW*s9hBhQCل}T>zue>K~ھBȐ;MVJ/2ڣI |xU# ^#n5;XS:ş |5SuM*oH &%Xyv DRYPx,wz )=xlUIn]W'Q26M9|w0]yG {f.DvjoE6Fxypˉ.ʽ< aB6p cЍK1T~&i@%4S{Rw RH'(^o*b&v@*q2m-ceX9|u,€>2xh=}02D|+b:!n QTeNt /Tkn(Z($*JS!/cx{ۉ#,vHk]@S\x^&+[lLF[.! w>űq!{f1p#mwTdF(ú?XD/g+)7l}#~_'Qyhfeףs)o2 ۣ@|FK>A$]w*+mx??J(9υT K`c;7 iW?Fڿ,ZY[+m1Ց^~Yv2!Zǂ}U5oJx'1| unjˡl]B o4 ͼ &r?2iVgY/_캻}o> 8.CU'x-:c[6:`֏s#y(:Mm~2fJ_kV֝Gʞnfm2lp)*9iM i>۞fR(Z(hf쬅C2{>. _8Ro#Z ÄϺJ<)ęv(Bd;X;ٖ{ C>vF1Bi52 $"ub=6+wa!+t9aSX( H4魯yܝm1#[n!!g3\XO7D!*uǝy[yM(_!d!Tv[yLH͘Jh7XމGc(|p߲Oހv]MZ2 WPJUufq4O~JvCi<|N=~3< rWπ(*џ ذ' S6"YDӨ8M˸K>gϚ-R=mB8-#{"&^ #*ܟCbRxLAmetPqr~,Ϭ[D8ڄxҰњІ@஛yR->z{= ;^79ǚi4yƸšI+ߗ FJh ܫJqhpKl X{:@Y:g])QiԄpQT*3+MW@̾Ĝԛ;g7(EcC7* %f$kE΀@Lwrͨ+ƳȻMY ;t)YzYW ~Lnt je:q&I RaPw:1Ɠj93"*LjH #~2Gf%ˈ1W h -˭Xa3;=Q1nEZҨ@`9>kw wuY7"rIL sb_c'g?px}gOjq=fZɒ$?5zA\3b TPYWZ>uH|nQw:b,y%T̡(-黤][ƗE^ JeWCG:K/ e*i6oJJ/8-`GgjSlPf*rwQoMA0 F䖊` "5LvNoQ (5(POR_D:0JŪ ۴KSIֶ'yG$w>v>Rg|Y@Wi-%': k:![1LUdbnN5s#,W_ <$yd@e JZҚ\fs4lPu KV F[ &)?:fh$wo<C{Y:@73'`Xh|w>C)}h+/PKfÎ4Kހj'Vmr2W4%LXNNTD0'~{ڦyPTQ˖<|Iek j&Jgߪ{{1ʺ _& ]:>ﾩy7/ZA=,g~U}ژp*]p-oWl`?=4bYv>2 _o";]|l+t`6gɮ7iGr#ߗ3xTR<h;3}o76>ӿSĖVj/E:bNK.S4<6kб2=3&ҭ}ΈNDJr|ɑ^Bٵ&H9hSRdwɾWFTkҷ?J%/7RdApD1jj@EQ]3鰰LAyiN7xuO x-UE,m-nJ\i8zj"Ѓs2{||Aif~s{E68 ?Z9>*K v (-%C.b*-,2G?P$ %OukrIX1wG1A̪B? $A*cRb? 2q-"yAJ/U@w%6ӟI9]+ƏaeÚ&3NA"Os=,ʔ@YE'*k,8*a5kpB3-Q,qyuTGfē"4!O%7ߧliO4cꟲ R{~>hV!uUXU80eq_`9Mo) G˽0ѐ|h'ѸE w(Qd[B?FSKjȏ+LqesGqXSvWTh|mQyM-1"X ZvN֮e^ϾFYneƏ 0LEz{ZoF1:xwؕ<\19Zfqc*c[^s\iWJ mVj-EOmCJ9 J_Vx vFk,]^! uR5j SKM9LsXr,Zw(83ҾQ|l.}mE3>ڱ I{i籥IŭFk"lbi^3R)ؘD/!c{\H`w> Fvxj hVQ1G2ZLX\@jmL0»UrG"Q<ɵ7F -C|ICz 7! R~%/J7cЙ }ₕ ;nsO|G-ӌgQ-u^Ǯd]SA`qDtKzQe 5\iϝyǴ"d#xfS˅La; 0u;lSb}p 5m:46tmf־5H*Y 6\W Tg@8hv[^=zMs:,k?bG)G+\^30`>\zO~%&~ -_Is@8%.q .op=rnE[P\a"* G,%@!Qxhس' .HL9 ^MT.#BK?S(5qϣ$?wjwxV60 GBUuNbh~5$[ڔW#o`Gؐ49;^Ah!_tO4RFk֛i"de$>wŸlÁ=#eH=_e)k՘0Z6S݊,|07> X.팀2i< yrXL%XkH3,IGr\׼`jR^kCy2Jb|njv%%R&fEuhV&g!?w`+@H$: D~`\fڗ-8Kj Lpj޽є41U &`Ei E*>e>حvz$6Rz CCP`L<0_T&zW%b{UϑC94DL4*YmI'EvQINmxM W^{RY7fPP(*)lI\Meb.O=G%0N>ޝ+A~ ^I8!LDs*)1MN$WQv~q{K1rȤF'Z&^ƨof;!u.зN#߻ѩ=--HրY>? zo`BK r6nIV3#FAQ=Adѫ;N.UmYќ__re,ɖUT vhz5j"Er%6}9NYq =V/St {[iYtz}rxo쐓41O-W2*}{"a۲.;[t366}+BӰ)R`Ӣ Lm~)0 D`wǧmYJ 6p5|?8 624Q9o~>ͨ*Lg٭"wCĤ-A4sjcV2"Ovm ig (ney51sV&@cWD(%!K %녻qTyXdՙ5e殚gd|`2uo7TtPA//K|Q}A DƤ\Xhcp $)LE3 6 ~+b{iӮ>fI5QF#T$PwYUN OO%"-g޸+XswESHLS"b)z}ΐM_ɏ挹J&܋t*8_qw.? (Z1U;R#Kn'w!۞̼7 όUpfص71+ܹeo ۗR*SeI`!)= -rfEk 2=h-V\Fύ*~mދsys$ v)BlvzB:ݥ T0g5`)-h9{.ϑxLYs qs[雋<Rdt*EV F%/dhH~B. x^oy mjXW>8I7QH+{|y}eȸt ѷ9 FQ_u jW%z 㘦[y<ʫwre8n 1l o5MSEBrN01,Gd3D[m,Cʆl Jխ,txNE{ Gۼa"06 Sυ0G%/c,,{o2$5#4-!vT0 ,*&2#`m~h~$< oItKh :.(@֖Dbاiy"=LMiX.>Sw=Hz{%~{fKuyCMPΥ5Tmf+gniWl>MU'j;!OdfB,ؒV{-YJ3 gst]'[4*p$=hqJ#"RUsƎ$}VD|O:1F5\gaNPMʂQbiw q,ؐ~;LRTaX a+N)Ԧf\eˏjZ\ݒE䫡ioT}e87ؠe}ݜ*T1dLziBxVt"I潯 pj9@Jp椲d=['=~i;w,PєWlu"P1vnSA`1O Ri 66H ġI^JԂݑԬ|Ha$ reR^I1U3%Wh5TRi :#ΝA/şL*/ݗ'>*0wtnׂ9kvfԿ,&bT:0ye-^۞]I4Ӎj@xL4m:;67!\ljWsX4|e0хA8s!1~KLu_?jR>Xӓ_?y"cc΀]/ȤKL<1$ru31xw;7HJW \ڍ&b>R7gh&Y* j?P͉̃Aqd{&ႬLW~Cs1ßpXir{zuyv}WU,7~%og՞H("C`nG,b+u$" -9Bad)& *o蚺&VRt垼VĹF4Tϐ:ĝ83 @Sf7IACv϶͙ǣxÓ@ݻMKȢ:Oab0+ϼZ@\Gti  wIj\țͿr:1Sٴ"9|,9r}m3BRw\2.QI3?aں`wq81?)=jֲcnKMjOa߮܆bC >),i\jzL䖍T(9)yU='VgPlz@O A8x9obmYmJf^fHg^4BO3D;}QaJpG96&^ 4OT7MLc%WԢI&unԳr/j]Ð6ѝq?} JHyZtdKK6]I\q1DwwQ;C?Cys{/]'.#H5%]<[dfJ $vs'R /5D_x .R+ͤ&Y!Wr6=}BLΰP_f1t95OmqDqO~:k<}w(D떉>_33.%sjg0@W6k4oxfoTA].M7{+gOhSVݺ|҄:@݌W&LN/HZ=$(eسEB(cuҍЊ e J3C,Mlҹ.ZQ׼wJCgQۑV8돦1m9 f9MLvB6v  rJY[EqbqB@X,=FrDn/G*wVf+M? uvif1'7sh&ZKI:^+'w`*.Ω4(m;&KNѮuQx!+TQ\wFRSC=0.=?FhW=ynS@NdlrD[ޅ&h3kn:5"_?S?[Tsܟ:hEx`$Lj7S" SŞ\"4PC-TgZاvj "Sp사FiЏBa ?㟅/'_saolʤdI!q fo2|@]^Q,E spo91mIi{)4 $At ^c>^8'tosFEvݿzKV![d4\_5bۗ2?t.ȸL C5 ys,zx䊠7♺|+[#]D~}lo=+R gy`%< zLYcvvq^7#T JݏXw Z@!Q-cD.Uaj GrpF;SW;RyvH~w "?;8FB>,H&[Mɺ~g݃jh+.+ !N832}>|4|_v~SD0ܷeB߽P \- fJmR4*܎AwK-@XQYN5G#6]@ag3Mą@m*XYfG=>(!3hsi*C :A!y}Icя®+ק(N^KG8 k$q/-l.ےnMUd{}=صUWPćf3D}Deš v)Gދ{dp@W Y4w9p@1Hk n~pm~uZ:k3c,y %Bdqd3R0 wACO&Sgt$)gFg 5LvKk^,1D\nT8A'ׄSH0QE3<\kq8Cե\4ϗjU9|g*Ѓj5[gW" EќKZ e1%.s;]g+=ikum^P0 )rݺ^x |nOE(sD"[@v" 5FaKs7-[24$TT!?DɗlsNvmk-@c8vw]8HdLku 9X5 x7C?qbI>@@ڨHO9%؄iC2\ $7|0<y o1M c-| 3FҬ!y\]phbl-hv,8H9!/gv DtuʝvUa 8;Y wiNtl '\3ѾίaYcM8w|b i]ZhQ |;s@jKfxm0M!("^{L pkgJ3P&dPq~E`Jm4ʼns/1 _~wU`誺v C@Z]cQ3TSY%诰#Y/VCӞKU VַLYiL+kZ7Kvvy7:H./F0N{Mfn(_Нpב1to!T .@#[aC#s~>ckSGγfS_rT(V[G9gvlI nEC/yYm1Ɨ0wb=ʛ#1җ. / Zza5#qGBp'P3NΓ]]}_> z_! Rٹ пY|3V:&,Hji,ђ=}5h[M;gP +8*e! n9IcZ<5FKcu[M K2B'd | ƭ:{H6ċ;c$ʕ Aꐋˠ+P =!)2ĩJw18Ld'b̄MFvY]\hwvpgHpx:"r (Q @-Ns2OǞ~P0);WXb"7>^Y@)<F' p؎LЦ*eF:yQTZw{~S%M*20+Q'ޚ #۹"FW_y*^GSܐ%FaY#I+[ř)b~oϔB[g'圬s-k0"ĺ%X8].ߜksz#UD--P$Q^v$\TL˝L9?eAf)֡1TOD -OYrjzFc6 p/CP2,AC 'M ߄ ErbC|C@a~ FW7ps0t$lNoϷZv y5>}Pis-ؑDz.h=l"o;G0M6ob<l0Ʋ|/#Qz6`sÁxIʡ%Q0BOsOB7Гؾas]u'<DzUM+{!v1OEcp],JvUSP\}k݌4JOCI'-mpBd{^'SrdF.VXd|ҠBKz1$@Yri XX(7+':H!@:Y8 ry3ZS^Jp%;+hF!U]հLU!sה4Ah=$rKil:b+?(8oڄ{ͷMT`gjU[P?IK=b^˻ KEPX+L i` FHZ>ٳBjI[{? +(D=/GSyg]w-f==tɀy]XsqJ)RTp±2o1`F)8&鿫º4M"Wrsn`s{ph*= dìvmIn'TKRt]nюv%N-bb+̴ 0Ñ,j^O xS7%9SM;|4JP[Rt=!'QZiW)oNý&粺LQ*x*k\PC7N+ErEWq:"V:̖-$(ڌ}ލujr#KG2?W KZ%7u22*+W8^p 9 ]#ti_^cRw#<$J-~./UDb)0)A5AdLٶ VEDM :`#\$FJ $ҳA-P^x,ҳpD,oN0pR5RxNK}W Xs\^o'֒|ooCw "ڱ>EQ]nH5TEMJAշ ,#޽A ıW4ju,:4 'S.#ێg^ts}ʉƲU0v-wI+/k /X3S9sW$>2'S*7~ȄL'.X !ikB(.8Xp:mR, "r Nt=m77{&zĞwdBP S't"WU]^*n+ L-*/9gGħڻtr|,s*&gFLͤ#x,tJ&I%eamHx,W]ddZ$`׮dxyTZIqٿ@@!.#B`NO~}q)ouEINbmƝZ _[om҈т؜. KQ$%NY]}eȿ QU$VcuC 3p+a>`mg\ZtI$?|[PpYH6,Sʹ4i('(#IEP蟠kj} vzT#`K;714Xiw5IqٽoʐfR dV ]/yeh*idޯ_wSz ;T73XT{6p"a2G;ّ򹣍w3*:g:ҋ82Jn$W/5)hQ|!I_!T,K=d"[Bi R D}2 lmdk.TJG׻ju_2RhL6nL?ϔTPFCc bau즑wX}H)c9ˁC yɣJ0ԘMTxa3}*+xYYdE88;^Sq*<aTs>MBeRp|P3pn 9-B@!rTIsQ *CW xiGU0(Aϒ!72[rAw80{Gg{yژAfTDP8 2Q.,/sאvEx6ur.Ωfhϑ]g9ji˿ Nي$0tK &.Q"k\J'W*Q_xבa  [Q )\s;G۶n*$pK;jI"+?f v?[ﴹ9@ONIP1Q /d ![O:>)']տW[? uW_ז^,Vԉ;^&"ܓ{3T&O) wT.BTzMqRx{'-kjQ5HK!&=u:roM9kȞE:X.ƾ/}9c"?#u?#DL-E[}H;M#Z x](A ? ݄;Pt(t|9 9[7bB0QBYDQI"U2BucvMQcma jO y#VpA*sW'<1 JG^$mZ9&䌾XwldVSR+&RBhh]=f`}&\}/yHgQKXssfN€)EU0 D 6@ yMbS@:U^kN#sZ]7yUdl>JR^M/ dɲ]Mf$OV%A5!)5auQ@ů\uO9uSVcЗJn]s A jɌk+ N97X yC w2 1<,j]Nzj \4*`w6!b@"&j *;(£CZ!e*p^"H7zfyVLiV{!J&v2Ny_Յ&.$̢wRgQ^SjN- QrhTIpt'r* {\X MHn KC Fov8G23{h"]78 >iE t)uީx쌱kE&wiҙ! @tS` 4T*eyꈦ"*&FZOG}_g5Y q[QGB|bDu5kkDpN\1]p5EEHz BP4E`c0;V0u3e<-1 VUDzw>fP0ށQa^&5y34h&Z2| ynмS+ӧ_!KWXbt79~)SRvx_}!6ç^ {lӡ2@Iܮ^Q+qV>GÌ'ӊm4e!~f_;tj-tvF7,>KFtkV[z7^Ypl݅n|)@T,>v4va7R{]a'x-l7Q{2ۈEE#> 8YNbWq0^|ٶu2Z& Ne&grY>ޒ1уċ/pfv$؇-DzNw#*Q”$*SOmcmxf{]ָ>~D̯o~~tKUsz5 E%%dA÷%hkT 9pM yHE],QyW^y )@ |^-Ł=.t^ٳpO?s-ls^TMd#3T]jI_81;[aX1.R\/=N޿FyRMogA +J++M| )`GvO CmC*LlAH2#r怫@ 5j)?7nt"ŦcV;V\HHP[*#9r2rGIqӀ lLؘV16!95v )ty/.BC &vKin ̳;zm*mz  m~>PF2Ή Q.+35" Z9 w)lM%"stٔnn#SZx]њ.]v0awht$īB8< 2Ӻٿb$g|n$qBV]vB11O+jyT7 RU3 iX0\$HXYSwlDhFF`:\}@W#^&c/`nJn63Nؔ?8pK0z74m <:-d~&)QHbc *$Xk*$QIi튫JwC$G#^Qj.өʅ18AYTKYKyߟV!G= GTt7돯,D?nl4N$D-:X!Q6fuǗ! #<-AAUٌvPr/l9Z^Qib6q>=5 0aEcS$٧\>E*EOEcq2?$Q"aʥIg u|or݀\g72љ)+HiMfy\S WQ`afs66']Ot~ğwmR*IXeWPq [r}ղ_uΛ8$??6 3@zj?Gi'O!N>vϨ ?|Q<-=?A%g%' *ZIO4+ sNR^r; wGR⩃0HX*q^C\,!ݒsTbLx`jECCc: 6  cn{ailr <+8'| R80(JuX Ij8cX$oHoL~` #7r!M3587ɪ[إK68 0  7^jSޛ}+ּ'(;%g8ɨ^5=WnΡ ,֫.ABև3~Y srYOac$w%oך 矟KtZ6(Ry8욏ۨ)T3R@,VHEڵO& Pak/>u qw^̽j{-ޟ5=sEs0ѠTb]H7^]W73F4HފL(.5$N3yw]yYmi?AGG(]vXB]2RMfGh6ՃZzG/_x6;w\ܯVy9h~ixNDgB,יY-'CW4s3F/'/t,"ZD\8*0i#U{d=g0OG~~ɻLJO[ӴgsT=T%Fl.7L .c ͈ZEZ#B&{j7N$_gWrfKN ؑZSMZԷNpSRR*/E]/@mQk(o*$ioZAKwՖKGv#6';p8&C7=Q'.N~E!@|O"!SqMF5Ю@ +0Nـ-aXZW4U_خ6Õ`'{](:),Y㓣wϛPs/?$15usP|?iq^2i :47^fBEvgwMɉgN[~a҂ YV}6ĜBwX6Aw ymSjlALWo@A;4N[9(JrD fѐL, U?@>mteR-|q*g,;Mǡ;)x !}9O-G6cBt5 VxU$ed".|PU0Z5$Q.pZߋsu泻=~3cYdRL23 :Uڃ)f)G">3[Zgv݌z5s;ܤb^pqXiY6XF=M8>>l]@Nw3/,PKnҷqXt޲řĴ!ZVHoZ ʆuu 6%qv=: m.$o"srSW^i`m 3U+\_S9E=c]<Bץ+Y |^FNIVk]3Hfq);LfVzr#.No=Opp\{l/y,ŃSVT Hkv:kyP3KARM? >׈iI1.,s4NUi{æ̗]j:}0!K%D4y R/<~5pD֒L"0b]Xͥ;=dCAw9 TxcT, <%ݵHB I NyG&k\a xl.H4-' 8!xw:%dr}I#z0VY#X,.0 ZɓyjnJN*Ѯnl\cp㨯߰"؄lr' y+vQLVl?+˕nkkrGCo[gdBR-B,dߍLͷd0VS gQꗘ 2bHa^!kKoMB7AVtC{dA:Ʊr\*Z3VVb8j %st Gnԯ}}^lxl.Z9vx0oAĐ@@kq"_0ʘ+qҫnvnي{QbTB񏑬HƆZ@ |4<`oVKrl k2mآ1M9& }xH,,5U ucSժ8YLZ!\+Z"O=#4M,fs|LB/`BOyR&iڨUQuuc:hh(܊] }rtR@yw=$*r<@̏.W86V-Zq}P~!#S(ɛW֬"mӵYczԳVͶ568FDRumB*T?⣼R}tq'BY=1I-P[ 9Ul,* nTΡ6u547/-\eFq/ѹ+ؽ_iqq߁[G ]׃*;MVL4vRe8%_LujB+cggxi c!?1O1y'/(ڑro6}&1춚:=)OLePwHoIWUOK`n U+YW|&I+؝(p28xx^(O=Oj$m2SX ]veA\F䪋cQ: lXe#`1v.KBTB2[kC dB^j3[)_X9%:I[Mv)'.Tx#&ro 橔Z蜛*.wwEM3ة0)\XTJҪ#*(υO_ψV Yaˍ :R }\X AGib^+F`WcDvj7 F UNbXZ9Fk?s4u!H" B SWHn$ٿN=U6]NK+ qrP0sn'^Ҳo gܿ 6p/1tёhtS %-~[?հk/fLyl|!bfR[u/)O..͟75fHc `q7M䡵 G3]S%=/'YtWmVlBqRg"ziv)w 'v=ճS_qQIqNכq ҵfr:4^J D;PE&-Rޥxl">I{Fe2^+i)ʴ.lcظ~|J׈m73UddO\({( KfbQC|a!'oU*dFӻVnWtVJjQb)c( W = JkWllgL[|Tj7rlx R"0OvM)V%' LjXA1d!^4 \!G[LcXI z1$;N !koƿt5mzJ8a4>cc[>0A VО?6mNK F:?q0)&%$bE'rb"PX|7p,H Fg;ǎ>5)f}{3Y®;1j"= C!Mf_L4L#J?*."~.\zrQ}>=Mo^s~45DqFؠSTMNjYmq64ﱨpxW>ĝ )7;h@e  (!~Dl9~ИyPϊUl* #yBTK1gK>\t3Ԫ%78䕉uz+Ax`^'3o}j0̽*H mH⟃h#B1륍f/x~R ɭs¿eNۚ15[ c&cʓȬ‹%~ h9V[c`M`{#gce|ݭ""Om\\W㊝T8GN.MK:9]us}Dl54 O4|H!rQpC)zTu|);eHWB[Qa0nb;B#]ʄ᧫u=IM5a|:[vv 3@!޷~\.3%U%.|*zOڛMgrV]B1; CZ<5j?r & ZY=oԹh.^$87;/6;8ۊ6(CvHzXGuߕ裷vYSi{176][wZ$#p; ?PI |VO{&4;[g+!vr29 3#IRE=J~(m, M 'kLS!rrn`G_JHvXbeg#NǪkpנdW[ƨ+-gIp!npXB߲mp+c"⚙}o+a7OCAJ|Z&#R~q'Ǎ 4=_f : :TfCA;mTA 0 ('e>++ՅU =.[),Dz4pZŌ0E:F1M"6K~а0/Dч1^6s,TVv/$)^a(wy3]*/JP)/c"w0{e6hRVdiAM* N @!7'j%D"rWh3cj{u6Vx->'j5rh8d 5)m}[4EgM^9I%"-IbnD`5HJgʾl.h5QkdOX-HcV,as`5OW]gYqW0ƾ-S)\۔S?L("jo6ZiXʍD?&C-µ[J` _(w.t|]-?ɳvM;r Ml"+GEkMTm@L(ӄ gu{ gݴ"WK$!XԚu;1sĥRy(V0کѧ5.!fM*+tPNBX_Z `تǛmXi\ݢs}i7(6tDKWMRL%MuT[>: qk@1 'D_j:x&Cid.CA%<Q>V"OROO?H( w-JAMAPi2ˣ0;t5X|֬}PPKx 8\;[Aח 5b̫B9Jز~sK #q፸` rC8#\lc+OWjһm\K"/af'1Zp s<*S2ǢSIڷK+ ~;[SPAXcɮܱ i ߞ{Y3>NqsQ'Az']W;H!Å@v>>> #4ÅH@Wh"m͍}8,%ջ V6ހch58hvxZS:*&RgWD5H]{.HyPH@7ĥIT-]''"aI&;FnA*@Qb7Il5mQdDAeyFEyS4aVD8T}#2\+8j=K-;2mh7ڔ1}?X 0q8eUQ*Yx7\f)`=H,xٽ<JEaFj}tz硧?1t5]=o `uT ̱egutxTjό&~]&Ѹ3:~\o%'Ѭ&>Q ִM]V3Էx8RWt5/L7"fu4yy<4eG,@LOٌisP*ɯ2*oV*qQ#(Ak(̔&mm )P2fO!*)A M֤OӃx˰zR˧Re\<iY͸w/QӜ81Z]ZZY/jI7#qfb :eAb1v/ŔZ<9-+-Wm-P58Dq B\.z`{VF]jc*_1yp p[~IumJ<5~)gtǾq#':F䒳K ~S:B `}ujm^c}ϸ#e-T8Gc=ހzJOd'P"qFd| | wD|Y>w"UEˆH̓fu3<#, fHf[mǀ&I[gݕJTRHtcO?5,y46@} p@ DR yY`";i-]ӂX kM6:i{!:,cr-:6^noUsfR)^!c@g 6iĞo\X(ʴg4vH5U7Pw:~D SVOqk,L;|ZZGlZ "z wI1LgM%l9{E΄x:D4hLUu8{ժ}@ 1Qc],q]L Grs[*_Ef8ԭ<2 Kgaj 5zP\Vm"=V&MJ 5aDbcl:z+2!bE;EqYiJK^Kԥ1|ߌJ `\.̢SeNc^TV)0t]R[?apأ-<8"Zxοh?z}.D<m0 v IX&wO4ؒ|jlu 6J /A`Zh/^эEXXGE஥g{D qe)ͽQ}ȩ#lI}sM.g?ۨkS)Zb`ml{ B0?W> M$H8cT6|t+yt ѥA$o+4^ :Tך= C"b~Ej/GK-\ J#J`'YB_)zA>jGUěfs{ۉq'~{]fC;Htt^Z~/ҶI2E > H8Ws3f+aT}!P#aWFJ h#XyYzIrwTdכ4N蔆j -JΗD3ΓVL.07SxXvt;}X\ z <D ^. a\? A"y5ph?%mjU/ф%T%i4kgtsGK6ÉP._5;J H )?f/Q3P$C/~pg.rx'`#ͪؑZ 8ctT:Ui$7Μ^5_`mҷ C4쁱X|{BaW-{a!h;aO 5Qm*Y4H&+J,c%KERE% \-yΉ/&DU6_MA$dc'吩ё8hZZ6a1ӜO GjOu<sBxzZEthR5P0{@p[mgK8\0 M tbc Lí/~KRwڳS^# AbNF,-.(³,`A{S8\/0\?vvB?TwimK[U#$aF*>EˣMkPss%Ye^qbQ{K!ܰx4y<ܠؔ ~L񪇢l Zm&9(WBWɮi~oV0Cr%#p ݭqGh&o.Rm3 s/~;.q S^%NpgbxγQ̀fo4Nܱ:gаe1 )&Ys$z"@7tQpP#YNx{h܍+֕ *yؕf#}[W"[dTxFe\ /?y$;s5z'|J,A?*cO.YyrȪs]+aLz\Ym97I9jKϮGut3Z 2t4#kv=JêjB>]=ʶ2yaݠ‘Y"\B{$LA6smrNba _Wљ62rȚvvaᄪEu6iAT}S{N3\^ RLCap8|??YO4uu]f5iÅ[2oŢ$̥{]7vAp2U!WqaEjR5-M&3 ٸ!$˻gnwL* NPUlU>3i{n+ŌrFwm24nt|[p쐺Ry QKi@@,FMC"Vf'E [a0$VaB]s룺S%~˘\5'UՎAbՋX}P2zB@OV6 d O|:7 x*ow"\2.~ A=pܭa%C|6.sEINUF kr.±{d*QFt̄A/ݚ{fa*߻񿅋~ķwupbE /8ցA&squ_>TY?'ڼ! 1-9GsO Q=n7h|`O=/.< 4{9 tsUFҗCARxO`' vEby#j, P^ 'q:wVv(/ ?ii_VhⳎ,,?yZ" !_yՕ*ꄹ[w9ז!I91"WQ@Bܟuu_'2-Ƌ_C\bD" U q a X^pHO,y|_=H w{:N+FhMܢȸ2'd\n,}˃fHУ_,x_1 4/tΆￌyT_xOPO1ߤaIl, k)nv B0p#bL6}(kA9Ld, K.})PTI{M:%Zqyŏ6/>A ߲p+g9;Ӝ$A7xxJ-n|v_-tz 4\hH3k]"U&ג>0"gDoR|LeƢnPH >(ߪnnf/0wM 4{OQr0ŘM[h3rY_g˓_wiY-V(e.C)r =ڭDq7Ds y FYl?'c@6B9MEi1֊; OL$ٚk==TS\ ؽPx2y$Į9 fF #-nL,$׭p"4cELvy2YlQWkVS&hQ͵8XN&CJZgpǬ^e-$e7U(]Òe) 傺B_rٓdIpFv wZ&[ PQspˮuIu.3e;8/򼇄Vց.SbԿA5\so1!)9ZFKAK|].7T6z`&Ғ>z "p v'uU_ 9qI6|(jgu(6F{/R 5(&~&sM qJ jNMNWPdGƾI<<2ՈNwyR9w889JBPԨ^`:d&K])(='~kk w( mmLM|w얘s˒f@bFƃûw:ϓ_`ѷ 5v4f< B"oG 8/~g\Rjŗ,^HRI%/`V7H$5+oƓ^I<`=s?3?\p6%1 ;=;3%K@E2{a ϸ,zx+L|JAc8QfNLO^ku/fۅy1>2իeems?r5U3n(^ - PD4@;{egx=!˜&Ob\qf>_%`\]JR^ɴ>!GTѫK!tx E9; 2W%)p9ϐ@/h2L\_vw'~ag 2#BQ^R ܀VIf;kՁ;qP@jAVT4Tǯ(R-bӡ8.q$xDѹ'ɭzyr2|oQ1NEZ``7C^ԓSµEvy$-Uu{s}{͑g`mRf}g="SR4\7qu+%p^@kK.`<0NxB45AV7_I{q/"I*ױCOrq1}#c6PY>7kA_l٠F[E Q_c>4IUWL-Y%<ߐxA2j9R^VʒpSyj?CKR MR C>v/@a)!{Nς(ײ(G_N+$)(݃ݒn0aaଝYcqk##Z3^z~u X Tjffe̗舔d/صpL尞Mp[F8,K:?P{_20;ǪGbgGګ2<_Nmy>b7K~y7umҁyk̝/@ٮqb~ \1JOKp6|~JwNwʸ#jpSl~~`MpBa2&cx1$bqEJGї+~VR/'&](܎g3Pbq§zbrSCjZŃ>D2biȒ3eTOJSС`"P]Ȯp!Ejy2)v ģO)d#A J2OBzhBۦɲle:v+>RY ½҅drIۉCM{F()@i d C.rj,ٗ2Qh*"l%C t&׎8x?Qi(&[ ;.Kh%3Ejs^ω?a?՗8>0"hiTu`TblqKDV_un42я-pbrAΏK@:,g1Y.4'5C'nFq?wn]gc 8՛ 8\G_Hh%",lpuc+{!d:՞$y%0lGPxO%7-W&Vi sî? *JJ;rܱ8Ky{ح;џ!Xy)*)IhQ/7 ShFht*1|m͢ *{8} :HjwjxTzո0[Q\x&JΛXja"!T:^SߏNҸl]a>9X>J75NA+6s`nx@1G|?Z[ }n-z_׌ JbX{F$>(g6Pn] 2Im$u7 qa9#qw} Z/&sXjXHAL3G+ZQQ8Hg,;J[e֋lFWAM9qirPVC 2gi['S E'wKtWU%䦪^\|4Z|{H/ Oc&h 3ExV{@1͜06Gf7|©h {03& c>*"ns^£=;^,wY?IFTֈzQsy7nufm;aCH15"2-EqK(F ୩lOD.gxvXOwnFI a˴M 0L%(fV:tfUjQY| 4Lps=j6c:dcIϟތ$c/Gcg]=>֐u31C_qllW t^nD7ZTG3 +im$+(X/><4/M߄ꚷR*k(] •+D }{q?OZbY|UCL~l#yWT8.ӕLk*Bn~edŮ]PGQٚV3 _%XѡV\~FۂI> m'NUs=\0\ n"g5TUuw/Q,m!VQWs9ɧL"Hw7".uW`kp#hix3WMC.lXtCu)iO8t J];wFh t( ]1c{ `t'ɯ',rTirW;-8Ywq,Uغ,wj%PD _'y9QoԶaآ }Pkǚ+1'9{`{EVm,МVF[ƤKN0VZ߃kD7:hP[`]\3Qxܯ%Xse0mj=;awc<,XXU ZQv-g6oNQ6@OC'r,ѤU>?`īIGx˦f2*W'(GTl  OåDc k ׹_ACD_tյ:!l%BlǢp>6(і-2nSxjP 0}Sb/Hi  7#+Id(hn?Ky8ŦwoP(2__\*V=λ7].^36l=\Ǔ*+j=@6Y,|JJ=)0߈cq.B)p7Ur@EsUfh( k(V }=*g Țow(aYG{QtxE3DXĎ9͗D} -ǧ uƲ73Ҕtr? բ\"ARMא-Щ(謑fLnA y hVxf8DSrk>u\ێH"z{L=i&B`=^L9s*lƖQŎ.".ByZe7rxCTk*z|:/D{l`!j9Veɵ+vW~_7#OdǹBjKhOZ0\T{X|a3}`ATNA £LH*2)`'g% A8^{_qaL9 ݭ?;pui6 c6{HN"#y4GؘX ‰]e Jkp9%U,(#x,G0tN_@PpťY 1&zmm-Z3^ kTG-x[A׵ e=QV']lprl0S;<qf#wJ=QQpHZ 3;(| {oNZtR_U;w -&er^ԍ]r@ Xљ VsY۞%k %HQ\|G$|xEΊws?B }1{> q~\%R,R{:Y mJ,]26W xxFF{~/&̰1m @]L< 1F [4Y% @ASbBТk^WexFYM<]?ډGywiΰO~jbf4aڍ0m$X VWITJS{"exݤAq]4<{h̋hSGC9j҃|%HC 7_|!%q&kvI |C8 b Aԝu O]E0;i0RP=ZH f:Uv&-yUVag=~(l9KD؟WvĠ 'KC.@M0+u]nZa"h3>R3 j)ѷedeYNb:s`5N^- |OJll]vWAk}O#p|iHl4.e)('kGu ʸ\&TjW8:D8N-O(Z #ܿqp*`P,坹TVدZNq$n BT"%jx)J<"t~Z;U֒?yԭ8rY5x7ӦD2B. @!en|8RmܬF h$> 9}t&rb"*n\" s G€kƤFPHo(19<@`Y'AEh\zȖArčcDZ ?-zvM!h O>$㤡ŔTS_D[ gcn˄q9L^K,6pzxaG]u:I6wuF=צ+ϗt:[&j6dwc!.ڽI=@ k-ioQU%a\,9?Dv ̼m'`t50(3tC#oMy^:R"N8KNJ"-ۙEt_.*"`I =8/Eׇ5( ~6"oʼn1@oϛ$&5%O^|N [$n ڠeI!q,Aʥ ڿWK*Zf5Q%}m-\]FO\AaωEM‘-!"!|TkVw_(~W`孔P|s^ R95(0m2 *'LɊ ]&VI-ٍ7j0z0:ŵv+SUg!<]Cjt\%q R7 )Պj/' &S!2XLX. >fMk(ҞώO$o/K-I>x{QXAL &b TKzN yٻ.o ڭ>/CqE4CvL~2iLE8s: 8#_Mppon `PFr1XVW}`_2R >d| wW#º/eXU5D_{\x]48Ѱ1]3>#A:Ȑ-.Kb^@`ʅ#x:/3G#=_8&| Մ^ڗ,#bA}Dz1v{Y Hكe),oHE+B9 EV~i'> yuK᳿2bZ!*1ˀQijKsoEu/;OQLaAViRD,X#6A4FaeLGp8TʏD^{=ZIR(ierO<9#ف=a@$ט\L9QO 1,LGQ JO"5n"pBW;9zfSɬg㍣'[]&[Lybh?`8ɚ/҇ ^%zG*r͌l - T0>&+Y[*c%vw%zi,Hظ]J)ROۊMb]FubUs|4W4˜4s̏j1h*f8Bʑhs/,ԛH9E=ŰXtΞAT2N%Z%f#!39D %чυg_`??aKDža/أ%r 2%ix`ptH<y{q=]p^>%~ܱb؈TZKʫ~ \4jX:S keH DuQzˬf>\2!d*5k׆ Šck L;+Q3"KOrg(jwHT5T} NOCS_ /f;\esŵS@&(S:Cif5"m!v͉N"Da3Y;7L(XҩbzW}>{gb7a" )bopDsnud{x0#m8IUc"8:8:ZS:s!H/y}}Nc)Tya􊹩)A*lba9mꤊ/x&P \2\AҖ_=?}@lWan\ZWIQ#mTʕ q֧f>A~EfE_w6Aw~.iޯ>3d%q LZC9FeS~NwckTѱ7a|so#3౔F ZY74?(:S\@_ 0 pM0UqBV.w3V*-r?lijMN䎫F]acsGMsiDNJ-OILdyr9Jw\{8ÃƱN$/fR0B\kAI |*r[AJW,9sc@>&TLyfꛣTJJ=.꽨xE&-x6Ykg"2hSm8E S %7Wy(섿m4˨^FsoZk#{B_6yQpBry8}n \TtGo^0 gr!HbHLVw.)ҭveF,E,Z{Q&Y6 i\`;HUUT[ؑsPFt%~]쌱3ɱl`%uIJ\'l'925pr8Z+S4;q.xO7d) l$9{,uI濧F }!Oz43l\A02j.q=z%"d ;42L"$lژc`PfZiN.gVO. Z7`wzQ72rN"ˉ5$'&ĻډZWxh@^w3:*ވJ!Ї`郁5 Ypu)D}a 0q|SxNNF8 ,*AWnn/ΊѤJdH`Fm~m-[2Qqho1~[NoLf#GE w<> KLcT5 M$;&? ..˳Z&[gq\9L;BN?`-Y jCFL18(G>t&sU棗9L; ;!#E Mwg&6f7V`9^C+Nع8^K E/"PNaYeb#'|K ÌaS\]ce鱗<-ko0" XCk059pGq}5Ҙ-̯ӭIuM6xF- .k OVUq#km꽌=щe,!hV Zg@…E~;oN`] a>'H}p&){S Sam4hz!%uTH =JmSi(3G5X{vCdxNWIm Sl)%JI4UقzU%cV 02GT:eps xLMtJZ>܋ >mXƶ!E-z*vЦ0^tKu}Tqs ўu_ WIW?YvH1% 2oeP"D%1 Z1 cS_3@8."\rnz!Eߔ @ |3/s6LQă>hQB m#ä5_hmXv́&cU Հ׺byJ* JICPam}F)[o9Յ`fبޣw|Izi偒9֖92sDBB#WA9R['bp|4@5򽮐>8iEMga|N#;1qo*18PjxI&ܧtpUVh|#1]q),F)ECRN gMMqW C_ |Z'_c)JܴtR-1ԵGIzF=^]`5/MnXS,Q+2(O-rٽzрy074wI[qy~ {8Պ#4N^a{▆KAg{?y<ܳo= S' O |Kg:.dtB+$xbpEOc =?כ !._Qg>,gһ(R&륾+'']f=Y㐣^od|/b=i3&__znyI^0D_bۗAYOӺ|ƁF\ÿލArlr.5C}0-*jܼVdU6*>؛'3NM` n+Ӹ}[Ҡ,ԲĐЁW^k&P{߶ rD3GnTWnKgn9,3Vxvչ~-e^A}cp_ksqB+"T 2?7˜8wÉ_&ON]C'WPʶv|MNF(u>r`ĘDGkNH=J7{OwȲdfAz@8k& Pv;B~:.*ERWFn5AF9mQ[;z~Jj`Kp|DrGp%ܤC-y2gҴLLPkRBKɒQ]BIg-1[i8$ j~g;> 6wt5'?UiTO,.Zp.L Gd`W *Bn>b3wT~ÔZb%i9l6]#fu)"Ek@zbI~\fM-"l e 4p驹c.4]˕ ^zamK^uN8\(,#nxR|iDىJ?! teR@p3Q5d)wܩlsu 0oKWɕQqe+D$0JmL뚾К8g칬49ڷ [1(gy}Xs @| 9CЫ^iHMǻ-ʜ /sK Und,DZ95-l5G>hjgM0EQa!=vi&)jY4Ńs%vxi"IǖZJ!ةMj?ܺI~u˃N_AO ~ZE=FyVu4-rZ ub@8%!OBssɯ,Qb*/D&<C%AepC.Oʽ0Lp_ػsC*&TT;v5CsNlR(~.zPim~r߉ 'je aP9GN+2Fr+ڃʪ|:1.ɽ}Ơ~d_&-@M8`b+$_H<']+c"*)K9 fx j89OiX4 J-|$]%LFI{v؀MɋebԢc7]7{^,|{)]1y ]NlDnvsKm2#@%RTjZ$I^f|6'Jb&#Clzug*QR@r|5@a9$"w/Tm_bWY_6i7=V{F26ckDFrzmR "m.-R~IP!DDSu]#hQqD @?=w6DL s ؏Jn{Ǹ|^ц0 CN#G޼nRfEqܥ-R-S6xcE8Ry|I+8`:kX i=$'z 5@9WW% 02;>4C; '\<d5Ez"-`bB i$TN'ӝҜ= &d(Ye&>\KcKEߗdy|fJޓ6]tھ\G$@pz%) ў83Ȳg·[+pOA=Ѭ&t룻_S`pN7>Nv8K5u2t+lCm"=K?P99}cL SBTMO~Pj#k pHl 1KԟgH@ x"[fB@1m-\ya"j<ъBLE&\\u?1:9i~W6>R{ 6uVw787+ƽVk d#vVVe>~)M[p1l>H)fFjz9^|9@!֩HB(~;݊vˤ&Ra0A8"Jxt餯)ѹGVڊ>a*yv˰Dr`N1ۖ}UeОy^`'msTJx%d% 9zYr. GMz?vCcK2eOHcu*ҖޯfrvMڦlcxseIF5'`#2,O k#ɬ Up 㶘$]t ?yP5czγJ^mdUzi3̎1zX]㐪 htI2+9@\Hrɥ_)#mQJ`OXNipFUhҖavZzWlbzkq?1L^^[^Uwj=7}"O#*dXLb;B6T4D\$t"X1sK'֕ѱW~+xWNe"+#-*9N`>切 4?n|I7`tKE¶9$t^H>(Tx.DyIMk;뽂QЖ#ua1fN|ef m,(^b\Um^r{|vf dIqXO"L7\ҡ>F YncY@|i2o?RxdS-SJU}ECN`%*sQ.t6}5a%goxt"'L7q!0V-AŢA2L!'ûye&@Mo0Rc5 &(ɛQIY?Gg\ $ Ȗo4JD=mhA&{@B^* S-"߶K-eh[mۜ27Q A6.ݛkY)X]f  *lkz`m.$rGb&rD_[c q2NZ惘)qA<՝b6s8wĺ9|]ZExa!Uh?b_7X/ZmA?p d~"G`ӫ -  ]fǶ\[}@&Ú~,~a'.`_/HH9@?Jˠ>fx̥U`Yіvi> cnV =c5Ba@T@ ݓ™:U:(6 '?L@u}j`]jO \^hūr~K9;U]̩Z%7exV#3B}:Si[dDZpH :m5Rrfrhwi~(g:tBI E7l̗579=>i$@pW^Y\e'><=/8^9wtz:߫SD t] h#24कQ{VN3磤՛sD֒f (:X<Ʃ1Lch .ܛnt ))vݥiS$Ae<ç[2C@b&¬4 f " "e=T?KeD涒n ڊ$K=79Ki^R}2b;hTM]zcw+$ڲd{:)!2oaoʡAxN(ꈳ?1׺!U3}-᪡o%%}i2ȅ@?#A[93Ca6 ׿je 㵭vQ)APQ^H핃/BB tH(g̴Tb&haa9O}"tٜؑL~}cVFgk-,`%\_Jzϧ]7*S=0Q;?ѽhljocޏ0y2EjD8l[#xwk\L?[=ǻ \ħԑPIjÌ U{:(nq%%>pC[Ȩon(ZXSxa:Q&h9S4*ç{&MW$QݜY ]aZRkH1 4uGa )V>7;*uT_>m6mV <$0̪ DFmSl뉏T{#h]Zcs^R8C<_"Z>uܛwY>Rlcz{`h4:0V$jr;W\9LJ3u ◶p{VeX$ {Q]5Kl9%}0{@iR2OLIӦI9߽^4r?Fƾ tL9㳋Ɏ7FwsYgMܣL8y5_^lKGeVo^G WQ!V2҂sAs3 +KN3?@W<%!_98,)Dtٳzt&Y{oK2# \Gns*7Wd͘0$b*C|LnyPDg(DDks+pf2֊3jS}}۟]TڎuWٞPz Lrzt|jr/rRifۢ'?|DRLH~Aka,@A)c`#rtY&_<>`2N  J]*r7Q}Ӹ]WZ PԋIf;! nt(ك%˵uڧ)i*bkFwB" Nu-H4{,/;EsdἪ \d*!,m"_Jѫǎ+/}!h*rtts0H#4m(;OI|Dfq2X-|L6qmoH)78 nXmk8s6KպnG];$:@݉Z,i99xs0WP A1η*gӅ:t//lf6,' Ƃ`MCINzy54<,KaUvՈ@X㷩̐AjQt9wUJ'$ oeM}0,Ė'v|AAˬ3A}"Nc-'PjgA1tCov(0&ҋ*-I"d3-A՛˾oeP$BA;C t )`\:bfR(4DRFD0DXԘ644$J1H R@=YC{Ƕm9xXx0\l=+ކwa")T0dfDSA/.g`0onj{ڔ%;dJT#s1J-*zjTөV?edX:#j؋쾏_ OѶ(ݝAsHt6z!DpF" HlWN} [P$r""z_@c=eDEXHnQ[΁+F#O@TwB܏h_K)T؝ךz/e r0 ;+yæMîP?jEmm$2\}v9( I3 wdUUKovm ζbA`HkQ4 ӕOYҙЍv ӬW> ߶|\KܾM,XY LIW]]/L 'L fW3kC/9|뱖ʠE|n'i(:\|7õw j9en`/Acp q7^㩳5#`w4b߱4QЬDt$ޙA)aբFho2V LAofy+Oi}i9 !t[ril &Nm 5| 2}!_@=wB{޽ߠ$LdiC'"%#}C3T3&~2/H^ ;PCd$$Hf66E_IH!H ހ`1^q;1Ix2@5;zS )$+u%>;͍7#4 .VkO' zLijpsTIɂvP[j*3r粞l] 3 1 lK8 ^Fo]8-T#a}PE  =l}->6B!rNixQ1 T^u9.i_pC[wxdyY4Y@E@!$RE4"orhItm]nn qjJDIZ8WͲ[uN@oeaZL A@[fM!LAw( ' , uS\2<V"袝ݢ_xrx}/rIs4#B$'L B7oNl?~=?G?s's(Z R M?KGZߡOf2YHg `YytP$ "-'}]"PnNv].^lB"$XԐ8 Bsq5qnL 2% G`ҖaC}Y?1X_tʲZp$DA!.nZ7S$H-Zh54k23 !lT4ԕ 4'\ռۄ\CLj) 4hhd,RlM%Mt\1JIk1XfHH=r ]DGNb00 (]+=?ˀӍ6~k{Y}ְE`Xq#(VE6mXʋXܹQe[f!5ê6&M$ŨlQf,F(oC뮽?T%ڵ䚢.\5kZ$Q3QMFc1l/]I9fZ+{VķG=6ȼi!lKW۩"(b>Iw6)!v|\*x g"mar4R)!# ʪɕ[-^Ͼ=_-y&qcE%b*Dm$lkEcl,W!&&ƢɊl!l bdB4GfCH2 %LEi4آMhf3U"EXE!1D̙FRLMF1d&ikkFHTQU9"I`&h,H-V&!4i!$2h$j&jVJB AN9H`f"oAznS=GSc0!E(FɄO"LUDIR_ГY%8IXgQ6 0 IPco }5PR^!=S:R/fJ:CK}l^QbƯi }>㒗a]hl˃nE*Dp-S92LoIIW0+;ѭ$=@ HBXyM 2|b⨮5 aFUYHaSgPOfX&IDTMCq]w+CL8E.%=gciڄ:w}Jt.NKYMqP 2JòRtinH}l[ 9^4AX{ǫZPer ~Q`tzW) <]Hjѣ5?#`^ɑ Rr<P`fT4eN(C,c0`_o(4B2y%=nfnheIJ(yqʼI k\$L0# |FmKcLX$7oGwQAUhuʗH, `:zzE ~SWnQB`-bX/$-PdzP]3q2'dfWN8eBguu9w `Nɹ{[lG*VaI}ibLF (-@쵱&W% 19s&E '"(`:%(i3)$7=/?y}]*IDfQD%lUƢdڍUѵUmkE1QF1@,FhhA D"أFFFElAE&$fM`-6Dd5f5K$6EЍ6hآ)3Lh[z}G~2Ŕb&30DX#f$Y4haDj3"RJ,Ĥ[[#&(R),AZ&lwT+4(Ĉ32T#(yJJ?_=?|>q?7i"pSbo0M X(ۄBoB`dJeJN&EK\ͷ% 'm;^Si!"Bh)12"ƕE ) TdlcmE6mDm6 M+lVF2 i(,[#`ڑd*!5Q-&lmDdh0i fql}Ż[mI[-)E=sAH Q h4$AV,JY I*M^ӛF>C#spm)17|q^eoнl @r6-hW)I-4kcH15~mb )ޣ~X&(pRu*ַrޤۍѷuFl07ѧOG^PSQDIȺGw8A\>ddH&chuy&Aᾇ6={(̜@!!) d38D@%n8ȶ~!iSjPټ x71&~gI]ߠj}lBAgNdXɃ~9e߾CO[aQY{,m"f;IV5kAEо @ 3yS\63D*=+2v/fXfѵ56m"U۹~A ,JQt{̡㯶nQS.#)E)J B!DC qS4f8jCGI872#a!,ı$MPč DCGw9ݿo>u(i D\buX5w.f)IV BUS#ܐwp$3쮳Fӥ",i68<}n W T }G @{I`T!A.OWYu,+*{otк}vc=exX LBM!N426o2VM;ekJo\Lnί*9YP4Ge6*jP`*MEQhr$6A IMJ+r&UKJ jQڭV]]OYXʲrV2 rHZ+T X֨EF}U=U+cA?~~w aXUU{zTzPP>'r:+bZY(X$DC8\ky(I[ӆ\hV{2R`E^B"AmZտ3GHcXkfDf )7L5,sGupa15SK87 !@C~{> )LYlfDȣ&X$2d@ Ӂ=] &,TG Q*oW4fq^rj#F ӫk~QB BcFlR]i_,GW>W0H oxdn i$)_"V#D`:ttw6 ׏/s b6*Z3]edN~M?=z\I*[EX $@R~S>l}9yݲ: K;ohdJB&QJuzȟ<;UQKDan ޥW qQ<|,__KF 6o3f>n??KԏUb s61%TupTY1Y3> >^G'=wi@jMǹ%S[sy<4 _ sd d$iH/BP7进][kPFV#$N HV8ަ# wdn$vQ%7<|]9bw[z IDD!$"lWYtVoyO-в$kZ %W+[j6ЁŮ&bӜ V` I$ ҍto'}y?0kLb YU@(LeZ̅ %VOFR' N|Ļ2Q!+1&6LJjһ8(-$R!5o󝬐m740HL,o|K=KA 4f]!b>M 0-Ypc~8z+mDM}*!=ri^g3U}3ΰ+vJJ$%I_pHԾ5ƑDfmi\S55x}o=,RAVMDZ,Dfb,hԔhD)1FI )wZF0k2dfu_0:7❖?/=ޖ{̫z(jO0Qoߛ- øH@GleGS9)Wז0 w}!,#U  G<[Wř7iQӓɀJ>]2=[-6an 8~mj8?,g~m--quwP(jP&.!z`>Zd`d q0s0@Ũ)})L MiZzۃr )Fyp09PȌ304Y %.nIc!!"dh߄gzO{]|0Eb;|4p,"x_!Lω8l wF"HA]>2e*!/C?]B@ ,xxoٙ~㌼ Io\ے E}B}DD3[nV}a=DQaUeG$d ׿j)w{/ʿOR_-IueQVR}ⶥojP񕭼M]m`bgݏaEg%1/K l*^y' JER3<SEM97{>0 2P//Pt%L͵%bvA Buli≪+%&Bq p=irxvg%Mf^e^}{NN)7I_FMt޻bنn)c.W{!ؙ!Y-F;@"~'S8&+ׇPiH zDk\ɏfɃ4Lf:]8Ucg~nP[Yz]#-A7v^"~?fOӀK>On$g{*zىoe>iIuso>Cnr,VPd.A\eγ&m)7[[[,ζv3uvkkq ;m^3=yǾט ̀3$+ى0)*8?SX3^g;߹y%p,]_a?mCiQHPY-'4aĿuhڟ!׌ڟmi\RR7Nvʋ ~"2./{W}a*G PucꞤtv_5xeg ÏK+.zܢn[_5ջ=o{^h(LL f*Hc$V2FQF)Cf&[ThHf FeBP0hѫ&fه#*I&#Ⱥ8Ի.3"jbc_)P_ Rl,_ª\fsd!i&VOV̮TzE #ֶԳМl-4d79"PSYдM[x^%g 2V2:Ĭ^<YLV.\oVWV/ҐLA# $@ Ƥ9|@%Ig69~8 E Yڗ6kH(VD qXZf@$ԓZ4\\6y}saV±Kq}>3$XT(!+1I*"FPR 1C(0`Aɱ`ѱEf4Y4% Y"E@J"?]kҹȬn=ae1`'sʻ m!\L}[$vwJe iܤO|J&!3ϛ6 eu˯լ!BS FC;R/K*,sz֎Aϟ!ȗFr,0 | [XMzylT^ && C0$:mS/WB:)!pis- voGԎ<³B I:qvc7H otsF_}=^*r* ߹O}7dpw$N4~qݗI܏_Đ0F +I~/C }\_EI$A$RCCn.t]]?c,ԵY *[OGC RR5f k5q5$LkXd$AXED(P6G寙bv|Z}~Yk'.I2|NmK_ѡkdEl-F^@ ^H30CF?}ī@@xFx<[} (w¿LhEAnP\ڣOp$XŽ k1=l~{>A9r|]$g8-z~/ύf<e)DO|JU|U  d\&ǀUO2 I\}C9E]7{_ Ix#y\r]*K"; Sϐy_?; U:XbC,bVK=:/uֹiq fVV1-dd;Nz:hjoOq8aiurMdaQC Bmh 9a&8NX$^~})]Xj(gZRUCjUnyǸiNЦ _]ZZ**'$ 'i0-|!]EKU]JJ%)=J]Ah@ބiAqC1kO :)Z* I߾Qx]0+SzNmtp4HVEР/Z%Z^meiΛo4$[ÑH#rČ~ɹ8@Jhq>&qSipQl5`t? ǞO!"P}eYH͛9Ho@`~ˁA4:Wf  7X˸7~R~5Oo9,u8b/ŭ90eܾ:k=eHJ$+= 1o3ZMLGqٗi2#aZ(? f!.RuF7 y%ioge@m:#2NH0ǭIC !Ul%, PF1 SԔ6[NBvuYsF9 R,)ҝXTk5@u%_t--i5/BRoNt֔S_m+EoS,ҋVc;hẅ́ aKSVRu2FbJFV#!sW$4\\ӕ+E+l(I);}_2<f"M\/`&<͌R׫j"˫ppG"T'b>V~7@?SzsqiH}RՄ3~l{o?w@ =`Z#>{\vU' !~ɘ ܔ-͒L˲|xNZNK@q~ibCSޤ3ꬂ?>=O~J6^+ֻK ۙYwoK}-:C&'1) &m:Y>X@?!X5G30}6y?6_+04Mh}p8?I ߬؂2gEhm`:1d3ҦIF%I͓G  BW@i,ISN{-;(6Rw[s/ﶼ4o'3&.$$$8 A JgQٜ2_\k^3*}ΓL:M)tQM\E;Vc'[?~V=9$sK*, 0 (aIr՟c"(|S}imdiqr=Ѫmq<.%cB>v?7_{V3T?<ꎋ9pʚu>) LvGsաzR_&ժgSP$| L-#k 'JQ)khr]b4<әn  TC4C3\5iKyóW4 ۙ62}}_+k'uX{13A+ "9)#bN -\ RanU/D`'/]2rDf@i*Mmn5%Ri WKD) 5_atBr|0 ym8Z$9"e! ❕JTԴdH(|{Ȋ?Z4C?]2<<4< $\h }e;{V6xfB2I-(7ٺ_Pz# &+[.{𕈑:B?3}d~"$j9PkϽ`{nt+xwC %$dZ-ړX1M)Q4^M d z†! 6@bm`z-^~.[Σ;%_o03}n[E^~}sϮu&;pRsѤY J|Hߟ3_Vu7 &/rPQ\>Vzߕ').I\=C=ݟחM-/bfIrB;n%f_vG*}0 G"e&EC _sz'Q_/k`?J_.PJ絓 ́юN3p1@f!Jnw5׎VKt{ uW*;_pc+ͯiWeA :߉yO㋥䰣3,DTws b.mKtU7k%X|~ϛFD !ʵN\`t0HUm(6/lym3z0v0|7=|w'P s]{NO5?8%&MA_1Mܥ)b e vaYĤ*$!͖j{qr>^ s/tJ bC0ps[yhs(}5 Ć Ͱ8h+z$ -2!$@-< ,FCkcF/2!5N1۬!XhC*Z뒏mf+1if̓^3.|\g7VKC ԝM#ߎ;i^&!Kv>KeΓjО+_ie\({/XحWER?dRCx`_}A%~;P|7AԲ)-'NT s PҞ_EQIϦߪѷ3 +@P/DL8h7te4j-ZKrfnJ QGiNA [#[yQ9m,/4Bq#3e"glqT,Ts!xb.*;m*avD+|X`f+V HWe#Kcy*mcQ+&X(m*KKɘW}j%ӣ O0DTF[D6soQgmeKe)H[=r—eԳZytѤ ☛Ν[Vl\Q^_gY–Y,S<8ƣ}g\Y#mOk_q>ǡ~[v҉J g"YmEA1,x2,nlQ;}4erJ!( ,K ` `HdcL(k6GbnO'Nfӳx!feZV—,z-ZEӑ2[ `Db&ul00+bŻYsnLPY|h珿[ 0+zw=2O6:oTKc槧W9/sn"o] +ߍ)- rdDH'Ub-&K2l[2.,ߟOm`Y" lCeY3XbLَcHHvxIpQ& 74wrp]/%rK1AU3d^Nbg` tpb \bG f>>zj$0l-K z;Q< h^[DжAq9L%-*V+PE@6(,Bn~!qqho0w!=֖!n$LF<. m`RG1Wxfh˿Fmc\f=\3 [ ]V 9mcI~0|:t߹tQF,ʙAMnbߖ6b9n*(w[,ډq~p|=:[!5$PW첒jdewDִU[,Q:%|e{g ZZ~cDkI}ˌIjJ#k.n7\QێHh\P,ȢNjӭaf6M]1n(]u֌X9˕Z9BE`^s{uׯ.ĺ (t %$I$wH%! uRIy̷e+0HE$I 뮋q㋜@@O^Zoo|W_Q20N Gj߸Cor^+Q@\kR,Q&g\zG|]_oD[\CsJ6 A4*PdN(TY;}t=5@d@ /즊's܍%J%/BB췍aܟ+5m>Ba\ LK [' N@ bq$LSt׆3v޻\Χr_)Kq=iQ ̟f.,GXւFXO6Y DR ET'Z!<76 .X]m' #at}?dDi0&4,6%=(5) @͘ BRHdRRdPДN4ߙ'&}އ|N)RRe@Ҕf(iJJhHfP$@d%* QchF-hUmV$   ѱZ0[Z)*-)BII@L ZfPR(Z))ZT-m%E(ZѬmUDV*6TUmzڋjM"%PJȫcjѶƣsD2UԁB4Rd5+Vk\j yy% dB*9 : SoAJ 4P-(P"ҁ@5CëҀJTЍ 5cIkъ-ZhXfUEEVV*En6HA2E( (jR5حbj+Q6jƨգhT4BHJmh6UV6jb2UJp &YDJZJT)BJ)0,k4V+X6$܀a4+>w'ǽLmp@?xEbÕ_poLG??oXy]S~n/UMu2J(XAF`mKd"T|eLNLc_{{-nRnfu 4'-5]=5p/ SF`NiMfulXHl=."4 с@U2[$(@$//>?V[YI7nCj lY :8@񵹐ԾޏGWa(Rsr#ۿ÷82-7H7boJO=.Q9X?s@q3D ץCv5>:Q4ȂWkT :)1!IX@&i"`cP7"&TGU8|.2-GE. / J KS HA70bcu< MX_Io+B z_& 3Mnj" AH%>aTJVqFʇ2Zmp#,♟$Mk~Gњ˶ϛ{O͛f]t2EdJ >^$((o&$l2po-7GK)N hĈ`x7xf x&b7F77Dhl|W}=M-ez\Y!yͧ7?)߫Hշw$M IPR6N@uB摟Dc})oh, n(yxvȵp(LZMgm BJD7[cOO})H~﵈<vfLdT=yB=%B e~WÄ!~@ޔG+2*^څ%Il5gJX0$X;@fQU˾m1P¡CSC샓`LU]'Ӡ>w:|rpz{7fd)d.t뿰#,%IhXc~J??ԗxݴ)0cz ѻp'g+-b::~ /?!D7С:>9gN!OK+3mwd{p1Xͣ^Z]?xl|=NBϮߴÿ)0#ܷ0lyzR/h11-.=G!z6fG)Oa'? 1xsQ#8yL & 2-0$)Hp:u:~W1pW;m!)n,)cYFƯ˶0ͯklәͧCvvNTb>2i):Fɤ󽛬%)Ȏ\_F\pKuI]a{`~me1eRQEQy>H7߃| 7;("@f$Q@_P\]cj,|u<.?T$*G!a1bO-3T̒DDN*2225$2HH `,3$=St5Db/4fٲ`Y$Id%!U10iJV"BH^ѨJZA†]L 2LĀR,:yA)3bI3=_*=VYRn:b1?)#;MG 7Fe>m-ϓj9*j⼲֦}ηp:7Q>}tXKqQtE~=_P( #NB|,:['$6LX"q0A7ڏ1s2Ap#z(0W -V.`tҔ2Kw7,JgIƤS+%SYQY'Nvl~_uZ\OCP%G}c1} \_u7~ˠ@ ϛT t`( ^7Y(Q6!`t@ ԅh;`]rĎ+॓쒠y`ca1j;_#QFJXcWLh|k\&#p 0(2bC N#P }BBɑvpJH"_ƼP u% HA0()B {0Uf^WbՆրQYtsiY_js{KaнU@|$\>֡1"/Klfak h0D@&yihICC^k`L6te b8d͉f;&/N$`L6b+z*bR2 pzqEG=42y8w 0z)ޙLgۊ8{G֛ukT46??;p=(&HZ Khgp'W #'2FȺo@` ܁kB#$l^mAsw8\-D~moTivr/*",+/ pa/m+ŻU=K50< -1!>;T>)S|)gR DB E8sؤ}wt6@QaTr ʁRh eEiVʚ0-}'&P=#4~r G>|b]۷Og&XŕmGk+\\_1z8hd-PNcLDuSrX %>=?+; yIj{/2;R"i/1v_|ͭ{w7$ғi&)UuMVqBQ)긾=eE"̘gg*;7+N}+vIU[r@'bRڔfeҭB6 DN3!ZB[)OBcN%J\![\V}%c{Fn2YP4 X{SdžK$E! lzu}q(Qvu<[̯UȠm%vFo:mz'̋ZZ{썈دdl6>2a_Ol;2` K]*K0DغЗ`cbrDeLOuEϽm7&s7yM.);1r޲dŲ֗W*K sҴ3?( Usn{RPk8Uӷ9o:U~Ь=7۶;O|[ؚ"@E<MZ2Ydc5m6iD=#j32)zh:Zav+ێH2taz9am]ntƬ{{^97>>2^{s1\t HkP%DQÅv HB@JYSh(P*)J[^<|쎎 xuI^Z4oLtzΖ;`{/|Jjx[=pp}<ngu쪈}WKCҊ_}ɯMw@C|)w{up{st]7 q QhD&#&&F@S&F0La14a40M2d'hz'0&*~% LFC@CTQOmSbzb6*~ډ~!oFSO)M=MM~jJdDMɡLhOzM=O@jzSz*dڛhLSR~S=Cє=6jzk]H/|[ `6w!cϹ@f "ߨhɕ2qdJ؉1ڟZj#MSAOϽ TxtX1]b]P?2mHgWe#V{J}zTKYΖL7o>~ < xaY5k؝xX?ث(DHv_=+0Qd. gZHEp*AAs``cd#n&׏skbtAr=60T8vf`6!4~ˠpO_r(B([d0'/W,к>Ʀ}lHiZ(^rhu$Ū&1jF:斚KI{U7bf3kW*Qy%];JKEY1lDM՛wAh~ӗ9z{1[/ARp:r˞v  Wh8iX!/);Păc~uܺ`ɰB֍`M'mx#AL!ipsͬ>ec5C *a=cQY0By7"*(3IggLIv ATU~: D94HEl1ǁK9a\TRIU()DRPRhFiPR"^lB]?깮|(lW5JO(ʂH2 i\D6 l55/a*>5(HHB0KpjQ޷?" {kD@Ag%MpvM&U\{Ҵ+­xNE we?'=9r9 9v3V, 笔FDbLhpፄ?W)+7JmC$ubؑUki:M<8V+í4A̬{ZRrHBfm(`uVX0o eXR~k;5Sq /{UF@?a#P2ov`8TI9Q o P)2BK"qh Њd+P IBDPpjrD(UN!P8@!B @TaPpQzz?k[ PA?+)Ǯg2SO|U}g}ݠ,:a| S7ӄR=w6ZOvG8ΠY["|iH vON)U}iJzfNhziMMch hs9n}FF?]o6ǭn17o݉u9N 4{|^15O0.!cv쭚ͫu… :gQKEIúBFpWP T(2Ui|~)LX4QsDbDB,PH J&PbMRQ5 Җ-QmIU5M-& E]*m-TYH$16L 6*lfֆl(B-!!KU J#BLLʉDe3jji*FJ[%TeE1%UZ5V-6CMiRIEF[QJ6hE ڹk% @K.x'>7ƀP c>.wO 3@kYgPF"r  ġtzc큜r!(2c˯Cӝ7ڌmg@VB;vzYqYfH̕xBNrϢ8;_cg2OUL_RÙ8-ଫ# sHyImO'뾺beUq߇g7g}Dv_vyfWEʧ7+BۄlB; PF?!W_ kO*%DTHGqL^8-,f,' i,>Ix]m YME"@?2.H  )E=\,'לӘk& sb#w=6ƶ]51k;6'r&K*Y t{ٳh!ŒKl䴭dOF3|Pɰ&U36TnB )׻[eRݶzO&[5KAQ (m6En9臉b$/6GOzkbB%-cN\' SS=,N]}9 QYU2CEwpyiNpz jams,)Fgr$Du YD"R(,`mVݦou. fuk%"BNXM0B[²4]x1$O#7Xl`3G;bmm auǏtWt#An F?FDKJL)c |fVX8X6o^#77-43& P؜-fYZ;L8Zg]9͖w΢ QTRiޤ{: $ D!6A&BADQ[fD&+Z̎Qo!Rb;$A )nϐ?}El&(/tb0wE/6VxfZp3zc3T4B|N^U1?"zSeٙ5 ø|7r17YP9( b9!66AAq>Բjj"(RPR-j0ǽ,EzS=9k }],Y|Vt-ck+0YVI$Sq5k1e`?2-ODC:hSuRmدG͐+*~|CR !UԔU,K,hl J*7R5Q3Z\ шnV?Si# ooNZpؐt XSWͮLh2gT*Iu ҈"ᙁ8•bts;wS:_KsJLVіUG{5c($3?bgT3Diϙty ^WN5 7(V+b21)E 82BcǡX/U[ 2&T-Z.,qtmh]e12u FYΤ$ >G˂IIAee/y me&Rw 1 "(uy rQ PJTMf" 0Di7 m ""GiEQ"A" aҔ&P *#xCZ.,:'P1Z]m &չ< #Tdم{h&~H-JqKI*&4ٰhB-o1]B[&P>~Fxȏ1Gn#/)"-3no\,`Yeh`69zv:MR9f0yico7&/oi1po;8x쌍w=眅gbr"?pd_§d,b(=$ Dn+~l3yD|.U{.7eT׏bu 8z|*ADi30Ffհ**Y. &[7-쑣dW'0 \Hy!S첂RЭ{gZ'=((ou]bH[/lNWn^+DwV0!aB Xu.6cYIoғ*{v]s{-Nm]Y@" x[a8˰M#m< s5!E`8r&ƋlG^6e1[գ-DTpL%(?87*Pa-qކ3~H˃-{˒$!-OyQ<PGVƿbDX""$Q]'W?n:2%oRdkfuqQ#* $3?xceT4:z⫫agx(׺qb\LPSDY'hmGg]Xqg77!@n**K2 9Oa Sdud4J<<3O{S3-" A"R*rU]c6XW6mc4סH^lvp(ɺ!lϔY},0n>JrU*H=9R"d8J/ldTbR {3QkqLc ΙMZpFZɕ#RK5|x z>@F`upG^*d vܷ7\|r9Go?{*;5=exrqsim338C9P|*FV@JĝmD:LVU\.W^w6}GRq+NMlZ KTraOpAFm]2 ODܩH $b˳Y?n$~Ry oS뜕Pd!s"A͵*NA yPK$;<̪2K;;.a7+t|:@T{˧@ub;JwR7{F @AC`Ae5JU;-Ժ2&S*QYabuXqwr!d uEE{[>vtΌ7{.7tM/iif//[u{~q\3D}C,%+E3g +b!h ͭ1iʖWBplhT  XFe;:oK0X9uu qB!O%W pv4WBR+C '!9 ^ޑWsjfS+ svoTqu`UvPKʵIjr'#SGtrwX|w< he e2Q[d SBjB \H>_my7f]yґUTXqj{!RH4y6V빟 Q'nc-wѥv͝[[1jobz/':Â..Wazh9nڜBD(^Q̷H۞(m>9ß _]Z}w6 az].U%=y3(.ݷ@0`{ h@X$M2(& dH]3t/a{ms[0 *Nm*VPN46ݼ>w#u=WWl*IhH  bHa@!OAH :[&! m RoT@zNVI٩po?ff7]tXPJC'(:^mm_u^'>l:&[!n%Nua,DȤpdIO{au?ә:ciA  @/) kwŚ;NE2 xCbiT0ffx2.e+gؖ|[%k7>-DQ0kHTA: hO]@TL铆M HƐ]IkDG( ڥ>@oNEr@"A8"Evo3ɗW/9~ȅ5a2fNvYqt#AA:1/MDžEJ?mD Wu-˕_Y\L{,w VuYKu,d|Cad N,U/+BU *)._t=I͏2QZ*s6a2 whX4TEU`W%ڠ_)QiXe,ѣUݍ\6K$->kh6L_ @^pKq{Ne&;!ӦːE('9U`xAB|8h@5f7/')]z!p,@fiH"XoDe ÿO <1GD dH*ȠCl̛7ps9oqSnݫz9ɷ̸=Ƌi˰KWb0n. ӕv|rXWP^l; X.PQ :YoD_M[W۪G˘U֮EO iw$T*K8я{OE[:3nSgCİ}@ eIa;"""; -ujQ؆ ~k:^y铃L"_,kqzڴNw˂4( H'7ʮ"$>?STV ȌBԙ u^\`QV`oϬy>HUeߎ/.y:)U@#p]7Cl9ilGb w늊㐮3kZ21^s7vh]u Ѥ wgSV~[{,C34ɤMmE ٧ E9aLhW 5ygĩ% |<P(iP{]9 ,&z>U zA{-d;$uYlϻu` AuֱU r|nr*~j"K6 XH8!:+0*CBKq "A5#ikFHzPtCA9隰;'{)~mMܯS"!9ɳʙ!iIev0hsŦ~ݼ .hA#g`5dYPm;HНs3$4tv(r/g_9=Ġ%Y}@{ڢ0v{zܼh8;oU E(9#>7+ʑӭ "C=ݷnˢVCvѨ2a$cIjUӭաb~q-^+1ϔZ3E"W:Rt;\8꺩BT E 3Ve^^y^%:*#X+b̪z6lYl1QNs$A+kZ]@p1I4 E !B!@5` TaP0*Rry^.rǪ DY=$#c%$K}Ynp򫊩s1JQo  l(bʰ,sJ2rD<TBPġOzONsRhD73o 3q@ bM4 ̌ǃ(:[xnkqBP@V# Y2V"f$}*ʫxݺhEAʃ7gCP2i$+L4 &<:wbZoYgrowYlC}vpc3DɵAxM q0@Tanm:\񿊈(ύu'p̄!սRxSU BkQ# )4{T8i06~^N֠ Le(dv 2M{j0 m kzrz5pf3ds">Ub$PNɊ[esE_aDQ/M6RiSD ,BVAf3 M@f! 11ßkanbyUF@ ahO)a%'`b2`8#Z.چM(9$,$dZ:Jj@qA]UԥF"q0@&r@U&2|9@^GPKUß mhc߳D!zP2fڣVilapG̠Q1p,, 4gFYeMn̡|Ҫ[;0v MLGOKoY%7^b7CPNshegZDp}t)ЂgϮZ01nܡaԃL@N*ADڃ jHS:<wo&*gWwɿ*qE8M (Æ kc7bL@Qq#޳>xS"m]R\^`$`.+(!wgO\G({) 0ùUD-vTA$/[$ha6 7lyMؕ2;hJo6m^m"63@;Ja-$JS3@ !7n7h#l[B艻mŲ6hୀ';DK [TC:U߈_sqS A㿥Q \ @ v>7J!yJӘ`(ו9ЂPCU ߿@m*+rGElU^0BRidG ЊҶG%eJD@uY`")U5AC5uN`S| LSA]0<8غT`PFQ6`̀.kVcA-`e^ER |൰~Py)I@v L?y ]1uq~Zal njԀ(| *q_WU# ̽͝>ïxT1P>􊪧ǞRƩuo~*'.K5.E/I(9+nPfo,L(&tGZQz[ nxҨ JP&-M yD^, [.R)"(HaÇ7;{SW28 Ha+jM*ջ334ۨ䊨&*fnƎօ1њlnG7Jh llSRnF]6-2dUٍ:-WDƴl%B췁E5.)dܡz&=&eJُ32 ߱qXCJM{u`loݳkӷn>w[Ҁ.D(9pnkov80ss5-|FܢZB Av)z03KE.^|,VUdlbf/D "fn168TviV/tt8DB T'Zz_$c^bzmiSS٨QeAQFyW}mO-jS~^2ͩXLIN ٦퍳N86Z͌6Ы ErMf̟EeٵBoв(ɱdCRV-d3ќiy6%'NkVǞ 7Qc'd`Suk^y%Xjf#T 쯢yNʩՕ-PV 5/U@byiZؚnlE ׻[\ ݺin;nm}[]f"PEhҪKq ʋQy@^ܤD%Ӻi @ ,+DZ. EtZ@Uٝzd5$n\:96ӳ3BdVV|y ` ̩͕W_;{hmQη[4fhD0UL D@UJ@$ETlEQD@V[hZb ٢({(nD SSQ7=*"#D@7٪+M"1)6h Z S{\d4z} "6@nNd?N9Jt^(/ Uުy SĹbs.Pߊ 5hQEob/mTbENv B"aASӿu@'Z[{M-j Ԩh}]k>}Xx CgAkU@ހtbS?3etqum8eWzq@ϛ ^'@By6u:<=!( @t\vV@U.3<)X[5b|iʣW7bgv(:l6DCj T{+ qS{LwO7ih3Mh#@G Dh=Tyy;.U M W)1*=P-.{ w ]<,P'Z߯޻/f5ȪihQV:P.e`;uTBV}p1}(fDj&TnEv(lt+TڋmVWȶ3ƦgOGo`vl(pPgNWW7wD@NN=m .}qvW `Wl࠙mR1-͸*܊t >CdV~ q&ܪB-kj5Tsrղqwme8J)DnweNyjd]+9خ<]:ƃc.3(r7ذ4(^-ѿ`ͳ-ި`)KK8՝4đia*8&59aAԢ;%ٲwmPbDd,3 Wn@7AAyzs-qox9uv5 ̳f4 |*fr, -ܖn'yQK~^=+U;QNPM^@ ܛt@,{JV3~CߠPb\n}5y/ EݼjBLjXġ|&KrV*`.-)u9ubhQdNгwsνܦϋ mX&Z N|LCj+ɚwj?Qv%2{:;h]*"89=z@\vr5vvu`#}ұ >]3D΂)PNT9 ލ]0\Trï̠\g9Vnl;W<=L:nlT4v .]/iP8ḿ؃""ỉ Ek;|<82o'Wmہљ*x { Jܢ6|qPU Bs̀6CXzSK]ʝ/eژӝ}CAt Ƀ{˳v*=.|h?>h0;dW*tQ9QPl jP㙐TS~܊A3w)gr c݉l]8<;k2ZKCQsAN\_* ͵|]Ѐ~ F\Daɋ{^ãΫܱL" Xsrb8"CD]5'{% ^}RQu;B @@;toAȯrFV#^b6(u( ע&C9{gTw⨜13↼SFJv|2δoZ˭Ԫ oUJSJဦQ@5 ETG TE |5 aр AC2@AeU"„ UPEt$5*jD5 ""#A Y^e`dza8w܌<f-\E@2/Zd 0tҧ[9hNu4X"EB͊hrk<>QP~r_I*#f5jozk"n [վr47) $M"%B-Ifx]TeX#w">ri 4ڥ$D DDYo qnƬf͜9`ecEpɧW>#7ËOsGmA4{6@ղ΅Х{ǷP͈" EAz<~uw%wְ dC<ȻNᔣsFdmo/a[Ov]-eҫ^YguK q`!gx4⟗̄۳ 7Ld[K;ɼi_yEV-QicsldMD %ʱ^PrL%T9‡~  BJ*4 4|zD1JDQ@EQV;"(*< DDdQ2[]ADW)d@8PPKu()c@4+PĈ+" 6|P7dLwާ?h])2V6EnA\n<͘r=~|˭&.M0 BP'%T]#]i9orcz)$Cr )!?d&{obם~ @ ل2]!:Z^ (mω5 ?|nKbeȊZd`׈9w,2p2dG ̕l^8ಅ~^$cmfD8+R@5!@zZCOʟ]A9`b1΢Y;O քNqÚN$sC#lJB$x:{:ZZ ;v4BOoʹLPFEnxX=>_DŽF d@ tHo'<~o{۷H:5SKy| `gz߼S!4v7]k.~Σ{0!i2i>}BjrtLWu\ةJY_F iI]"9&И ֜XQ.b 1S ,ksi*Rmlm l#R4 њHRV@$ O+$>C1 D"M̗7"rS`TƋeȗ~(=$4#J8J&!fpq,GiD sN#Aj0}e -}mKh̖f-E4D@DyL$SC4w =,K׭^JH n > ݻp5t!RwP0pXBf DJmXRM{5vWWWhU1%MjUd*0 yz[QTZ*ҭLBZA!(JPhF ]%)fRZ.N<' )Sd8FMYUj*5C,ޟ_IA[j "ZI^ ɨ@f7 q)$&P%B%rUxw* % B ڑL$B`7`rPc`1}:z, y!D*ZN|f؄]9kR)3ִ`P9 j5|yk]cHOA2&@`rӉ "pD@m&I5(3 <6m˜Y$-(lsAsC8hj'!BM!*Kuԗ[`~o,7i\UTDrpȗX`gB1ˊ%jqn ѡE| j\D M+x{L}{CAּtuM'?~C2׼Զv;N̴U*p;7HM>@Nޥ&r>t{sV?4Ưο@rL4.[<%KyM^ |4F22ĥqmfIŲq%Xvz4 @Ё0 R`fD=/vg˿y6xCcHjo;;:9SZ$0@ eph><-ul`'zOSSi3 J20fj1qÿh:q K,!jHv$#y(Ɩ33u%BţIk^_]O/Kp1 %>-W}4l_ؽ}a:[չջۮzA [66~͹*rE_` BZP6*63Og-LC̫DI}T)QF}-,X>ѫ/Z~-. |b4` ME%;1Nfbgmi)JR-Q~ t3=*J(}|aT~*X!C᫗M`)W%@Gc@k0Q̌p%afȞP`gwukPڴ}H8JB;؀acE00d U;cԤ4V*k6t=_AfG4:Uᥚ6FLotn:=o㥲U=:F$ .Lّ G-]i~Uuf=`h  AE1PS>=:݂|X fE "9;~e6{=^2"c'ߪ)- Y]qW;ׅꨒ#_K˼"ʮP&? ,HxbKQZ8($ % ~S1ͻf8Z٨tɊ_ o vvo(<ES6[5{Ѫ6|j#dsي'?g.KX( tpPwbV-rqEEC8<ۃpDé̠F_\nT+̂a5Va3 `Jh\{wqyؑmgi(C#1K2ixZmg27 /jVjJJ$?v;J6&[J:3~Z,Ť?Jch8Ah\-ug28#:nȾ%/ZٓB" hkKO,%,"Mtߴ`sD,>JG0He֯ E,{JgV?:~h@Ohix$$B} ^m|(#" kY* B%8Do[t|.,^!:^@j>j'6(!~4:UN 9Sk.DKGA9tfZ%MF>K`hO: +,B@Y4{;ϴcԾ#5X5l*t`R+H*@2}Q| )j`]?٨luZ-VƮGIp^qyf>l:62- M;1Hk%#~i#5}=J諓{=YА iuFoG-bg*R-cP[]ug9fFѯXWճ=bwk \)omk.4IeZ`zYIm?j 0`,-{L"SoSsfhk據 reW%B`Hk'{ouWz9lYA8q{~?}f= \oɫVD@yPE,/ܾoޅ˙:#Hk(M'E_#5deԏWpH#$0S?,{]+Ό6)f'qRъڀ_c=KŰn(l[=C01Wq*tÖ/ҦL!9 එhe :/OvVU *yd++AF5ɘ7n%W'5*RZ.RxΜ4-+Z|=@l$`?VEۯ핁|r Lڠ׳{I U#8e?'xMg%*+Sby8j'&"I@ňڜ#3&Qpmu̝|VxNs 3mba;F{Z3Xypx2$Tdz0 =*('{2K<ɯ޻%#n^'d !HBIWw7\́).MyQ!+oq<5%#M78oȐ!2J teO@D=D"v=?€] .&it$+ ZOyV[@ܫ ~GQT '5/I3jZU 2ѵ~wW?O}@_CP2NH:K[.xWUO®VRὍFR#a֫ (?OpA#iɾ@0 0]3j?kL%t :{B5MI2ƴ5>u+KM_7鉋v-Q%}g!g"עIA >k0D'wVuxt@@4*X4ުa{>k-== suw%xʜn^:>nH'ă?D}M 6;O^s_}bj~'> 8-`j߹ino2FwsgW;_C'g2,$T~q>WP~|zy&D:4~' u'Q<ڟ((vOK)s,IOԙ"_`I2Qa`y~7O{ύpN=G'͠xkMy70t37`o34PԈL_ v3}F]H E0ȁ;wB8É _iε^5[E~;rT%pb$\ebDۦ<^Nsbј`bͣ)|ֽ?V¥f?c詮+C,W›jv 1}o<Ӣ;TЋaZVŁĕÚ?M+t2@Bݢ S2brRzbۗU[>.e1&7p]x@J+ |1QCZ]2DAZ*>Ɔn2y.|g<fZy{bv]qh'҈H#AUV'J(7#>Oc{ #ɽ`"~$K:O;@(1@tsQD&vY99^# O.q5 },{TCxxaNP}҉t( WaRHhןOE2>J(ɫOn0:J,se XBmڥ(Byژ*h?m0 ½&*9=b41Z=/${t,*BBɯm~*] Fq Up0e,C [s?m~~P~Jӥe\u70_)1\(6 WUOxMBUچ6"<'pgɾ4ٷRʓ<.UfPqSfjJ'?lxpi@AMw(Zz86)㱰Vs&a[o $;;tt(tiLɮV ; wJnEW"UvݺۙNJ4ZAW3ХX YRnBQE~f0vGҺD T]om3 Ps?t rdGO[#;bĐE|?Q[z ,sJ[BpP`tQ>v^K޳fzjh ˲cǙ8^@Z)3vk]*rc).3_߾$Q?!wTC^f1)u"m#H~,S$+[ETTХu.;8p*D! 5^M %< Bm =#Pҍ %2Ej"ʲvB&A+O[UsY dJ(}yu IH|mcǣɔM0fd{Rڕ,Y{bآW5!2mXֹOܐ(A@q2BxʎJQAE[LQ界bѬ1ڸ&3@M3Ej :~=Inh =Lk C~#Ee-O^ ؁J>2H- @1$hRR`(WW ъ6jGz{ym#F(c }G~^<:L=o^\Y_9`S̊iu|M(&eNɪ<־a}*XP^4{ Lj[B {lW;CPno7^hqAj 2(ͼG!eOd^UбSI?4 "GV CW(kc+n;E|UKχ&K#Y[eVEIEC 7_la6¿ٺX`}"[+4hىfQh%n;ƭMXv!ԎZ;MGwgn']vH-fbƌEFt5i]ƚZn6 KmLiDMXhmdS~Vpc#&sK1XwqD /oy.jHhD]wY[u|jHnmݓmwt-w]ksFչ΍s]ݹ˦Ӯ\py{]E鸘w:-mtjݹ8iE)6 Dn\w.˨7*8V"#"6݁Fd\mʻMrik;%ss]uة q-I.U>Aiu!@uc*-_Tf^#lѯVRA*tm9qAD >c0zmYR ]{ify1֕4h,ini22!$a }oy0u&M$DTS׃6ӻ&UNJdE:2huf;SUYQxoSQH|$ĉɅ;%AF5) f&@ [@B OvJ)T3S b*҈ґ,^ ڮkF̪@B !)96\=i#LRj3Yhm`g-ح-0nC|)FDR;;S˖J(&F*6Z>iוcZĚZּBbRt6ƃ3B,!1 #!)6an _Koy *7&,̭& jEW `q:dۍh<7 f!$2ƙD-7~_: o hfɑ\$Ōe"jkTF17fԅLqgH7g]Ȗ+,$#Dʑ6͚Fb(i'`$g.8# 1j')H~)#OREmj|2;KWާOWnxMǓ#v<ki:FqS,DInC@LKA|K^,vXoĊ{nwBTU Bzs۟[jwx'-3U$@~L[v ҂xhϔTirK @E8ɒn}^,[X3lQ ݥDmlmb9#AA JPhIRm*ڊEd! ѴZH0ؖCfF1CZ,5mMJHRM6"b,m-cYj#Qj*jDE?o9*L1EMq-ISTS@IbQbVEEh6[BmcBPMkME[v#8lc!rpAo%Zr-s`S{y,UGY[rZhѤ hmug1׵/TTUUw`Ve-O J&ٹ~Ųt| Eh ̠(9pL?zi^O6`,CzEz+hˆ1SCCSlpѤ7!E˭x,!Wnt*BI&ʣ\&IiJn]onДd2Io*uڮ'uȻm^h1%֙%֌ȘE[@)MSRk!i]2F%!u.nŮjuv$i9M i[+u0HdZ[I2']iKkx7j6Χw] ޚUs4n&bwv͖ITقPa1wt*()j*+DRBCV-Ib,TV B~gUFUk%}D"Q  M BޣSι̹k3$wl3̣W*DZA]J1FXM))J.ZKF0,ܹG]; u]*3PmO;mL&Ie$F61sHc$2$,,)E%Ism crܩw\H_v.q-]ts YYNeq+-FkiiKmn%;ufXM,Qwt6 ~ m{RLU’u9]@uuRk6҈*uˮ1\+Nɂ6[k(g94w)][]wkJb+tutT66RK*3\ cI RiMT` }Yȅ͂*-foWj%չ\|ILe1ٷ[FFL)fj5/mQZW m&n+ߑynHpzBQnDllIbf]櫛W*jkj[RE%SYlu|phdVaԵ6f:5dl2*[ɫέ$󹮚V(j\^,깸Ne&fC!:`K,bch!m `0~Nݳ /pLrƂLḫۛh2h!b$rCL`LhB6\ponXEpRBn#RQQSTkF"ښɚ,Z( "4!di0LULUH3m[W^,S=Fk& X0٦cS$M615*B`@I% $ieLbUAjM-a+d26LjIbJBc2L-B̩"X4jD@6XXJ, b&*QlbQ!3AQCJ(5i""Ce52Qb6ѶI(QQZ6meAIMŴE-QL[S!A3JRC6؍cchj(Hƫ$2XMSk&jmRET"A k,$%"I4(ALh3AHʢƴXԆUPYcK&!4-dQQ$BZ4jF5e 4`*fPV"&ōFm26R E|ׁ <LJ͟5nbkHETQדu uwL6vųuѣ`D.XҢьWm٫:-pө 1fUR[ nɄa}k|jv 4_X1Du  MVlDFbM4MAR+y:JMWrۇ4#MJ٬^Yyo KYZAZd1L֊jHՠEm_䲥5v#d60TQkSeJTiMƋW+t1]YiVZuw[2,eE)sF$WcD(ElvڹMKMTwH/: #ȕ7%#MRnp:\⹗9 B.tAc J U*ÛTQLZ6%4QXQֻZTmTS#kD _|{]ELHLAiƾE#>7֜B]%Y]s tI[8;~nͣt@9 (fk)fE!e)HFkDB-D& #Rino;(to}糗X TL*$lld.TQ)쩆6 dቔCY[ۙlXQFo>W~]ʊ [$x8u<]s0Q- U,dԔYIoj(f4j&bFy#  /n 04aӃzZsBO:G8jLW AK kA1Sîw%$evxyB~~=^(j,C8b!H͂oDRQ\_(9s@Ѯ=V}Fv4OVFd}_oO~}~l# j _)y,tOO{]+}xV4=5߿sW"H10뻪F]-bmtfQ~(ò5 3T T1կb۰|UF1bAAҽ,GQ Ff絉UbyO\@Y\qlPDC0z}bղQAp2?}û2PRLA'BDy:~_JI錤$iL&JK60جU6U)JMZHZaM,mKf-K6J HG} 4F‗H*Ѐ^|Ss<\ӹt1s& !A(X!ybŰ35V5eQ֗"ihT?drS-H̳$gOh #!g%@YVRoʁ`~DAb'3 ;n9 Cs['{Эt/wz@?ICAJQTTU0zqh-Rf@0bMG=(81pt K⩏Yzcka-`f/_`dddY`8c(!W]w 9_.lYٿX,dOzU(Qc3̵⡒6#{XC T aQʷmXr1?9 ꯮b*P0:P>X @@ۭLڴG;>i#pf@ "Y[.'Cgxm !psTQ}y[FRH{h[QGX 3+5+N|ݦgf{WXvlkbS,\i<@.:uu+]S2y~n1Z<^b k>`彔l?P0fZ"D7ayw S3Fѧ8Jz5 4hJmc2A_qZC`no-Ω@Ck|^>}o `kBߩXf"p/%>p|Hu:O,k BP ؠg{ˠ"O( ;h+e"oL@'e*Y4 Ա3*=jI3bx0=^U%1B9:oy3>ŷfe]iWGCROǦHlD2"wx`6qNu 1B3A| />ύOL C !3od~P<]:ɟLY<;Q\@#oZ1y d`.4A5!@n年]h0;u˛@! W([=wrmrzTNMcWK[ߊZ&ᇧC~T /&$4$ȃ(ȓ2$@ȲEjS,cY&MLdbR"f Y*#yoy\x)#1DH ͈"i$2HddA`P MwGoJ⧷c{Gq#chBG'} H"ۥMiإSfJD0!$*J2))KffiSem5Mffii"bhZU@%Aԃ=sw\0B2Y*_EIYKᩲg,Xet'"#:Gbc,9vT$d~ yUUሁ!|LA^¹+ d{ =sO؜9[q\ wW5S b ]։h_ͯP{5;U픳'I _nZ]1um*CD~Dĕ3 2^NƵfƎfMM3lL&6[Z"iXᆳ Sq26Vr#,מ/U !>[3&Vm"3Sb$ 30,ZGECڕpɠ '{Vׯdg_ I$&d)ș0$4~8?\yP̎~Yq=N׊0:oW_{WuG(ce\l0;s.4B5YwXp4&f̲1 Bw*tű#hDn>yΜxʚȭ,9I$R:EV3G2:R Ǐ8M5 P4%}Sm4tФKg,yO%y6 #33.Ё.D-[ y?$RU聏O]A2:z޿*<gyGr8wc*C$c3ׯQ&)L@e_x!%$@i2dAzb^z 'ZhGSH(Ar{HlִYf<2مfB @g`?TNh#j[bEِy8kTf":E]`ioMP>$$ï)EOkwି{^g"h`:[_mv ܑ"#ZPe̮&/41 EfP}]Hz][}Rnp&r'[fƎTsb ^ZFuQ%C4C[ڵ7ɂMi;o'sMCo= "MTȎqFG!Ƶ <~r!Xu3]y5RBswbU~RnuvI |}o%俰qTXZybjX҉X U˘,^ $"*@8t#ZVMA8g\[:3ϯ0x$AV>XXx *SF@MwަB6/{7T]?OY@QcSKY vZEkQNFJiG)OI@%w-*̑ؓA}+;v6e1S?`S:NE'>"QS: 3c\/Αg!̖i]^Fpȥ׈Y,̇,bI!ѣwWeN"Q)oP֎< zVD<# VIq i}ҸayxǓH:F!|S!Sȷ24L$@ a|=cN¹6 -QҚ[!ŚٕNH)@Rs>w߸v[2".t1۳yqiFĎΘ%IJFn\:43ݔs]Yg\ nuFt=T+%u \k9Pκh_\-cmI^lB"IDG=u;s/Wi yv'8/ri(36TȮo1Gx_nܾ~9|4իٴtW c0VE#ծ?:@miy++񩹢%2-X0Xz62y+(gSǟ oOF08L6*V3 3ۀECY[XbZae=,Tz["@_uu=g6(uNf&ND4 _FuWOkfYdt8r$ЅL܍XV-H;9cPnNШfPa&f)~t6q򝫤ʵ5NRQtu%7  }{s8=yzty^@3Pc}KL-M0 KPKsu*:Co=}}"I묔77ȯM57Fwe<r)'7ԠT{2p|$ޗ󂨣m}I j; FXa@6Dݹ%x0f&j{#Tb]3ȋ 69;=!zqbĞ\8,Ls$&7PæҐ}P}z~ծ:$K2`0R &937Z3尧M&\Z Hr.hL-仵'܇Ukv>uʖנp笺̗'N#FHR~|8|;if/ J`Vc4e>˃)Q_PjpO 0A,C/BZqȚEUfXNӥi}.U\ś Z4~G}i7 YYcem{~ A?qa:fVND !+o S^n@``sY@ Yg'}C?.mr%`(U:ĜK d[f nc9H^n[]ìPA~!`Mۄ% urNc$N0˼e!&Ը,0q=ʑ8] ϢUeK`@fGP]m>5x~<>DlSsAI9]z7h#MGFP1pMx^YEzfCs𣭝Y Ř%濕Gz:cކ&JC*@mK\K|X!dҦyoٜ'eA!X,{c_G޿s>"oltڍ? =~8%rADSIɘyG. Y0tޙՋ,hml4GO`Ir0!XߨNG84J휅ܿ yyJЛ;EI6j5(>fpgG6P$i$ĺ(Б|t6CG ;  [-EXDԣMRX E9¸.Sr1M"oڨAdRD =gzP.>qb$YݕE$GU#a`suBOa2X$/iKfzZZ" (cq 咰JZ:'B)Hsh`}ab^6Err8\46\g+ ^mQo> [ݎZRqLOW=F-g}Xp0 @qIn7L$#e$ˠhF0N;s6ﶿɗEp-_E1(z;LqRYڿՖXL[9]7_ dr^5"쇯]wО+nL+*)u&Ծ2 |$aBPVJ}aHK fͅ|OPE4`8gv^а*C )X+f?])Z\EŅ'#:ùi,m7N CaHC{+HzqAԒ 'qCW,6UWs5|PMHӸeuZ;?SvWKڕA[bƥއsj J:ETs/ BZEw!3(;[Va?[^q3mgD 5T_rTuN&-\`nS2xE߲ȗ-32B99} W:o֚(T\Erm:HA]C\\F095ٲ=e]̀L;I#Cihq.Zx=VJG0磧+y=7(/J¤q/[B/oxb [H[Ȩnpv;vOad~q^`@Cq;ڤz8IYp$2Orv1't <pޭ.!JYES4sKe>B=8iL|shps NPŰFK;l/ > uE-VpV+Ͻ7ꆳĸT< +rWn ڞ!TRdJ5  VhR^Xk;!X*_Z$}K-V [F_]ߎw(}2vW#s i& {XB`\HĔ텘*R*r_""Ce S=p1w<;lHD2!'Hg.55816%Y9RaiN߾Ô%xc|e\OG2t [Uoj z ϠPka$i В7sQE*u)-_IH6_ʧa':<:kIHS4T 1jyXݝ},p{q/_§sNtm|g@vgP8}`_fǯ T%Z0&#R*:=" li} hsH8~@AY:ة수L:fe "Ԫd#e].GB,o0oJzOJzsp&b{eN,i+銣` AL _';d̅7em)ACqwb+{bB,X?q.<۵iapq2_;*+̴E }/R KX#Q^1`֬~\d`D9{Lg``j=6\@ơ crSyHI;{_O" \4v}8o}yG 7Æ* "Pн";pc Q9YCmҧlZ)Y6?B !7u@ҐnֳW֋InZp ˖.ԣ) ޶ $%,KH%_B1c(#<-Cy ͣ8E4Zb9M-" a:nJf6ZxcZ51-v z}7.?.w,#%ؒ1hx~ _ > Ԇ; O9o~Įoro=Mmpԍ9,u dUB!ם;_MSlYv3DJ\.)L^R ,$9_,lmUd(d+*It ]5yKC-ڡN/yS= M`j T""iu i#x4< r3 4+e:ӫKz!X? 6](70RХS)Y/,N8},c{<Ń勅+@ctT}Վ [wM5 &(`"̈́Ivߚ JN ]7=Є Z(jdz/ǪU487oE1Gw%p$-<*j6dj=ds@2lˊUJTNTFǼ(MPldd.梟 =iu M9YA}3AfL$p0P|h @N d7fEeb쉬͔B:k}Й=ٵQucJYjF0>?# t ZlՐ$Bw?$4dNb4bw8m.bfھ# >[,]ٽ [Fƌlqvo]lnޏ[A  H]ff(H!ec bDF._ko9c 0څ6TBf溫ХS붿  [:SvDaN#XcwPv P)180̏luC  3Eٞh𱓕Q_Թ&<9*u+W)ϳ{vw ڤy=b%db7eT"Y<3&5't [{uA*d5ĒU}ɞ5DuaT!j& G?9ve!OCѧYpTe H;>Z$¦c}?uȐ#5i|7W,UH[j,N6@"B,{^BLG6^~W"Z&w4.=AaZ<,n5G<[oF⦭.V'/ww)|:Q 򱏨  _a~WӝXpR0D@{d<Z$^<9]Uy"(q$ '@*a]|kۺ\"9]`&左T'w5h_Xk_{#Ca՞;gM(#췓2P/,L8ɷb.^N TfR "`H q/'<1NJpIo g־bNnJC*K*ʩ=07J2F-Q Xb>jYYuDVm  #5Ek0~uAڎt92M9}F;E< afE{b+|b&  p̭c/"dB>AfLF̚lN9v_XW\"x 2/7F>7'{=?0TZd/duL#TnϢ3*Ji|M8jc䃴difkU;"6&Wgr.ݣ xw8քJ|e(_3 om%3DF"P]Cf2>j}3&;J:#:>xzB9=37 iQ8>k᥼hB , e8q  j!<:Sjl41%9 \afeNaYM6UG^ә6 HҭxmGnctuhWS8qX7 e?& p!cY(Ga{mӉ5U=IGzg%Dxke#Î!+e>ؤdrtI>(}?NMk2 g"7n$%͖x";Qİj^n'GOV}0mjfYO-EZIK nfbD Eؠžf4rt?$ZaE_.BXe"xWjFB~g+DhA9 m<(KD4_}F0#ԍli2uZͳNqy6+a*J` @enx֍}D`pn^4͟Ap?g2\-SݓOÕ7%bW!A`>k?li-Cq^$ǭTM`q3K3X8M' _g - I<֤ AyNզ} 0k_Ǫt8 /6KỌ4Pn&X]ő C-HbČ . !5۰uكE g jNԙ_?|2Йr혩n?,.]~u tJ_g"Pүtk~$ ^: *l -p˞8?b LLP 1Bby} S,7TՂ_r 㺨XtP-:&gWZg=^HڧF`rkE[Ʌ|Zf-q"*H1i'Wuѝ p"?k1+;dAMȨk.S6Jޜa G׎ =3U>K-HTKm: d+_i)8\^@.š%y|Τ|8G5l!b)^S 3ӋHCNFeI{J{2ABr}ڇ5>C9 s~>*Ō4CpWo_zK)}\$6`4 9F< RIMy^Pe$,s1$`Mnlw 4v6€$YmxރM[D[, JFɶ{6X{k`>$#󅁩W#3 &okLm{k&yǔvٯ^P;Ѹpմ(VԵu2sރE/NmA|IB|/ }Vw)gRWG_Xq}3r/0rCQt׭bt ֟kF(lg(?O%!Mm:]%Py=&~1yG+hS ?Bc[G~Ԧ=cgqsGlѨym]]ڸyyW: Gh.rY| V_\ Jh Fc;ʯRT1U6ePwrAԻTJ$^-:Ŷ? G$NhH "F )m"I Z(kDڱ [)d#vm:i_.Mw⠟:C +ؾYvXZ:xC1- r&r]ȏ#eEBϳ%{zp`}buxHiE5[v% 7J7why;Q)f<]8'䪉[mh>B|U2C4?`w{ݡq8G; >7+ %y2] Ջf+u6TDC gךs^al&'Tٚ}WP'n>f"@s/MWIlـ$jCE7 ܊@_4C Hu%/˝f0 i #j|&b SGO?ްb9]$̏]OZiM>aJv77 `ԩ&XW;0@+gSS26?'`A6wwm(GƔ☬ _sehO9-R8qyՔ!A\ CU d)*GTİqrFJ*#zb|S&"N&GL ,Ԟt龲8e1wN}*_=HQƉ He-R̅.Oyрګ Aɂw]OX+.QG`-oZ0k.@5"] 5btᨙAcK&qp="h5;|QV]4yŌd`zϮt 6y*wܩ]m.ƴҮ F{g -V}nq;@i2{1 j/4v x[FdUkrwyc֣%#Hڟ4ԣo2[SaUǩ``sc 2;܁('`SHGxֳu\ϼ~.ԈsjWT/?oYb֑ U :L3]ƄbW#?0*81xÚ#woweZә[З=M "bL&N=p7[>;Yc} u.}-OK3ZOvܻ٩}s >MԱP$a‹PwN-j58tm'֣bUy0)VWwg`Ho$m2\U`rI ȟ.s]e+Oi0MZ~255-R89_':q8X)p

d,QvbX5F Vu߶,lѝ?|ẏ=(1ϛttJVFpb)ˍ^!n}^Mr޻,䊽6 m~ {])씗Yd.g4c Ƴ'norF&hj,ryrE9{{_;Ry6醎xpDW<"Xؾ¸/⬑1u[]^Uu1ogl0Skj  iLJ^ۛdV7dGbNG'uv7$<@k"L;(r{O$n'?e)x&Σ>4-fSi$V$V`hOK[`{uEEPx=G{i{SaR[>D:(ߟKu`HR2nW;FExe1z#Jlu@?SDru 4螺DY.b4ma#"wz,0QG׬6ک]!5a*";#){x4+P;9SCZ7\'  l z3qI6]OA]R řhb4ں XŽ]PFƈFG Gpl(`0c\7!gx+_M 4,~rɧ 5C BZ-L6Ž{5I2dX_M2`_sfם);͟0=PxĎLu"-} $4!D2QEU-(9d0j Q69% GH/#Ƙl:6 D˟Ox( mm.ZN`7f8i#H<@3R=RrFA'SM[:DzzYH֍^hTm"+U §.r<k0y+IJIs0sѿkBHde^]">xi)h{x>nczZ [Q{Kb!n_g$^K/eEmP؈0lf!Յ凧/,E~?P7};/։,U@eɃY U:jHf݃"wSz?ʨٟؗKwl[zG$OK2عvK.^M7'TB1Q=7-)sت-)P˸x\;<:p؜1&5:ft?gYq?t,S2ɘ ,;h휘ɯej`'lT$_̣4,@Jb$`_ Ckv#`GS)J LbteOnXH6PC:7LR |'`yOȌwTݹ,!sY6'3X'B"3]Y@_czC, 컇 V Uj\"jXix.5X¶–eRN `Žm£4~^Uk!QY:~=%+TEJ/@g6(y[u.ygE\J"j"xaWUEeLQ _I cv_vQ^ @Ir[䀙ux, u6OXD|v+8y6RKu#Զu}M+:PqλN&9I"qd}wb#';ՓN>ۑ,QI@qlQ햩_ƘHt!D+ן?o6rIaOm {X:`86FO~3r?փdy"P#-,Ξc?ߛSI ofϪ?!AO8Zwwcd!v r#7U%ꭔBA >زwey,qRzżґXZ7>:KL]Zp30Z Sqv (.Qk}1 {ReĆw؞8q ,lly|= =XD 1? ;^"  بSQdj2µt|yt+S*z½\gqdsr8 61@c,,!ԯ6%"Ӑ=~R!\4( d08Ȳ tŀ!_%E,jz@ȶyqi^!fÍyu/A79keʀV§4*y677q!1 |FE Ϯ)ဵE[*-)`bx){tg&W\IfP) H;rk73O;fu8\(|M̔@g44Z{QK%Rܙw1 ")ydeAw PȦ)"OCW+S-K˼ ]q'!%-űL؀9v릻<.鍫 8 Ffxё%PBhu8mĴcfsv|i+P \<-"5xؤl;GA9ZRsO]8&J4LriK»L?awX<)eY 51(x37Ҵe.`EU:.Pxx8U<B;Ek!Q,.{~1aGX1)P$_;7H_uzZ}TmQoFyIYH/Ynr?m[݀*^$Ϊ B2//[ ?=kҜ-63'2R&j*_"ʮ mSDAA}E,;T̷{?oח;y:IJ*=3-Ydgf{3#3 `L c‚ˏfP(bYתϵi jvU=>)1 'Z# .u7є`;d}z/"% }ףl^._wQqh]ë}h4Xұ 8?av/Rw( ˿L!˕P ?S^.K5̾h'Tj H2Μ擫J<#gF[#aL^j" MG}wJ^"hh]Mr, py6hF;X(xf5}W(q̓t(1QG2'p2prSܽd .L[XyʪPC`IL+I̧PT'NJp EWÖgLmZKD7Vb?ab? ɵ.0AܛQxESl֧C6Gݘ %tjvଽ:˰G7G·2Oq緒5u6^rQ?*AWf[%Њ v 㓹-9&\N7ׇeϨ%@(˜axo?6JqAg;wV%WD PRAF|e?kñ*]QmO4z%{ aN;V'(I;P>mypb:z[{RCAB`' |dDOP0Jܓz~i,᣺ïLŴ8 m vA]xm&̉ 4Z1eDpiҖ"F"R%Fگ(:@|eq烳"i)87d)jHkG.L_cSI١F@'6&7^KHk)訰ޅ88iaͬ8YT=:4uldUaFKuoIik-M}Ci^BJ9]2ͳq*k̞I.lk'e<|'z(*VHxoQ脚H)RЃDr^~[umOg W/Ю獺Vn Ps7\p}@Bq e6뻟5iYyq"&AP Rz[7&$Klo Ϋ3hX4YT&,ӻ`@[d%ؙ.ZFxb񆱶8%ӗ_#.BRwrsE1, d̄(RBL_ {LҒ)}:io\cMT[z +!C=b{^Ng9ŸS <@}Oy`DSj oaX ,Ι_,=WI= IG SCD| '-i԰gwWă[_N :`A\SyD $XK( f ~mHn-;66!º1~UokB3C{3rЙ"@k|Dżx]Lh%Zb' _[BmikDID؆z{+Jx8OY_) ltnAm M'p @c6H\NF?=+M:{%ȷ#'@ֶ>UVIiqc1ѤwoE. шV—GC?2 f)!T 0[}e|V1@oþ!C3V 534G,I8n`TWI@5@ ON-{%://Co2&"gVKgCPb$*9nkr8#Wp7!aX { j[<,^ c^A=75ki-'96y!\Sbu@|ɩ>ޘ.} c{+.Jw[qHsken/O]@ZB4[ vV a4aۼT?dz @:C M7LE0m/UBK6hr6)K2C6q@}*~Xd ]36)HԉSl;d>H\zju)aCTi:clڢXŽ9B}b(uΣgЪnp?nkzYgYžfj9 H = Ŀv1N;R[i>D \> YN elPp 1vW% "6I"eV2'LYuXb J2êDb؇H0.4o=JG^0$_BS}x ^hNU|*{GAps|&k(a/Lr $OJ'U;:Ll!]`翰,B&!\'W; f_U?smowz{ߤNVLaB:h#N%iK rC],6鿮\xReo\00+*Å5Jbvk[\Sap,v0L+Sz$'鸚4>r>' J gPtZL˅װ^#Espu;gUcnlrfJF@"Ovi幕.ؽMh3C=5ofl߄5U0 OVWq {0BTNZȩeB cF! #S1a'FJ0^zb=q>~Úop2 vD4ڮ~Bʽť0VNvm|}x;S]䂷έƢrUOq0.!f~!k]ҸeE֋;x>-AO 3'*ƝڽSL05(^˘&3U?bC}`3])IɪS'Th{7lMr>|XJԲ;.(MWD24*|J\FnY}..Oa.эY^@o;զM=3{8[p&A2'Ȕgz|BN]Im"E% U{~_(.R=u$BK*mmv{JLãySX2:۴#-Q5]3<8`4\|gsqZ>?(Xgw`ʦ0ԍLKT$٦%=:t#ā6d>$ېv#B6>Vg_xu&$xªV|D6t%c1$e\JN6<9!R{?S0a_Ҧ~ .Htܔ.V"34ʼ_y`(]L,z_3pC G(x dKߨ 6X&nczgh~m0t߷9QS*nj@EqPIFSBl98}7\269Y>^:g?>-o`ro vTмcRMZt, i-nv2h9ŋCSOz}ƛ)Ms5X&*޼'WIx,{qS&EʗEL 2w M=^͇1J!\Fb(v7G"!=Ie@H6]i [`-\< o0PvX&*!>F|7|w}]o恵l8< ÐUCigF7%Z e - ҦvLHW=%|~'> h 53L8.S]n``D5EŔXG&-( I L!BՖ!jS¬ɄrE=[e|Zvz_c(K@|*8[ߏC͜f)pݻqIAi3r)%tT/Vwn'(vukq.|;S!y(U;]e:ڦ"KJڴ,[1|k,9`& J!Ҟ6xq| T3e0x2؂R"rR3mmf7&qn_o Ny.Qb8#0 q`[K$Fqqe5䡜WXjMuu?k|Z+L0-!&nlh$}4Fb[LeXR ~ Hʹ#ċ Q О;m@Bz6H6HP/(#Yyi9k;!*\m~AwȲ^Z :-E JŶ|Pd}oEM3~TrċoO*&foV>!=(S߆lv/yd̀9H«HG-NËYDi;1Lڰ4A#LC) ly$g7 7xktBO!l*3(  H߂րl0i[irm?_O Z)5!@tC!W$r oOE1Rft±* z_?O԰<)I HK qKٲg}`*Sj 3g-: Ƃ!6,6п,2A$5k9xʷD,X<_(/ahPq  FX$mdߍ;a66ŋV,&+Fk3Kr4Dt'!32!.eiy\XV1A ]C;~A L٧!2@zny Wx}+W8c7Ț^^(& mϞ˹{޺m׭܂6oq5ڧɱ?e+tY^^Q|7?ha)PFƹy Α nmk՗s2Y|K~EL%Zr sp h{  rQHa2EW^g)i @Q kNY9 ]v ^ÓDՑOd8w韧WjEQB- y}-N! z*F+pe(-.ͨ\jȳpΛw#њzd8"{ǛI܁xEUۤ{FlYV\3O +/+\V&N֫"Jd?3~p!g罉{kdfo]ۑpUA'w3zҮD֧Xe# `!m.k%SP$(p[k#uE6pW)+;36uYl&-(kzM$?:Ha[-nizްLu%Y?W/ͱJ Cx8> ﵅g:N>t#g(C4%ᖡУmekW%]EFKQ2jDŽ$6z_&2&Ln;0pltmXW oQ 훼ʉ?UV_.?Кs {$pzrkieUwn5ucsf*Н`$k=:農lE:74;\NG.CJ!)eu94[TK[Ku)Kb jAҢevΪׁâ;P×p aǷ7ɪ„kRr_1޲^W(iՇbDq. xoI,KS,Wj]IDTW9VNSҠWWb1ydU&fM]Sqb#`!R;RE<'9i]υSaP02,U΍bcbfFSHÅlК}K pPv*U*Ǝ* vmQpMwK59Yd#6k?0JFW%Ff0S\J=F5IQE#.,7`U7&r ?@:,~w="^7רZ }^szq׌<_E+1Y5WihR>l æ X9qQ:׍# g٪3762L $u'yT&.`jP.pJ @u_Ԃ ߛAhwB<gw1if ܶyL 3TY/S g2$Ƒ /Ԧ+-{i+yy]8އFN jӊDlA`团F=Q&ټSwDO ]G(ō) kS|/QSZߡٴ7enI4lM6THw0e䞊'} ǯ㢰!3F[lq)u7@{G1Ak"8l\<ċV-נ+_]@8.°|(z'A+_$oq@$ogKLW 'HSYlIJ W!%(dɦElE7yVmD1SAM>}vrJ(Tpu&Wu)D5R~doF^ +R[OP:C1'YPS{3œphH P`=ʑj)!_1%k8\X:ѿ)"_5[!dsEmllJ2l"w4LLEMVQ6W8 8{yndR)n1!N>g2P/qn7&7w s#*(m2sN &;i6nbq"ծ]َ]ֵ㬁C(TCUr%B5p}"u~*$-7'_5 .>)=Io/B~l!vx\XCg|KM-+ᐳt'~iq7.Y.VZ/:tR'ȫ}TP5i O. hmof4u|HÀ -=FFR] td)DO᫤,Y\Wv/i*yߖ-N妎(Ƕ ڲ`T0?~[GpT(nݣֽRȀc}6 Ŕt]Oٿ.#TG7.WQ9J7R->XN_:(BH2& h὾om^fJ`:A3.id *j0 l#6Sic(`Pg-w6]RƺIV^3"pr_=ddc 4< X& \D)N&OABUHӹͯ.H*MB.cBC-w$R[+q}h}Of"dTuGHl53SxCE:*gA`>f5VZ`b,b ~R4$}1\Rub^a}a*q@h^$~HYijzyduWJ/75>e,lFb~H"pD@ӐFɲ7] v~p ~9{a1˥ˣsO$|B! j~K+i2FJV/[?Xc5j~"uXfTUՖ/JhdȚ K\u244;h[5 /ж94WMi (ofpҷ8wr3ץ_c;?ɵ'17 H`(VO" g4$=#np%p1aWYL" tv S?lZ 5?Y]%®U]\A$_å>JӔIDGH%5?4Ozz+z*CZK7b[! Y(G턇QTo}&gU>{8AJkl TXBQ (a!eYú=G|36N]؀-'|@Яaw0/6dkK0}h4' 㮬2'U]dX_w27pQX`Kq/O)+tʖOXE1#Ҫ liy̘L TQVh; I)ɾ_iHc:(L,(qʪ