gvim-9.1.0330-150500.20.12.1<>, \f&p9|j Q.5'>͡mMusnIo8 |#7rXyIYFM/ NkQDNAL(%G׭gD7S)~.u8m&m˃yhe*")%TO)qHi5Jj'(׋ A(/$.!x._}Ν!,pat|a[GwOJ`<µڒ(`N1z%;gOЌZJ'V3:SL>HƬ?Ɯd  ,8<HLe P, j  $  t  & L  6 66TX](a8h9:!>@BFG(HI X@YZ0[<\]^bcjdefluvwTxyL<z<LPVƘCgvim9.1.0330150500.20.12.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.f&s390zl33MSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxs390x/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiKPt/)U C.&F,A큤f&f&f&f&f&f&f&f&f&f&f&f&f&f&f&f&f&f&f&fNlf&f&f&f&f&f&f&f&f&f&f&b21235fd2df0ac7a78c629dff13364cabb30a8c1e996a940bb8639d3cc13e670761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820107cb95d748bec136ced9f94fdd01de543cefb1f2a9888becbd60e76968598c846eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.1.0330-150500.20.12.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(s390-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2)(64bit)libc.so.6(GLIBC_2.2.1)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2)(64bit)libm.so.6(GLIBC_2.29)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libselinux.so.1()(64bit)libselinux.so.1(LIBSELINUX_1.0)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.1.0330-150500.20.12.13.0.4-14.6.0-14.0-15.2-19.1.0330-150500.20.12.1gvim8.24.14.3f$eqe]@dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.1 with patch level 0330, fixes the following problems * Fixing bsc#1220763 - vim gets Segmentation fault after updating to version 9.1.0111-150500.20.9.1 - refreshed vim-7.3-filetype_spec.patch - refreshed vim-7.3-filetype_ftl.patch - Update spec.skeleton to use autosetup in place of setup macro. - for the complete list of changes see https://github.com/vim/vim/compare/v9.1.0111...v9.1.0330- Updated to version 9.1 with patch level 0111, fixes the following security problems * Fixing bsc#1217316 (CVE-2023-48231) - VUL-0: CVE-2023-48231: vim: Use-After-Free in win_close() * Fixing bsc#1217320 (CVE-2023-48232) - VUL-0: CVE-2023-48232: vim: Floating point Exception in adjust_plines_for_skipcol() * Fixing bsc#1217321 (CVE-2023-48233) - VUL-0: CVE-2023-48233: vim: overflow with count for :s command * Fixing bsc#1217324 (CVE-2023-48234) - VUL-0: CVE-2023-48234: vim: overflow in nv_z_get_count * Fixing bsc#1217326 (CVE-2023-48235) - VUL-0: CVE-2023-48235: vim: overflow in ex address parsing * Fixing bsc#1217329 (CVE-2023-48236) - VUL-0: CVE-2023-48236: vim: overflow in get_number * Fixing bsc#1217330 (CVE-2023-48237) - VUL-0: CVE-2023-48237: vim: overflow in shift_line * Fixing bsc#1217432 (CVE-2023-48706) - VUL-0: CVE-2023-48706: vim: heap-use-after-free in ex_substitute * Fixing bsc#1219581 (CVE-2024-22667) - VUL-0: CVE-2024-22667: vim: stack-based buffer overflow in did_set_langmap function in map.c * Fixing bsc#1215005 (CVE-2023-4750) - VUL-0: CVE-2023-4750: vim: Heap use-after-free in function bt_quickfix - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.2103...v9.1.0111- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxds390zl33 1713774335  9.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:33536/SUSE_SLE-15-SP5_Update/abf4439c5c9e7f068a189fff5e613809-vim.SUSE_SLE-15-SP5_Updatedrpmxz5s390x-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0330-150500.20.12.1.s390x/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0330-150500.20.12.1.s390x/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=991cbf8e1932834564ec4feeda9c9a59a7a4f4a6, for GNU/Linux 3.2.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image++R R*RR,R(R#R"R R.RRRR RRRRRRR RR%R$RRRRRRRRRR!R+R-R)RR RRR&R'R PPP P PP PPPPPPPPPP P )buf8utf-8370bf7b330dbee8203226482b8be9e9dd4918d10b778404d13169169d79c509c?7zXZ !t/",]"k%{J #.4q #B浈&&6fP.Lܛhrm0MM]/+"I*|͝!^huBצO\!~eW26"':`\ ⓼!=F6r[¤O*.' HWH R$uEvڲМd,&l3ҳ>dpddFa5*mJ k D9S{7Vlvk8 Gn9Gyog#yDH#jp\*-_t1 ?njsj@nb*5h"$Wc|_/w W5ũmCm h%JY}X҄lϷDڀBv;$@ls Sۤ{)V|Sބ֚A3<ɮ'][ M\D vZގݩ7]:04[dm"w??=(mM-;;jn#)ۃ{Y 5I|c"cm>?z۬Ehs,NKfJh樬HGƃf'W8\1ֹT~S1Qo!3p@ Lva7fxyHű852ȕL'|s]:d)MZx=I\p^.Dh;}#r>SO? \Vk Ge_Y >p^||pT_hݯmz2N<'փJϛVqUN5(leF 结1|DwbBwc#Uy#'W .1;z3E\GV7UjQ^nb_ˋQG)nu]3毵Q왴!꛺gSf[o=5eV,{+7x/R. u,Kĵ)8qW%f:cZlHRuE~$GH*-@k1Nb,"C;Y:RИ8@f$)D@XzqnVMշk5(!CFȺ̠f؝س Hx\uD:y#skf No+ͪ@Lٺ\ T=:ުsD XCwCgrO$/a. >"j6OϔC|a5Lqa0+^~B|C0vmlS E\a?C[`Tf0mσ6wNN⛓W ʢFic ](KUq.vC|ÀWQ"r /ZTC,EP1)KMvCP(% jtM)|!<ôDgd .|f=dŋ {-rkpw%9` gٳϚ2jS)#`T\UD.lƠհg$'1Ã3Rc]Gw(,fU+p4w6<Ј.(Sq=+`hc`$]8ĊdW8RsTo-Ka]LDkYvJW]ST. QV[0 $ᮅc4Ҵ`@HۂZ%\͏HVKJ*ڑtq/>Po>m/p=n㍓YQ,x<6ΜW@%W)0|a d̃?7$qheA3p| %u¤RGZ9EXRON <yte $V6tL:WkZŊ`9%YVe?~D9wRU(li)y\S6Yu+c6s+ N<8ꎡgowܵh=y ;½MdoSTi+!^ f,򲪫Hԟzy>c?DX00қλS[osl 0s1`ɤ}YClC ?[ +S#$rkxBGgĩ[NA~suR#Hq" ҆}W+.'zdum{t:s-lO,Z$XQ ^T"MMr)IxV0ڕ>g1o1*!`G=:9sE}BL݊*N> kh;#lF'ɓ%>T`7YphFy20۴[a]͜]dnyzVC:ni]Hms]Sb:dtWnVTr͑=UG|{>n5I"*ɦ?eGQ4$Ԃ0Rh,p(#-OVMyflH=x:#yh l GQXI6$ ?+@漺HPe\#Y#c1('? V7wsWUC*p0$Xߟ zp- ΐW'\ v2N<uqfԹpD&P`&EE Q O=2pn}p“گ yhUeib4)(m >czřgQ9­G|A0 w]<7)}[CRmaްۭPX|KF^Q?jk@1m'G)Q͖F pTuЪ^e~ To'EQ5SPUfe\ ]C"ygb@c&vaJqbzݸ͛1iۺrj#޸&3BAi Y.^Q u1\1 N:e{*y| !Ȃl٫T?eDP̩"mRsܗP7r|a8o3/x{*] }'-;q/TrhӁO2#\oPD%T~[X9xבNØxӬ|&(2b Pڮ>~,rw WY^V;Uwi{6tE&pChfō >Íyt/i EtyI]774[\'~z^hzl>H/I:eF9eM7o,)c{7P}|PH=8dɩƈrATMi:/W'N%YE|њ$AȉZ) E1Qܸ(ߎ@{|ſ=h9m) HGKaà7ٮn}Hmy`?qgc7QOQVn)b&jyUxVXOԡ<$Y9膆./.4m0-L_mv0?h9.+9MHj|3o\)kD/F &*JR\˻ c#%rr͸,Rqz^/FSB%$Y<\%l'hݻZyL>hVFcue(+guCJʄ&b/8Wf%*;K25{,O!ϑF @9_YN b"q1НtW4³КOc ςި#emF9_G,tXs+?ETx5СG-˾Yh:gS/d% hj):`@),WP`4n}-Cm߫a8BwF-Nv~GudYX(V{@nE&q7"ӇOvAe{I27軜;ٔFJbг*l]TaGwHm>DZD F[Nt>\ *˻0(90hF!#w5؝#klT1cv+L{Ov : 3 H͔5tz S `%. 7::'a HnгE<%H@2wFQϳlNq!Lłj׸̴Wlv `#7xO[M2nj7w=hՊDfN%Ǥ[}~gIRAT\Q!wq`/?' )ZOúj-\JYt6'8ku~ýbg"6T؎ķXF>o#b4Eo5NƝ*NUf砷j$keBRe0)hePHˌ*F|[6WF mFx"~8]H/MD::0vɰZ#kU1jl+,UMAB:&:86UҢE!mhHnrYlk$s ~PVS]\zAt0ۄo~!~h6LRbd*G9 {Fz*h# _/ud{ѴifgRN]`*ְxgqWqYB/ ) X9 08vS$s;  sGehtV쁚}N3JbCR<6V{'ְ֪7.^xoG:SL^rL}iGf:za{'ͨyb\U6檩6#G!q+'O_,Nx}G% &h=m$s΂沱Jx859,s"aj[hIzv ʕ<ǼjlP .+W"3{;،vik> S珱:dRZ =FWg`IġĒ9ݞ>>N0lj|%K"xY?'TlY](U[ vA:_^H=!7!Hf U7{SB+`٧\հ[z*Ŵm%vsk'czPZhhe@׈`әwANQuE<7鵴|'fdkr5&-%Bߐ}3,/2g6#` ."Jc&N2qplH}:8n60ýe$i͡{c1'0Vmujl=!R ˮ&IfTY"4BD 0~KBye}E H 0Y',η]p4ID C@=hGu3L׈sIU3V* l-N)11[fTAEȎ/#5yWO5ɣij ,t>]')%X1I:euzKA NBeЎ!^"Kvɥh:e0cH EO^{]"7)jW{jr_)]/n%aI(iAk Dj/'CE<4;q~FQ~TM #kp>fpjKy(QBseV' ~s>ȠNIVnl\4z%Xv~7}OTe+9 b.q'iJaWEulY$0V ÙZyEa//iMV0B.YO5I׽JU8˰ѯUc?1@2;9@NvE_/8T'Lj *07,Kb1K>l{DU>by)EbP {3 =Qd;I#"Y?/HO \;2A2Z=.7RT`՞wR ϛQ𿦷%2Bk;,QSCEeOwA-~ `^;*mqm Fn\BsĈ[Pls1A&P@2kGxa=e.iB@B~ꂛVCY')p\ ,;2ǝo\ӄDf\`0œ#j6'Um92J_eRH8-w)S) 0ܡD}_9ZH2z.Gm&Β6E/@)wE KZQNSv\}b8I&jRB| -}j߷k7m4'@U#[0O^Cڪ7-9C)H 6L0pSrvX1 t$DjF$`Hϵ݌7:{2*0\ C/Dnp^c/b% * F3))8.R$oTb y ?xR6; DD#[*"S aMK}Ըbvd3ҙ{-~mҋkJLQU1LTa.U\c8dfVhգιXߒ!^H(Q$\ <&$w]ɏhl,prjpYBOh?g$yķۑ5ؘg8X#A-W~$_0|wD5e-s‽]ɇgf7GRcb飮7uqd¥~'W]߉G@sيHTW}T(R`TdaŭNX~yLtpxqժN]Q=t d&ט)7. RsLW ]ͤDڶx,eR;JΚvy݆ł@iW W5. Mpݔy=DCvN'Wo#ؐζf2d v9{J麊 *Yv/ڝҌe!f|.Sx";}!uWz(,N1%y*}Js0%6JAH92 E/b< `pڰM22-\G #:(˽4~Qs74xSUHK8@R+,33,u_*8~ G(0sn@s!o#ܩ}VS^?њ G;B2h" A5qdz{CV"+bJ>M8#6Vi/{IأaunV$V3_p/axx85f-3|x`a/AjV p~J|Á٥aGYҿ}g_t!B^0KFBPҗ뷠th3bqOB&Py 9׆'P=@;VU|~$*Ĕ²3T〜`$`IӁsM5p[GV|wIgbOn~*S3XJ(o٩ڳMkGszjl{eUrZ҉8C΂LǪ;% as} {NIwls>H},e]wf>V?pXp`X^ lDjI=!襴AJD{T]5kH۟2ŠunmʥhG-RTۺɒ3M).~cm>T;A]цZ.ؓ`vvKduyZLv*t. ۔#q4wW7[:֡$Gɼg3]ԑI;}(@sG@4x}wΩ.;PO̦&&L[5u!* Pñ>wiLzMxpli mqhg?fp>?}>퐹q'K]SeL!ӭ_hk"+C/e;t)Ymu3'YVt, jľ 8 &IjBd޹%\2%EE WSEP5LaJީF[e#%VLl;tY &#^}^:pzV{52 l"]_myen$ZosCb5VytذR GAgg)}1CXj1/pKǿޞLr >>yW{>Y( j.'Uq1<ې\gI&H?c k{9c79[\"^>Kھ>5sJ3ޙ82g#i:ޡ$omPȒց^*dKjs^aU]xJ%_2>.bbM~A Ǎ56-Buq9ŋ<~­^Ah֫ 4T\sA3B ɂu_?3QQݮ娗+}hx9Ntf'9Ѥ}Ko沆TS(_;g@|΍d^"0iaAFax'??q"᯷TEnb.2ٵo 5&<*. %Un4x@h{RQzp(4l&/)u3: 66Wp<;27S@77iWA@^N~2QIZ w!'8р'q8[jd̍rR>Brh8e*X v Wl 䦼$P}T0|m[^sKb\= [QrjOh%g"!'}ViݵPPE` }Ј.3 [*1 B2K2E]~;''y IWlu(oB0W4&D G 7YXǗ틤~n@@-#EHz^ ۊrf֫C-P:*ό E j2\,DdUkx<8F|40٣[cwT&(NOe{G jԈP>YA>.w jF®8)/X"?0_c[xÚ^ 8f*"o.6ECO|W #1![;p r}zO`n:3=07]2}fxFǣݙ&OWX W&y%v^,uT+芣-nxsX><( >;»fP#m֙r0ZWs㉴nRDc9_.kPo~K=O~mvd$':Ip_nD=!A>.cmpH3/żxi=<J? 3UڏI=IM+*]7V^֦ɘOCEvҤԥ$'&\:Turu_._NRIVڈ@H۱#=h6ĄۑP!2eMlo'"_mC같ZS bةYc2 vm5jbWU>λ4Z6®OKj1d?$\s#{""4kn.ϽOPfk=S^_ށn>1. DhIۻJAs>aGӀjWԢliȣ~ .`6m+>:(vbohzr KAtȢ vThü{$@Lɑq/`ݓKA(eww:w_OcC.)o&8֖4SRs2xF}/̱U?hBc5^H˗t}9,E.Ƽ~~˵V,;] k̯D/s &7i}r1O(^h,=l%@,87ǧӫ֥O`r%ip/J/k_J4qaflM,aI0V=L'(ry }YF5v[xl)f7F>rN7}p2V ÿ}hVrHgro~}p"A.uLm6 3QYp$>$Dx&UW ӸǛݗELAZŇ &zbJb'_Di -C,[#PXl{|r3j2!Ʌn2͔뫕2iAlgx.5V8__~>rEՙj UJ̐\@.6wF:$SЪU̼p=;:R6 TWnLQ2Q5p_?+ݎn0M@Ť"I 8mףؤ{KQ4.I'SUu)$s*{bmlqGY̘u~؄6`2<*""<+=ؘ~> @[cϗ#p}⣤m/ cxC!"L5?dKy;T4#'1p_?hnDzߒL_v;g|/K?! ۯa2F'Bv̙Kv?,odPn;RɅDnA 2 *6.J y¡zWJz/Ң@]$0# rg!Th8dݵ@yXFɓJVV$gɛm{lI_3%-PI. l/첔@"1bLkEOXTi&!"q8KCA1)Qթ۠ug<lLX`qYcmO17*甶 iRdS+J8]Pi]๘=MmJI}LT"0>c3(%T9Z#,90knE}K?eЍ2"B%G6+z>8տ5+{;}OttVggַ n3Qz]eZiʾo}cBҕ.Wm{AFZ01)ƕn^O^䜣g_d5^({AN& eOwH-]lq34FpV9bZ gZ] Q?DTRkpm &5(.mfX!dG- gs?s" 5e眗1tleHMŽ435 W0=ϼGo,2|. _ŖJ MҨҀ!9 M90uUr5Fz.5E*zC'֘<3l wV~5I捠 nTĮ a/ 3\XMS17$>{zi"$no óiƁF$80Bl LWuR3m$LO;wN!sm^؂zo=<#I{Z#X&ʵ;.R_Ac$FKR<:Q 2>Zܒ'@5 ,>1je{eeۺnb:UTet/WC{J}i4qNsF%0؟U wo曗e 4}2Q(#|zb1!} ̣egF}ѵ":ļY{i`SWcuVHT=4Vh`SIP qL_l{ gcZ~ĖL"oV/v#W_ YqA-8Įq߸J;H7@G,KGS.-*`F˂+%Kj[287= hID ^{ rr_ "bM X#MX}p(vj|.\ YʾMY3a5i/,g ?|pvIľ{'۾,6ًM# E)(p ӣ;Cy_7ex)yLv|DE&A'"I8|p[ge @Qh0a*ejHuRoO5CNYe(`cSDqU2 ;,IM?0XfLfe~o>'"ey ΌuImIG,5%`4|yUɇ7P#n!mWzC wq6}<&\Iɦ?A'{YuA[ٔj9Os JJ PG_\NVp +[m]ߧv7RWU\k;"[ Rrނ0PhIvE|g=+.^WcLJtx6蓙R&u"6 9u1^cJ"Q1&œ@Ro:~}Ɂ#K}_ r4<<zM@AB ̫Xuz= F|>* ]WeS|U5ma8 04[ֺVWev6 $7b\9 ܲȺ IB; *T)koέ " \0`gL]koJ|7L%u.h۠S沭$M/nD\Bp,O)mҬlma%7B z*7(dBXbgömra"72z#u_F\aЈoEuj618#FO+~J!!leyYѶ(UTz)`KK /N<$w~]6?,HҦhDcd:L z-F"4eLl |28p-ekE'>MmqxF^$XY2ɍ~WD;k,?H2‰ǣޜa47mRb%Qj:vǃ06!~0 D{FXBO<"Yv&:84o,u&Da?L{S(tGFwM#i/kW]k]ukIfO'̽c=Q60LdAPGc>+)o[;TϮ߈S pN(3V"mxZvY09eV`);dT ӽwg9[@?I6CtDu'g;)2`굒L~JT Xօ\OcW whדoŃ(iԘ׬a7 {JVmV`}?S>57'B,ZA֯Ib` XϚ۔+i3acN,r̎sH.Hi648LeB KbFq1l[z^˦2*{%oN*IxEkܜZ˱3σ7}+<$܎xB3pM2tiJB~Y `H7Bɟ\R$?[]Whj䓊Eoa_[k n؎->z+1m4._Dh\`j6Y zOS@$mUf; <$*\kkm_oRVkxjWJ+n4BD{=θg eC]&r%jK}\n4M& bSx{*5]t5zu aq*/0C⇄-u¯aقԊn!m$dɞY"PTeIq=‘w>i B\FF⅂ hpYV}TB{$ 6TS!nvY >êf- uW""+yTl2}LCަ`}i}3>J[FN[@c: nC~(Y! q7]x7YsV|TA>&u n~JJ#Hܓdк7[\kuL^ $ W&i1K TB5 F\ES&2z2fLþ"*]& nta}@Ugj;ܝ{Ӫdte bB׍<nEք`xmN4^@J50V㽷-{9kgg7/M]a7Fz%)Ů4Y F"Cc Q4LpGW>ЩtDaj|֙! 3 J30 b\o.'лWl V~a"d&;"i4iMBCo1X0kԮĂk^F(.E\r߮MW+dp=8})x m"Z}'0y`h,2R&qG~_D嘷 n׬ hg9HT *֦OqvQWgSĘr3D 1>:ئ'r@k5G,lҁ6ͭTm ftݖitx.::!Ch<Ll"9G:(fvq# ,9յo$szطe4Du¿J!bw 3[vԌB;[UPR/Sجɍ]pqW t|U0U/3l8>fB#6t'˩iTf#~R'Z)qg4ȡ&O][=}nB1C.pkW@3:qV9.weWqZ9 'Z pRԭ"^X\۶ǦfG&EqKEl44`mMۢӁ-A P%;D6+ɱscY0w-T٩!?Oice!vFCBwo' ~P5`΀s转LL"? v)mS}; {LkZ߈FW[ $憾_&H HƿUh~; _i,'a˾Ys#0u=:diVz$BI--bМTadPMG.?#`LY|IisQe ЎwKGUUn#'gk2HwQ@ߤP`azXYj2%o^ڃNsB }::㠿6niXRkc!쿫0ř|Yjجr%xkNXC‰@#vK'v[)F ".;eJgũ/>9Lg+:Z@[Tx\um"+W^ j޷5Gw-!h/,qԎbdF$Z=zb&m~[TE@X>m,'̓5}bKlSqGMT|ϧԀv1Vhtljco?}Rگ@]0w:v#D WZ9-KvޖXj$e;+MeIܯ^.I@.yx"\ZSqw;67岰=iY:5^We_rEQmA6\ +Da U^%W%*o& ykv! ܯEbEp*d5]pwЭE ݂o[YFiU\k)ɵgXj @ςV5t@CK[sURu%DJ}uFh'`#GmtJGS +Z8tj>"#夲gs]ts|X/w` 'OSFtjqjUjrQ:Ùx:%قg[xo?ep˓`!V7IhM/IiFF*.u ұiB8T"Iěs(-'i%3%1}H\M*8| (ZP1Z0AVǤ8v3%YZ6 O+Ee:T}a+B 4 \wEݮKZ 2KZ^oMh:+j#Y#zYQ=s%S5)^gAځy(H+)a~{)فH4u{!*%9bGĊ܃͈Rqz^uXS'P뢹G5Z9K}f_\S%%a+׀ M ~* 0U@Hzm+Iz5T5 42A!U?+T])썮A Nlg4;fu㴩>6 /t9t ѻ6,ߊ]JUA+UD-%nQ!R{{Oa?m!nw nT؍^oϨW>msݗKD:n' X3q~1fb`05X--y:Q2YHQtLtj̔jeFb D=b"1Ml""pF̬pmQ5zGrfRS}?%Y!/MH^JRĝ_{WM,Ƹ)ֶ<úp's[ =>n5.gͺp;nC>LFS uS+/ c>\dd2E(V:8@xKS۪^VA :جIZS$/ ,"z?"88(nRČ䜥HYnnAHդB}*0E6smn|.F%)ҢDŅKQr(U*HA}UH [b?/\X`׶dJw)AsGx=f%0^1Aa\Tw\A @.PKt!ØSA]<I!| %Lnznil򪩧x}N?ry p7+ t:TDIr 0IadbʱTk VxӤ: e2<)K c6yAV3XFcbXv훽yW!~i)H^l}[/>OB.lOS8T$> 4fcvjͫL*ŦɮbW&sUB|%ҼEhMK RMD;aN9lfHO_S(ކq[Yvʋ"BYߦs015,W`=Mlj;fUy__͞`//Fe:n3ӱ;A9+pGc#n>=dptVa`dםJ86Jʴ{D% kR {ȨLh8E w&1-LAo1+Ln%,츙lcL/< 5:(b{`>?kD'^mSFZ[;a-DM5uӗ"MƵebQTภ/xgaܵZޗq/?@?3EϋN!J\o9czy}1n4k29O>FW& մvMiU2x)FqZif*;fng,%}_óeqrgfWrH!ʂ7AИ\yir2ylNSIJ`oU2+wKLYtӦw?i}M:8T}PoYQ%jwO`1\e@4L{ (id;/#*=,̠ >w辚@2[[Gz~,8R;{HJeb3G0 >VjqFwF& <ȈEPgJ3&%oz3!,/ yP4v/ ۲ ES(Ϭ |;#{(ˤLteO;܅,jTLx ['.B9T`t.*LRL7xD[]D׶6?nՁ qA~wR"-a; A#ʍTSv}SГ8a` AjDElS0O0ъж4)1Jwn' =wGPڸHp()rs,M47flUM[ty˝8r3{(y<{)/L=w_1p*ȝڄo_{6d'MV:6m4X5"$Tډc0)A}/UՀalySxoKMZ} ytzăٜӑ&|[i^y_4𡂰 AM"0g av+cz a,4#o: `N1eԌzmM#YFۤZC<ZDKmL/cd 9W{K!bW$Nc8\ZhrCfȜnB=] ]"1 ~d sm7lwN)$WVȧmpj͚;.tT(0uR14+",Chzo(X]ȿz'%K<դ,#FLIٙGn(l1ߨq#\,Ax6Av$?|͒~|d= '$Jآx PH]ib>棰6[ ]d}GurÅK9(C:9vIV6)  S.Âم Qwd -YVN+3Kwk#OMߴrfhxxe:<[ kCD =cC]v>u%ǧ4nǥV}<9Kr@RBYZ><=WJػ٠',ijd|*e9Y&mdt aY`YS dƑYwBQvx q HWP{"5j!"RAR5Z;9~a>4q홉_ύ@^3Wi?!: %WlY1âw% 1Q:UDv 7C4ۦ,ߦqqTP+7r#Vi)JȠMԢ Է+v+ ~ bkn~\3]V5+:`! V!%f1p$(p%X>MEgKۀH~]IJ{ynW{DŽUooiIθ@n5$38.X+M4D+jVsUj:Q*QN8P?ѱ|kzڶvnMg&MloKPܷ]Rb,"U/ ⏊ahXmqx$jg#*\>pdvwBwr݁ChdÕ}};)E99ժid,QaB؈`Y{0m Px}Y)xs/*:1YF};Փ[ח|a {jhIAlDAmd-sjg{L4EV {LEhP1ӣ\obZJa]yaj.e?x?ɧzX@W~gShP3Fˁ,A&<yͶ2a%+s94p{$숾`^Nzwd.tC~OgՋ e}(n ǣ؎pI^El"ξ,nHPJWɱoI~#ˠjmD ʾ =7Q/*Ku~nZV{d"k4sJ/h7 vhR(K!$ERU1{pSuq{ #8vF 6=][t³PCd (¹QPJotOGSZƿ=[N7 m#YHNZBqJz֘w2v.aꊨk7~P_1?sz h#.J}e1 R8Sim k5dFLAѱnr)m3d^9醝qkԖ<CrۚаVHs`I$BYzhTқy,O1$m|^ݏ.aZ` ә/s !6k/R;ϔ6?eiat<Bڐ\Xw#B埔#Rw!8%LG?f؆a5ܦE[Ɂh X7 CB D RYjҕ6T=t PK+\6v"ʂI%yEK _%uLB_&K)ѝಗ9"?" G#̠銸#tr*,;&14ړ:k}o43vzaȏ}gFd/pVO%GFOD9]T8%Qv@9R$ rnT&17Fh@!#yAXoD+% |'%h oOH*xE>٤=XKI{o2ɟ\ xk֣{:5G}#}0܄T󘄥,c%Sl,J8 TXחcG1V~o vAh)CɁC[VߟZ@gOn5ha>|P۳kFgPw`& M滜@Kʻ/yI_Hϫ]zL6 -^u魓NjwaΊ8kM=C3bg=nwlO NWhԃ: \ I> "/bR@ .s@qtӵ`U݅zVB 鞫DʂJ.iBCpХ8Zz-nF?Dw-4M"R?ޞhe=\/{X@. ecLpҊݕ+}YAOj P[_!t`,9p0<=,xST@_tBfM{6.Ɨ?r}X$ -]^M2",Xm%1Ȇ ЕV*bd WWw90\L|p%7w.Z^Bmp^XUII7G/OwI%{O5ű~kUk'\TDdREON> vu ҇57FR,t K@_rAQbGGq79 GRЖ-YPlW67=3ͦ;tj8'S@:!9uCBԞdu|S3 9Pe[l}Ǣ o46r-i=0W4Xl8:MҒH]~oSzw&Ol$ I/SXuOI]+Xfg'%Tc3EREӹxݝ*8 +_XpGSnJ,pyʍVha<~<ii3f}?a\ #MՊxy:3A/*wTf97PeL z-@ M] 9EJE;I}M]}+S[1p[I@Nɪ Ύy8TAyQDO?xe\IeƒAQ̊.0SFd;M2|ߪ&jW S,` IL_@%HCh;sv3%id /au`eI6P%yجNw4o (AC[UD kKS>wA }X/M0x! A`2T@8aw2!LFbwSXsumbD/H ?Af5`Je7VbӬ)gEtۗ~U >. @ݗ8hF}ğwCdzewhYH1>=8s[片D<`L ҦeQj,F5ŢekȯB":r nӖoT_xDj`Lck8Hn+`[HyZW{-sdۇ|sLJCL99 Hlm.)=O2tǠN}mİ{+c*BKSzRVlꄙI8k鲖LJ zpɈ?t=vHTQK&,NQjݛʁb"RkQI"74ӱK 8?#Icj;-@3APY); ,8oIJӭYRג@s4͵d#VRaO=OkҋR!>s@i?߁0Mt |,8'W;oFYfz;SM}}9\{2I*.b좝ŬxNJDv { JQDd9g¯M﹑U< QeX/1i*5|\ktR!pvd`#~Wzx.)x1˖ȏK\KO|\ H){YHގZrZk9/u_e݄^(\.&-1DNF 8&'!9^>F@ W=|37ᖈM^]f|-LXY>.OrI4 \8ȉe>Z:75,hǁNV̖BG^18uY<#g`H)̇k ~٢@l|qc/![:7z`5tعѮ&zA2/=֫Z|xnO[Qŭb} @{:%c\/d״N͔>i[Wu&X.1®p'9첟"O eswdl|4sQ=Pya6P=Ι(|,%Y&œU!}0,[4NCRjT\`IJVQk IaSzD?#qfVo4,G+u 8P*G8\T7}+F[yef83@ ?Bl';=Ƌ9D},5LnOe1AC{Lsw-\=\ǥ_lZ'1fw-`CA3Jh_ur>]8" &eAٸfqY{?7&;="m ]*MX:\@Eq0IAiJa9  E̢_5tso#~ ?669,ï+Voqy5Xn6Pשׁi&M)*h5`U(΋ fGzF^1Qm6! Z;`6&ӘZ;D4BͥrV\v1;~Bɔʌa2rP?E6#tGׅCaHjoTc)ݤw–!&s7lQBz{t` \|3? 0H0ЫXDzs;[)7^T?R昩3rCڱ! _.BV%-V C$^!,Dl*N`(&)B1Ɩ\*aZ0z&N޷oNǂj.Dr4iP7Yi!`[jQCJ' R95$38JoӮheKΔ˗[G2ä]ZYM~9SEn}} z  oɸؗJEl5jbmI9jşi|eRҟrٔ;<"8FckI7ս/NC~b:i/J95LKToTθISgHyk$~,cmުd?,gޞSlY<%K0"SEʼ۪ke`2B>h| ŸT,iWE1PFқK=Mݢ߆cajlGQ6Y(bb'bOӒNdO*QR6չE /8SZ)lrs!6%j]=O16'?=_L% #\A"V"5g $*؏ѝE\޻ok_xQi\܁GJaN=8c ;/%&uEl#`j| *)K'#QIO.!P>_|z^xsӏ8<4Npm 2G_>^wwo#/K11\œ QKn/H窲Ĉh}I2X5 ;(FJE׶cը&+븈~@VK֧sh[Mq獠6skdu!Cry ]1#1$2Y [\_c"oPwo{L!h<b{ @umBs,w9+BRh* bJT1;SZEU#E&TUU)z5XEH+9Y]zH.8sK-sPӠ)a-`!,x^1FHK hFA{mWK\f S)ؕ``r|4UA @{Ҟ=$(-E.C=lj{\VaTD!O˃҇J#DD*+炥RqQTHJ»hCk">*ya0||ΧB;)XB@Q%i6%)MAEܲfQA) t(eV#PiwgA`sc!noU7@Ja j/r2NFNY#f9ћR\``c5'Ʉ&5.ҳS'8^n9aU5A /ƀ0Ev^; Gr)>Ôm2h5BmxX|,E6<-,]%ӽڮ]р_l{v0M?/ʐw\^.nǝgD8@ϚMv)ec&,^T5r}WƛOzgnNȧlk[ (ĶǷ n,N#$^ӄEmڍܰժQ4^k~Ȁ? #%c^G`r#&3!8EČ8/w䍴GfXp[=@8PBw p!sߣ1KUw2 @E7i]ԑГiZ-9\Oa auVK"AJ8en,RKtZWĖq5jQu!Un1l1je +T LD4ޛ|DeWAeSnؖoթ.[ȆRlgkrđR181"Bovڇ6ElcjNiHG)SqN)=B$I1 b#Tm` SރU-)KG 0U}`:jD`(Dn * `krhVSpQM*hl3XN:+JGbv66^ Y(TԼɬD'uMApJ'<v$R/j1YW΄ 8amR7wBѭWs ),>A\f?Gn1k-54my^knPC%ഛJ'+#Ɲt3pًx`yoI[fJ_i~or"Ok yM]9ńg Cu CA--C\e˘ȓ[_Jp.lDo &OLay) gÕ!9FX^;"w~5QQ)jvLO?65 5}dyaA56v˓ kYJ1i ikv`~\ѐ (?ZT d,g奻1 0~>bٖI2j Q閍AST%zwAKu->Z" yZ^ qߵ \m% JrW .8]7c6V>(KH E3I~*@TBo*~Pyjl*.=tK kBl,(Pª8LcUA~p.|ʀ0va@vvY{bLE3uD=ο$n =ͪF~A;լUbۓteOf`A \nmU-V }HOO|i[.y\{ujWR4ڂW0 ]U؉뉢a%_jd9u; X\bf\F/^a/ H@C@rìY$$MVǴ3ړqӰW,޲wU7*'>_z<'q'҄#O2>;S*bpZ $ 0Ҏ+DR%7Ct3FLf0Gb&a]> Νw9p $7jF/cݯVU'q_zpXbg6K2XAΧ~쪾/[= gDǚʆ\y͕6FE**mlxLnQ(_ o [Z20/K$RJ<{6q ";h %1V*xW|(?ݰwG_!y:PpRzyk93|W 3!:&,w҈mb9K+ \~sw>xQֆ3K&IJ@4|idkfA !dARm {2)F/6Sh}ݛMQ ZS*΁FpQVMC7BWa?B;`A#{-C1o،eBǦ%?2xL~S| |=u\{eOerT :~JyJn,\[+«]=uRM*ΩX-P.h'wy=s0<; a:ěDy)#5iI%lln~,sl%!MsB@ʯ hzgҥUӂn/ 4A2{E9ڛwėUѰA$@|:d:/Hy#Бz∡2v$.r y3D)Q!ўqx{L]o$? l;y'skC\̻F-` n χt5sI8CY!]7OOpU-J.$nhyVS)|Sz-zm:ޡ+4l;B=1¨/Y窃8ZDZj[>@"`@}AJ Ay':GhFɲ#Ĺs 9W b1#De{iRE⡱lYb^qϸM9{ +h7S,8tJop ?z"2EvpKnp?-GQλɳTԮ^fФL)N@4:o25b>̳r7J.㋟@̌{Q4j_Ue?s.Y7+3K|=ñZ}ARK2ʭm?1Gg@2M4,]Ej}E圸+qӤ/]p'n{OsY:$7lɺ8_EŜmZŰ4+ A}N )fv#;TKUc.76ԕ1U R;o./KV+*5e2;Ualk\ DxB̬MA2q *1=fĵĜ׆6%j $o\Uʥ8?Y;c5@įW| &İق*,jNAu1o^M`a\덇IQ9t {^\ŌMSZ7bK#9J m-=9iwxUWgP(~cꇩbn}$IvUDۍeXh-4T Z4J>,\GRM7?R.ڭl Pr-9He?|rFgiMtj~@?Ih[h$yC4=UR_gl.*^N!?\fz1]+ez ZնI$p/N@ɍ.lK8= NE !Db׎!Qq5qD3`C}V$/7.3O[N[q@N^Ĕ(.TOcWN )/ li L*8OUPpջ |vըP=`v0`AYt=j)t&D\LzS u@DhGp rCMԀ_q#ܘ#W01 'pFĚpOj,&Aޕb1tE|-4MB3r ۖmPό: ml8#9wbKwajUJl6uR(‛`֣ZB{8D fVDwBLX3Q-hڭ!},和/֤/mT6vF@ 19ԱK!G^_l4QZPjMk*2@9kRY_K0Oqe-`Ңxk7lqC㾤f\Hh/Vy:Rsx40E*F[mp)xEUJڌ$.l,oby pX\zvj@*^g8]+IDx'ʴ0,DW9-T&'pep&eT쫎3cPȑyWYZu{.zsn>RahWTJ;ym8@!b )OnLt-ro+.K4Ak=D=ͨf{- ߠaiy)4;V[L)-b`p@h[ף_#\X)6\{iIV}>n0' ns,g{,/HvnYHYs20hf79bnP\,pmH[ij -YK V Xi-Ba9YBL/8Fn'OHJ11_[W5O0OV c~{ɜҠtHChYai9҃Lt52`fijF.F?׋* 8vD:"67vyf}sxJ9^2m稌񂥦:JSY,դߡ:)),h?oۋ=Y3ם0i9_'sE2t*ˁEA|oL(e:>GHNkxO[|#IHG7t]&= (OyMs2oկd E:([Gi*)KkbP]Mb"Y_ -6jLơkK,Վ퓁5WU@^oOg3*\]*zՒ6{#r:#X-`Lda_wl= Eh $mo%B4C$OQu@6'`G*?e=9AOq5BG4:>=UZ[sc:y\00$fʲh,P0y z=w4K lqtG>ac8Z< z_ā9V 3,$F4_k0D>9Ͱ0\}d{2{O* 2M}=lB^5Re7m^+R/3mHlPƓ5ڔ+Ja y9؎j"X -~OZ8_I!Di׉X~?T} th_9IsSTE)Z{ -OE#}ԉP 6˒ DOMghrzCh}7`bD_熵L,eZQ!CBPV?tk"Zdrvs\xB4 #c΍-aԯ%-6״~d~%ixg}E/$ z|C.WF3Yd<*G9" 8 7j^+?~ĔC Us2fn,KLnĻ/|}" %B\mMHqU0.98YS⺆efA}NM^}~'Sw$l"8&ĥ"뗦Oc|>rDL1LCԨs(!WHz2CN gx;{+Ñ5&$\5,ߴ}pT-Z E$Dx! !0}{wQPKR8WAYbɈ` vWVX4R~[wmR,"EqD2]t*uP0$kTN*eGO6irW>(kL`|ZLp~4SҒg²segV]vQ~Oˀ(P/Dv9~ poJT-["fw"r-_ޚ?10֌x$S W{sʌq:zR]JL`LKV]<\ǯ!jhGίi^{ӷ{a䫘PeNWnTSGHB@=6 bd+rTUNXGKighYh={>1MȤ;f8[l߆!HQH|N:Wu.L%懙ץ @iM# J-Q_ N]\<ٓ[( luo VHd (,~FU LMY0~Q!~_Ƹ/ti Ȋ-'%rWM"O!O(xuQ-((H߅'@g6o6\a/^EEPԍ9a%t.m$a'z]甚<}|@c{k0Qv Wp+j 凼d0Xn%Ql*kG܍O\#0V( a:Y3`b.E 6".1ntd?k,16҈ }9:5]_ڜMd6%XzY('UehY2)u3X)[#KDؗ3IhXO$%/.J`[(NV'טxbE58Md'78Эd7 Cҭ@zj#vNN %لĪ*!8ܙu"Yc_&Fqc^->3Z{F }j׶lwZk6Ji˸e2KA~%y+{ OׅKh%@f>N5`06Dq&}~8 zXD13&pCE4}=,l>-6/{UBVnjC0䎖Sؒkߘ厧"AAʴ6U3 Ho6 RJ_ gv%zRmKZ5:CJج=OYdU[@7|4uP}Ȱֺ}c59o>e6U )N#+(jVI.]qo|՗m!o:O ڏph9l+_@T^gl,؅v-3/!yܨ!f2u2Fsi S=M4Y$ӶHCCGvnDd'nBeLXw&SwPgT+Ul^vTFI Z-K\(126rEU]]^_z! m!i~m|VR/ _\8";аn*b k@8yjSr M7ApڪyxZ4e}()TfO炑psZj*F ͣ N}jw* * >'+|`F\09ˋ5s%'zԖYz\4ڄk "'jm n~MG/E/nݗwR!0xWcՠ4κ9TL+cYe@+2Ż lFT U#NӤEk }O;4RbW5$CH_J,/JG `8g$H[,)劃 /_nclbK7_A+[#BYMoű?ٕRBMYNڮ ꐍ CAX\oʘNxkp9]B/P^ 3)>~.xB#pSsJ2f{ N} b\wN/Մ<#Obx2m=.Lrj?lz+kA{ˇ7uJ+HhyxEŧANwv1ez{rqanh@2%М{kK;F789$"ȱp76w8ѥzBJ_ "aDEs0eBi~j`d} A(hUT,Öj+\Z, Ɂe25R IWHCCrG.^I}v.ӥ&IxX: O vXaG%3&NeW#_\CtQy?QCb B!G>{ñàfqzn-q2Nž49Q#Ei"v:D2^t.Shwf^iƒ-fFk7*|+K*v9WDq:lz?0)JHYso´'_O)8o b*V8AǼϭp(fs~O!͌zJNJ&ݧGP]Ua%]gV EE\jLYB&)By^ L#Yw`Qmvj vmwxP`_|}n0kKc'@\1}1x  pONg U/tN8(y=!2Ouq<ϞQjiN9ܾ}xf*Jx#+ B׻L|Ri?uK Er y&[u?y6\)zeu%="MʓIe&bQ\и0iJ0IiFXKm\Cr0|F|^RGRr#]{ˡ6ϚJp<IDq6zV7 ƖL5ko1FYLu*B(C̶CE- ' {ƃ3jeN`{5 )#2\\ ' =9,z bsǞnj7 ^doW bz0yWT6&8{$8`m!q}nuȱ*t.5E}mCc'3y`'}<> d>5$e i9Pq$2Q,6]X#!RK'DjLRjXXa5I )j]= 5Z--|Qy<|a[~ F7swd4> )e )*n*SL<2:t{d"H]t\;,4N\՛ͫccE;Qx ڨz_`.L!0iC<|>m6PJ rz; "#OǭcHlXjL`jtN5Aq\DYq~D`HD%F&O#$ܠ 漅2VMP] DqgW$Kt A|VZ2U>JyP+aѬ[R}e%B#i|8gx[%VmgB/AN+grb+~{JiH^V3 )K:\Ԫ>uRo54ԲШ#Sx/"k.A][o,,LXϟ!d eE E}aeh8DuG`"ӐQX@! n+xL)ͤ+Un*ټ2 [? [v0,r>G` HITˏ,`ۺV/S/b8XT-ysZw۾R׋YYnzm>,t; n`W$ҥj",μ"jTYK+ߝ2?hW%&{X#6iov{}㧌#E9 'зwWe&|H9_>!UE&DåTmmnlhw+Hm5y@Y|kӠ$pr 7Ͳa Ca| TO)ga`ZgF{NoYZ(/YU+]cd.?v)Rg ;f[/Da`ݭS&f,Cn/b؛o#lL{Pލ|˂M *8; 'O,umD\a wNrfd]R?da((PVMD;1Ʋ I8;Jhs):Tm: 쀼F1d/6{y4%cM?^>{jNuSKfT-W)US"z;_Bl~k"wy["rMf TO5?UZAU[1V"A9}xG і;1S"n.0{R|P0bIdl$o[ godӭvKư<UqUi)s~27v\ArOGE (#ExHO;d,TtiT. Nczs̘Rxf ǭ1 {Pc3KCÆ~"!.}d3V_o]tPYx$k!W,RkuJini+bmy&HSpp0PTϚ[K(K/?,l ;Jymt ?t`y4 "S' R7mM dInlDU8z'FIJ*װnҴa}s B Wa>cE~+ww`gZldR^&uPx?-:6VL4H eM_wGOvs$ndZG'\M1V>C^V Kʩ*LОt"ZRdLuN te $ߜm\@ak3- jX<5CՕU+ q3=}>-S]7K2ѕVeO~ko Y9p,O/ ̳~ǍJs/4Xf1`'i I>& ~_N5fT1 q&2 GTq„ ?=,^kXo,J~Ͱ;t)zP2wG+@84 E#[^pw,luvg}uI8SzQjL|3F"?c B f  Ɵ у3oD!d$@GZZz4 #/"R._ FQ/I.`\H1:A[YKD+nZOF=;>*l$)y¤4wU)e }=/$qCWJ< RunealwiP<o󘺾7@ ͩ^++A5wlޒ.diTR] e ߔsNZn[=|ko-rTsI3${C Em-9藔'ʗ d1 w],[8 (D14l$@κ 9畖W됎s劫Sd,f dڨג.n'䡽I{COCm 48i5#"yM"HڋR3^yLw BtrÕN 4JqٝS)cCxẈuTha,ٺy8ͻy^ p.n$Z=7T P8lZB;k '^z{X 2a" 'OQIQ@f빆VaEWpGrFi!6O`.| `tkuO4Mz/qWbom2t@Bgɛs}ܯFX:3HK9ܬsҀLM pR`nRƏL2nY,UUh~&qWߞ zqH[S/'_:c%ߢ>o ߆W\C dD 2(,/OjAc'mMQU<ȍpZt]k q/hFdIZаDWK)tI|ܻs޳Ώ^J@ms(ɲl*:v9+ceF4s>}LtA\T< br(%_>JOr08#9c" V^z]}?'h_xP0V 8&4IK؎rHǂ7>j9mB\1Fx*nhx0EG/HVHh9I0# [ClPR&X ͳaUtaqG+ IC(#Fu)kp4V(bmR,K18>a%KT 2haC({nbD=^# gs;} B%2>YPK]J݂c@6?$β|Ȇd<#\Ծ +tr %Zt /$r9c4[-i571)fnQȿkfN<\/EH3X,=K lŐg!Y8R@(&=c.UKP=+yF~ IB. }K/.f0Us R1u}!y|#04uтnbx8}z"_>R1WZUvB|M#dxAK OCq T$AM^&fߐJa=y6tx>QH-wg1ii=dKr0_3w|\iGP_#B.0ÿZ-3g. JC2Z &%h3ggT`ߴCIlaZ(]8Al11s-^ɝ0ܰ:U,WhԊ5yKC=2XEX"@YZ؁jN)zFڽREX'/L"âAlo9l1;a3:Txlo~jmKG~D{Y\9{wE~Y(tz=_-_I3*p_A|'$`E~p$5r;8b4vs[Q#j*O9%aDN(D |B:dX9i!CRhD8#:>=W'#+} OCNƤCkwNK\mg@SӨRcG^y*K Ѩg0ЭG@{6$,CT>,P\4/E{}9-r XJ`7*Zӟ&GG%P;*ha)³gJc(vpZЍhͺvᘢl UqX \߫]s&Ҧ /E9aZhC{?gWIhP,Uu;p(42~>ee_Cjf%a޽@,n&lXK[)ERؕצ>_Mǚ6hz9n\ H!SKL@GhȔ1<]B(vgg {ZIJrV|R"Z[p\t- ĵJZRnj Kk }jZHC)2ie7Xi7 <@c!`IOq2 v'DԄ%D%1Le529f[PϤժvW63!QwmBHH"(]xMF'.WOkc z 9H_S8" 9L` ^P,ɷFO^` y$GA:TAc=E_ΰn][a]WWyʲ'|K;GFl\ So)o߰ r{0I;Z[X@aWsLχ坺} :"W8bOM|>/? %9|Z9b$%ք%" m+O{sG%ClHBˈܘuG=/n$'.ɡ#qB\zltդj0+%۔uS bٵ57S@:o .FIiL͐?ťCdO$ |jCx7U+)ggP`mf"8S M=J?p&7gZ]`42ۑ%Puhkۛk1>}&;#N;ɉy|i}Ҭ6,Ai|jLBZX_>1rȹ5'!IsE~ǣ5nTso@ З"N.}wg_À=]":t=/̖3Kp3'#hƆP.:!oz˶P%;VZ9nPҠ D #ZvώGne ;665bicԻyqA]T~YܚCTa[`ʂ\Dh)|ZC>;|oHM;+}8!Rhr?,[>%i&lԶה'^Kk{!\MgbdT~y|6܊ܠk7U's9Շi0ņzSDSS(zH CRf9)у9,slQv|@JT S-й|8s: <&j']qgQtEFKz|~q_ w^e( c3)pUb"ʾ*:1AeQD/T *XA<6[]Lx vےOSSGmzk}IDjf|L> QvX{"WU:4rS]">H{Vc%u*AMa}gˈk싙QvԗvUИ QOW[:Ș؎w\Dν%;'STd޲1hCBEU'9IV+rpHa&`u8d:h+rtd$H)~-(ʼ9p91W9{qfн&7K:Obw] 9 :E*::[mZBwR瞜x+%Q0`b]Ÿקx3]&w3iK+LEu@< fCeRv˗1w7j 3BX`} bԻ \kIì0*;QS e˥ԫ(]efK۴nCG\&2?0ŠnՉN~ezHuPAH_\~>JYU4Y{(E+;َڹ7$s̢5jqvzNV㚤%_@O aMI2B | ʯ^, B rw @|t|~6lgF_LS7ֹ>:O rJ~PzeCO=n= :s0jqfB #dBJDn%ɹSѫ0$(Aڥ-tN ZDKS6r NlkjٳyÐrp] N=se]| ZzPYqGQ;k)XOpÐY&6ׁ5O[uEY`̺Gu:N@ZGd~L&Kq b yH|! konߐEZ,Y@VIKiVN^:ˣŢ\&ɃvPP $Q hv4% lx瀘krUDv>\t9Q~Dl~!W<_!)K *RK@)؉MN')iA?pvX=G0Q+|m`8F>r q1%orf7%yo̽*҂SWo۽7 yW"qgM*M+sLۚS$jуkWx HL~ج'b>TL&QV HXHCPMBJaMRZӗe^҄T)!ʪ,G6.ov+BYF+OXFJhФ`x;3TLQ?J$2:CuOܫ=7$ AWvn{) S}lj/4Lk\!\ >&l}]bî2=Wj<9cN@x~6=߂|M9p^c )Z.B/myl#*Tt]c)$o[ %?KT~u}s/B; vtrnu -|t2fkGu  pE#]c?wa n}Q 02uzێi `8eH'#+JmB daaA]>6NHv VSK?r̆zS1ۮ]N⨿0Lz!< *Ũ)]*fl>1_ЦlmR_1w:Xۂ#V 舉WßStJgj9{Tuj%o&l%Ef |xR 5y-SR$h-KS(e!m`1[l1ҹݵި<3+28%G2l"m@ؓ{6|8ڍx-jX=^-"%b.v-zo2`8 zeYG(V(.92hC+6*PCnyg kUa?=V?x+W*lYM4m,^2\3pWW|;WNpQG#H'4һVyav7?D=sB{a(8%"s/aQ',>.b<ҾX{Nu!.1Gަiݤ/6Eݞ{&MF)YBp?;ZXa+Gf uچv{iҠsKQ$ B@f3ܪpб?xXN/h@Nge=ꐡ`B#I \xgxe*bi[H3xAInU m1$PUՁB:]¦x,0oI"G7l2\PP}H#`#}K [BGRTLEK3Hvw}AabNGSc-0뢝@qcΎKB1# ($gO溪מn1[4!{Ze#]8e< UF/Ff.A(p 1HXj.Q˫5_T~AE8OYw ysJ8n,SsZ}ta*w_25xWUD(,A+ !vqZ" {/_x)j`0\H{l`cGjOX Q»\o!VXjYvTmğL-ESXʥmȏ#HO8X\*6[=%kH+KܹU}}w곾4_y$2uP2HC-QƄlbWy\8'}4qE~0d,&Ս5pZPY/һrm\eJ ,,ƠSqS)`0r E: ږhӃ`k8N;Yzx{ڨjM߯-*lGx|>2j-sQ_p-pɕRc> \V._MJ #?hjAr <׳[V{8a.[y.ů#ڷ SÜiNaD)c4uN}fBeӉac=%3ueCodqL!,5Ьߜ@NgU 3dDdq;R]H]L(K~*:rѪn,$t\.ٔ8ذ="6F)XGl /Qv`#! W}uM*~bfއ%-)C/i4"qr :.OdO CO-h/*p0Eu``%ѭ,<&{UaKRAd 1?3ff1pw={+I3K(X?r~8FٳzTz[`:6$lJ " , Dl-"3@pN"_&Ovr9'ިC_m1c*f`M*cP,'p NN:oʰPuU1*MKw:NEH!;$pּvTewhvRO w*Q@Fj~&ĐmNqD68^<V5Ż40%Vܹl|8)w(c` Ec4CfCK\^א%L0!qQґ t/x=p7y\OC귾MAәOHG t׏\4Ű,pms.o|#trg9Z9i:t,);9sj]%bseTC1 ,]L9 I<kQZjФj0 0@4lpաy9lh~ڐA1:519jU/&v3*:W4gok(EjC "En] nS 8/eG95G.D+ dU'T0XAhԁ=)$`5TMoƁKV ͑&Uo}5ĘTdFΦ:DG1QHbD`4Y]M$3+'84"'"k]OV7Pʡ, <9[ש&ࣩ$]s#tE"ꩀ@wрIýR7U.y"3g}9nΆq͞WOԒps䛦E&j~(v9^~ȧV☏n;PbLщ~ұS.';_'Xk<< y pV–^ _ F=/x }wc;,U:yA&f !҉XdR:1rcR#1WLJr6~u "j<%vG8@1t;ņ ZUػ:X!hvkg*Oɽ 5Yn8nzsLFl37/|4y Ǥ>\.;`mbG_oamNm/:EBnX7H4mC ݎ ێ=5 ~σw7ηyLLv;שFI%Ӯҝ"4,ĥbxe2)wH^]q#ffc2j錂SDyc1EJrISˬy2m YF ,\141'6d2e.1ni5mcxc` gcֆ9_mH$ U$z>_t iHW]!?ieuX}i2WcHȡfwȒO9vqowf%t3lJAJaw Y3ZB6ЯzB s 2؂)٭7l:/thIJ-ilad-p DDvGE9& ЦXC>[@_~/h?1K8GɦՙG<)3/5qV  $W1ݷRBIRCBr+z͏1;wڈbX;ϸ2Iՠ^o+~ƦQo1>u`.=ɼYsy_5uM奛G'T'%dYioσv!=q p&TsNu ^1-OoC #/4Ū9qƒ8.Ůn 6;4J7?c}\XG HB!QaaYū"&Nd @l(VG 1)8@l1Y+jfŸDqQpΛcV<*B`=঑9B1 CJ8v.e$Im$= Ő@02P{&VZG6Sf {Vc|Rn^8\QGm5+[2y7&+t *,zaPdej =[f1I=GCUY| 0R$pD&CQ_-0 4A@+;}@W׵R6kd$+\L址V︕!g/;@T'^ͳ=]~\Vhm쌳|z|Zc~c`P!+ua ~YHUwAס_L UQuե3>CI:?֧3| =L:n=alp6gUk?I  sLBr_-.v<+Uc7'VY[ӚGpbXD ~\O#/^:Z"֊A$Ђ1p:pZ|s8{^!q-# sPitA-P:N/gCa<(6V3f՘;^/[MQ;);tdԠ! 0L$Q a_ ټ06)-q 7h32{/?|%8u@̅. L We8Y꤭3 f)R]Քk6kV"/w2]6>2ilŗT;o7֐lܰ0_3ujNg{+yx6,nK$cc$Wyg@ ccWέH'(,}U*^$nwMmx7K8S8OSLG?(AhT2$ׇ_Kz at:RItdSj_}C)sqH[m%@^ID3^d؇Q ~~h 3-),%Cot{XC7MN>\3Als}fWo D5?[|عl)˨_ Tai{LEgY7wEΪ_ć}l[2TsZ5 2@¨ eSg(i PMov~jZo`_%W/2$@1}%=xoL ~?AKmE0e+0P% 0& ]."^F#.f֥QSj^j}Wh{USI{Ș:+a2UAl ,܋lctB YYC7[Q%;]L"Z$dFpS3*xFEn:&!YޥZ4U +LB&0"KerP(Ǖ*3ŒuX֊.HK9 ` l_gchxj4N 6RIBNrB(g&O q#S=HE!n 2ʡk5%@Ag_orѩIu.*@v,@2 kNZQzFJPrU宇 z+:s'VvOLn'P`3`ODžDXq h)fc* !XJB4ȓ&xvaSVY!WtYI`E0PNH@HÔrR, `h)V2OjUEwEJK,=N 9=t`}yNfI(e<8R ),W*l4BWV8U0 J]j a$C@;0#@EFyPЈMx)Z ۍF$NuGM#vb)9K9Ծkf[cE4 0DLUR>TP{1Q* ΥJ-[uŚJ촛 lF]W^5]XյPNVU4QLtOe8*d`RAT9UoJO!eHEbHy'M¤dM})z&O7z5Z z_,~`ʞG_EVYQ{F, 0b<`,Im5P[Rqb-h qx4P<PS `^Q}kkr0+|N&Bd%y#Vz"ݳ[h$8S%q&NlE #7Fn(1h$`Su`EIruP= EΞ1Bᘁ8p LeqEMx,Y*"ӨCSm3ji{+L]f캆BW'F A_}L:wE^Fsg1Rr$ "L;:$"S᪁H=e k>,b3˞87eg-ű!%ڏ-H\#=1BH\tҙřyyY鮊0l, 6` M5.۩;%fep 5ɪ4 @@ [/f (8Vth,SIg|dl4țPsC*[zy b9.{tB@rcs+bhZr\I1.Q@d紿#^E'/M.Č у83_CNzs75oZWtD%G0FٻV%e\C˨Ani CIjӏ˳Q1*1^3)~J)Sx4%~^Np=۟u0:S[3j>ZTzL/.k;R´6\:n<SX@񬆣Ps~e?D߫)--R3:Nycʃ5gjw$%MOb4.ãOP@mc^YL7N ) ׿~zaNr,Qe9*rc'C}eS/}A7`%<:fqD`_}kr2 ;a˷,4yku͔*YuKH!=t В70 q"n Ѿ3F8_y`^'9V!G"1D5Z툨a@_;v,jnkFk~ɮP}8c6V!ؼI]ŪV;5xݣ:Ap͔oaQҐ;׻ +/mHǟt-)8(@ZMȱPP,Z@1E4G ԷI2Ta)P#;FSPNHpS P#{]F9e*M:(8U#J5g h x;DZ֠CK<¯O :peDFA#a!vSAfC-j{CuF;-34Y{os:q9D2sن<`ٱg~N38e㠩 v O4(,bшez%n1=`uSK;T.8NZP+`/]u˄rQ6}9[Jm:B"DH""^H <ϸ^ VYrzYww $:A3ݾ~%pjh?=`6Yx\|)L(ΑF'JF[ ҵ5Yթ>@$&DX+=-d:.'ϝM, q?ۨHnM{l&|y'^2!t Qh#W=1=\hvhA@!e^8`~C?bxì}(XBA!@{1W!{OlY68IAa0B?O++.R}z_7hF[y`}-G^ĶQ~A?濡-~~9!eD"&R2O&,@-<8`f,1/O̾G>,2y a9ԂpW!jHYc #.xB#udάX領.a@Nl} hD%l.gCݸb €%*S6 ,{ӕ-_JyP.7aDsxhuNtǖ l Ѕ-s>R\pP1 qmϸfC8 ,S%/- &ໍB:yt'G}0 ,OV(ah޿ȐՅمV\PV%K)[kIYx޳i!!.nYqs} uhr2T_2Usp덙BIX"v{du)^wnИ5hJKϬ̠ ;hyd60PF|-ɟv?š-WiW5|f̆+ZB׹E_y쾤74\;S2p31/!xy - ;=8d:w63} 1Ӱ.0<ڱiQ$ԫ 4p&lw"wfPj{#b63t~c};ręԖzr=c^lcYm'8Lc5 jгjqf84d^&&˿ahùW0?})a.*ee(u+D*0~ɁH*[t͔apM#P6:jJu= 'SnW"WE9mpBPN[Gs/:JhM:YTOe"`߃>@UM|X'ѨH3@ Qg^6*+$xp橏Em@ -f“m_5ccx5Nz%At* ZN!g>U1Tk<{?G$ wk U]PQ80NusY6^nSv#c$VjrK]r JGgu,E<a6I C̫G-^vi a! :R@W#[?^=z߯ q}yٜJs䅌`$fs-FNv Xo`Q*o٦%`+%"jD=Lu"l`DDDlތڕ +`9r28viO>c ܽkiY7 țJ*RctX\>O[ c^MhӲ"0&6Ӌ/.twDvk;.'<),?mRG$cUlCZDCT°ƴ 7B4i0u蘖I%bb+Vۉ|,a-'Q#m;d+ieN-MeӍV3qSJ>|L`E<(<x;)E{ed>کYÖ#tt  k(Cz~9J~Ѓ)d[l (C+8?z[ႳhUtU]Gם z*0}vzxOrx(AwZ@ @ӰV6QLsYވ Hmح=Za:``_xD +֏,X+VhFy5HџLv%RgdeQ8>f@0~Qf*pq&?ahѩ}Lΐ3@ճ3 S"ƇK"9Զ/sDo8ދ}AZGzmlk<pouG%/pYW6b#BRtw&p"3'"XI.{h5@m#xb_H'+{8wAL 05LfivhE ͘㻌Z9 ngNwy}^1C8]ԟ-}jv>Kd1GID\cgXΙnBf8Iln,6 9oN3b .ՍlE83\!@d@6w e>;_f^ZX^g^|Aɴmd;pR7[mrl0xʹ4IM;x 6y2r88i?(~Y0֠?GHxǨ-3uT+I|Owcˡs{cz.կ_E Hˏ`4YS@Bk;\;niCnm]6q~T~(i|Ebg/4 ~wd8no)a2J#ע# 7c&ުE\WO:/)"٬i1 v#'@G ʞ>41 45qSw3n0Cǻq6`TZCN hěFk$7B#nGb0弜:^(޽\Ţ hމ@k^u"yc@i fUiD`f2ơ@2 3j#.] yZ^3QžYwh}"o?M9 zW`=l:4k[F#xѱ Ç{Z'G_<.H6-ѫkBX-fgۀܢ Mp\/{#)0H5 4_Uvn4/rj?ML`y41BzWUχp <5 pQSw}.sB::|,k谆R3aӺc7Cֈ/p-Neg`RǪI~H2N.UL@VT~'-gFx% ;# uH_OP"9 A4@AKjC>yDI32"xK8#A~<|ʄQrN}-1QM}o89t>TKEᲸ/Vsm.S3QYƹ51$xRfOGIyZn w]/0X`m`!ءӂ0< hdž0R>P{;I:fMY a#+`R}H;2]y4tCuRYf j>'_bxu) Jz~YZ:q:ZsI﯎Gr )S[1ؤ3|-9W#394 wߕ|R4ޏQ+ӾuN{RnHv]N1>_'j ʭ2u$2wsKjܒ0s0x 7pd3!a~)^y=<ɫN4-lgZԑ[V4xb"&Z$Ծ%L>Heˆ@ޓ-58koZ}2?ʲ= Ψܱ2w3ޒM֮:݊K१]%/j*N:ߧ5uù)~%K7Xq7?iNjgN_nX:(Z!{ItAUq:ΣNU{UOs-~}_,3*:'o({CYŮ[SlP]ͧne;sʪpKk8MCREbvf|vRo !yUr٧>aGJڭ.6k0 O9]dg??Ȥj}m%Iò$֍}L+ P:s9=?`8~ߟjZ>'?\WJ`Wz>ْ;]Z}mfIjvis``V4WU.z`5$ySQdA+ :ˮ9?3t ׏B]4pԽtufݥ׿t<~d֯}6وu{N!}tsxӬtpmB2ߑUM H5<{r]tVhYP`%?7pGDȿXBs"S]T>@Y~ç)$% Ns=3yZĖn aQй]Ok׃MպmkM8s{r<׼Xu5_Qv {_T~~ F/7֡'F񗎴lIbs;mu@9MISUSvrܵ}Jfx0F~j[, 5l6 98_ފlҡcWC^0ݺRh ׾ϛ3+}TBrz#qNW$  r$a7X1~c/?wzl-nݔ?'<hLG>Y4ĿBB=Aީ-iXOॹ.~n[[uG~l$]e<5J$$MogDjD0en*e|I'~ Gyb9:_ZHB0"p~CO}Lə\lXuΏvNڶ n{e8?+Ăn2E{Pք8/]ҝ.|\]8Q+֎bMޖ%jho2ZL T| ܍Mȫ.q58&c'=b?B88AiɈCs* W`7gi5dZ!A"@ BpLILUwYF~l~6%.8J( b88͘X8} Q#'NCcҚ MAX1T`ا. ,b@#@fż:mOj[n?T(pd !JiS:zӄ#=J^ B3 '+DV^ݭy/+֕fȹQ4j/mf8hk]Xl0֓! e{O䍟FɱAcDMX>OytEh ڂ vnb,K41B<^ܱӲ"A]:! KqA~Bv! +7O?\qZ&ا<2ުJ[-J~@d#"mMUeo(b#B @[L[礆Pxa:$A^ɻ: kCJI0 n!ШjkgkC! 枻`y>:^7݃AʾKZfM}jl]dB%hH2XiZHh c #QlkL)/K8U84CmgEq;5Wv T7e1bhoOr*Q*(Oh kzzTiw%nz`S8w"ʯfg|!J#(<7^yƛoap{!(ONJʝfKOu>ZSt.C L6z>NaYdF7Ru`. L #\%Lvӓtދֈazr DDp wG9Dkگ5)O%H*gJ8iu +Pܡ,gXzpJ]́Pr㍼c.ӀshB?5SM׮[xP l:K񄄞yͶsNcj {zs5~.u sU.\˖J^izA4ˀ"nwє;ꥶfڞل缝oCe7u/ܤкqfL|Vhdk|c R6qf!O@T؁U*Er1L $4l|Ӫ7[GNէm|"` ԴSy!:;Fy,ٝTlO,!cFP%C*E6ۺn < BQebJ[nTԜ~TpU Jlmw+kS"}WȄI@(c1]YQryB(n _ϦR,}6C[AMeD8AQsBHTWaK O@!}&mr,[-((=y$YxE+ߙfd'8ZݚYmkpe04N ifYxkD$vQCf_|{E^Ge}!Ն`RqBXڛ)s4VFώ^G60ؖݤP"A; N[ApEv/ȸ.|=(\ 3C_{3n !mxo!5cqx7C_6/@8[KQʍ*!BC5uw@7DU(q̸Co'nnA% /* <ǁ1P4QDՔ1⫙G)x(]R<m2%ǎ,D/VxIڗqn.buj/Gaۺ fvDKa6 _XI 6dUpib3gQ_N4Ö)T%sd1" W=&sEf06]Y 6q;ݟ0 :@GAW;#xi,г8tzTw=e{Ðͱe3ah_3),ǐ.`~ @=+&#JkG=>_| P=#FʑeW[VVΰ#șf$m [7өӮvW+WlLPKPiP̂B0JGi 5v#هmpVVZ !TC~8طXB\Հm^u]\| \JRGq:azQ?&N<ԷI}5H]r7́5f:uoΡ⼗~"2=u^wkA%_:Hh4T: 4ʀF,W=V^-JS;-Pj uiŚfNifyy< :_+~ քn!.UyCQ+zTH^|c;ئ5DtTqr'䨳= }Dȸ9[^&' 75UHn#KY:>10![(GN:a9@Lp5p*zMpnu6C5ݭ?cpA]NN˃*^J0?A_7ue[y-Ԝ[Ai^ E\["&r%<(TkP `1譸VR C0w[ MN`p<0螐g-W.+hf^f;irndWmćBH޷b5$[''uvذ{>=G!=%C2ks8B26,e۲9[pjֶȝRLIeMNöE)1x2QPˏ X,S-"HpDӎ*Nz%9"4hM5'u%Z$NзyJktґ%/R.30-l 1m`謪 ] D"axgV{o['1^怣HDrPV .8Ä D!_SqiouEc}00NDF S,OЍKiW8ܵA'ގ͕C41o=E8y4!=~t^ALANBZ<0i{idR#zQloD*Jň3 r{m\.IJ[~B#_{#H !'` ^e bCl/`֝G>} ׄlyv7C(} C/O4XBEm7bFe!J1:%3PpQl7K l] -B/ݴ nq4q+ luB6(N3K+H.|^,72xH󑤝~FB}߭|Hf9o=G;+GkV:wTQ&m/.aFТr s훡wl=Lro%-6 W.Bsr8yIaEW$w>CȊhz[|!E]`>TEEgNxKC=eYWA!AMjTfxuzh|~{ :x!d0ҥaIsҲA4%Vhs=Izus\jm z:㾫k<2ʸb߉]|@g΅0)4g__p LǛ«J"Ҍ\Ca7mЊCOFʥo` *}SiV!GM͢>-RKl_g1Y̱qݍi +mDⳫh݇ ؑmb l3j >Ls/\zrK< %pP H%Vyf@\R-aOa34a?qL@ h V$Ϭj Ů*m-b v%f)Si^HI0s1Dp]l1F5+u[2zRMuL>+9wzQDIõT#<(_1gjഢU4/NE-'g@Hyl\}.uIrCQP2n'wkx\C ]".'(*Be|hX;#=x'F,l%C<y gi-^B{lp&( 19lde99)0+ 4ȸF|0u4X [-{\D% R9K7R ao05ݷ1l  n\oKy6#a ray=3Io"#> WPp\d`bx5 0iB$3Ht+ kiiQfN;K0O&eq^:\E57˭qyf~p%ٕrUNÒmL"~IrcMP_ b EN5#u:fGYLZWinp"J_T1jVvt|[KsjFțF8:4ض7>#eMVD "KIm& Axka<rXͪO0^E6V1jB~_i*VI=$e5O<3*zlYc;;Jl6Ja fFoe¦ew/,Vn d" 2bK#ciP2t@ VbL  H78KO=nOɿ EGF .֦S bc0)jCӷT0E<8~@CPp*6E0 Ѕ˔Ys<̇ 8V AH6d"(ἪSJ M~#*q(YIOktP Zw#8e^c3"]v$D `.TVąJ ޏ&Xib %PtuL]1"m^ ^>@sۖXAcEn_"Ro,xhP1=OCp.4kiCkGQo(ꮱQl~J\l,ygG.IfYŭF S,EAnc 9R'R%, Z7Y,A㖝l{sNŬvkStdr zbshv$zopקM7d֏eM#%q0:=ysϸTFw/{Lҍ~)i#H]BŦhVh`bBI#Hǎ+6F#m?ȯw޾9ǠerH9):8HvRrD !T]6HcNjW[Uh(] p]-̫VW[)4cXhmrq-!cb̗oB,K η]\Mz=YQ{nC fhEΦGBzbyˉ(q<6)9~O7 /Ԅ.~y5)7~l B ںژ惀+#%'vBz(tkՃu7U'1:\cv1xq]!zOh>L=։ 3fivW !9VM"M4B@8TQ\-9?oPA_N*oMQ:𞂷I8@F-Yǟ_e|2Z%% EGѲ<6#{rO($_Ofv-p.xِB#؄%)ڥ;ʞP»N./2&G%e\ebd}:Dv'^}eOg2ΌM^rہ`]:XU^IxwWmW\ -A a _k29 ɦ~tPf;OJ3\ΚעdZ,*l"2}ѓQ>B r9kݻo@!AnS睸X8:qTR3T8+f+~iOW==i7֤L2`zk0XO;`@Дўs00"YuAPJ VHl{tr,5*|[}1&AY#ג8 Oӟ{ {P.r/Yh'Jٹsf'q&/Ex~LH }W᳂|bS`m_NhƊޤ_|p!H0JbQD+%G2n,@ tȨ\4LFC+Qk@\@?X" 3_A RXD߻{ud}zH //ћBԉOFkgp ೹k8B ((!6 hr=sń Cx(wzQ@R|3]n{XS^@M(V\7)m: [WԼZ&hw9wi ˗9փvfط^{絯FfҦXLK]bGdYT /5Wy:r*JT`IJ?z`*Q(F(P]Ckv; } #mCՎYaZJWPxrg/~ Зfp[4jpxv_|>3e$ n'.xM-@atFbNw1AAϲޏ/Lf;< (W ^)mWZ iOM`ߨb UFm%k;NT:fv #"H)O.۴EXg_ߝ%m$+;QO7S)8{;+u 7҆6oȩfl, i%lOw}욞7[5OsizԿ"Sq%VV߂fOhB?˲P#=Xbnjcϵ=c򲹠Ң @mCkH:UWgtC?Ë>>)IOk'<#փ6\cvmZ2.)Vry=DF|9f ӉɟĈ skC6 .O9bg6\vj P.͘UϪZN۸nm H`,ݕP sVaA(E:̝J8K O6NS&a%jD "psslJiHơCgv57bԓn LSNK0PML7b3[:ޯ[O5t1x#p6 !L 6a;]+ -FD!VAYN` Jg;OM %#籁PQYRjZM)D-`(V+;H#P4lC[puD3#T,@\=+v3қ彞H,%#ܖTO͖ ja6)3t6r9u J *Ͼ$il)oLH# in4?({6_f!똩m0O*6!qsM[M53fMpLi1o O<'h2X3J}}ǓTa() B8:8MMR*ͳ&a~%5G8=-Mn8e; B?f)zіxW? å_z ӗV>G"/#2B|3eDdOfMm (b0_`[/͉lլHgץ+]ߗ^>2t?2M>ZFwwj):D6g{\wP Enz&Lh/ucr4ܩܐ7Ii8d;6Dnz Q~!{XS9 b(' lT˩/q@}J=JM3e$B Dq]M>\YV'@ ҰGz2߻/JP{=Vi`Șq C@9d{7D9U =h_=d5FصZ:{gǟ?\iDF#4 V%9=^g-1ݰ1Ks/02 Wv`MuU-c]7$ W((4Hmcp(@{BQpO"oBAZ*z=MVvܣ]*$mvA0АnKxk|^8Ne< | s2&|/v_UBW;`=E}_oS4Sfov6hp%+I!SbZDmaw*mp vftJ %nW/p[(Iğ'29tAS7/O&W1]go)rEae 燲[Uq[꺻Kp9 h4 X<[ě̸GZ|lLSƂx>{;::$s dSͱoObcf#o.:.{Ucʵɏ͎uLf@~qyU[jdev\4*Upf?]@r9mJ&9PRvӃ$Ռ} I)3`\fk>6p[2*pxd?Zp*Sܭ# [DWy2NTV9؛ʚ˫5,I5i$#WL*'.Yj%2t63Wh1o Frah.b=A(t 퀳6`bw~]%1 ][d:B+&PhDHԂcnkBBe/Y%59F^"təKjDm4s8xQHע`zԧX y15&^V-&.PHӕ2z럻-FoFTųf #I3Drs jDX T緥߲] FvA=PRGgG=e ^X/9a69q@ByY%mM9O TBaJ23p+H!@r,O LxQc?q̏ CmIwQ/]0 VḷPWh^ו집3^y9 `v;byo@i,vRw[X gŸ ΁p6`WdMh+2hڑ /6?27'ը7J) __6BtK;;KĸF#Qf79Vk(;[Woi-T`oCjVn8?kACQMK?F&5qxGjԸ>qx:|^Xꮄa 3|~3p :j⛯)_ٱvC:)*?ڐΝG;W"*S/7UEw=>CFq?U62 VA˳&Nwu1\چLˌ 4GrrQvlZX^ke+7Gyf2Ua:.inQJ\fHuz GқKQ`rdup6VM '-@SI`R`nZteSh?#PKj'&0u 0Wl3sQVUNz7#}QaDk@F7c5ʭ^W-lm n.8>T 4IF\4{6=h pjbXʌTC߸Ă @LWS|H`|[dVY]V&~a!t4ׯ.{ؙB%{ Gv?jYl o^-s.zs? g3)־EZZx0xV6,:8җ7u5#WX4e 92BGז7V+9P _~_DZ-LYP&1)M$Xi 5#+ e_Ѱd+Xr6Mv=I0_CQ"KP=/-s!qZބh#x_pw*GeL[p=Ғm1VeSj[ͨz6j1GEg3a4찫- {9Z)},ƭ|[N+H\}O ᬬָuo<9ď[Le:Dx QP!T)\}%>n5P9[9jF[}h-uz 㕊H0_.ߞwE2k*x?q{ چ x+pU5JTyEm:m3GR̠r9ʖڰO"cF|%mlg i&hdC"<A\l_0ګBd4GfecM 2Y8/NO'tw6~ . ]e?ږ#?<>C<(5A`&qd/s_98FÍ/KW#Qq8%!À4fE=ɒ Wl;bxMeyK߲5b2Cʮc;8c_\20E(wt(Ͳ7z2s滩dn%܍`{H|YKR鹆viܙL2*\O /EQ8^4>}~GfyifMgsv/^ ^:,-_JyqC`ʅ!MS#&6)}@ұ˜ ]O+ 9u:5vlC5UUcV2%>]/TMz4k;]hO%"zTeϾf5Ne\ ;|G3p`u6+V650J dtlsI4e\"4as!\d* Ng ,6l)7n){1sZp&W+ 7Y iJE@QJKxږƴ H%-Ķk417 j\ywmJ-ƺi6JW_1"MLYtwIWlyo%wvz57&I&.[  p" Y5OW'[clr0x-QZ+=нz1'-IEtWce}dkmi;O[_py&ǸQ沤UOݏt"`|oG0@$;ecz7K/jM8 FSISx>/tϝI &upJ~oU r$~OU;#hczټܿЪDc"|)Bf=*cAwϭBb4{,/ O^O4R}$U`+I-;BfOu<AcXgGU'ܺACM$Ԥn9'j_Q |!o؂D s$),\ !H͒JEƱho9V$ŸB__dLM%x)urZ3s߳E(eےG᪰Y\hTPRpTI|ٲBڑ\쑈VxISzA)p R6#Tmrd̑b#i<}2Q&oCmAB3c>69u{.nWe…@I!./lJ)N՚A$Ht0qvաbA`{cgN 9Ftvav-+sX3c>}~G*ط)GfO&;xq_Oip-_3TL6p&ZI/rhR<߰+b!Hk~kMjfQuSD"Ҍyf V$- @':׎O:rL0Z.>5gcKN٭#DmQS͏;f4XxnT ,#44Z~%"O?}r>!ٍPxӱpi7qJv=- _BѮC'9Ѡ$/PDB3R2zɠPf hŎ~9'#g)s?1~N*ccTСDlT^rˍo`AϨ^iz0kɖtjXBkrd]$IV-=ro^ӣ=U 9VJK~ †8m5 {V25?"7ee:Fb  UӕIMbK̹q B~d\Ϯ'Ui%ПWv!Z5 i%l}zY8eX}m~:/gfwyi 8>o"6leϨaa#!EZ$4$]Jt-ϋIY-X>BȨJМo<A_+OQqm50"5= ԫ־CX;PL\w v״(` R(YY{Kp\jbt-72?/Iu=lA :t.>BF /2A晅d(0T~Ǯ3"1ֵFXNSp1yNy_ s4" ZbOvZ3LVS5a9vd']f\RH A 9Mțz)YX^xv;aD}Vufg=.tEZ(͈FàӣWI #b*1[.Dv_]zRqAӺa=,M)P (hZ̎ѥY# hғaofrvh Dn24h~;麈lh9ƧKڄLEV,·*i}edxWn׃Ǡд,9Lz SE 1T5K A>iNܦOeN u3r`ZlU_IW4¦V8pؘ&]P2V t(3ߪ+ao2鷆TVQ#]#t&˶REjPߔRT'|c:>AZYݎ=Ft u_*:PƐh. | >G1Zy.' ^M:V]S >o=L=?r3 c8(^6\/%Sһ.v(f؟xI#Z҇;;`FӴÃɉS[$PU> :8qN>j'1!; 6s%F/Ƶl6T qф/!&5Oshok&OP%p;.Q5{"CpѰwΊ96g,moLى+6dܳ~kfxi2tw'csn(ImBsT/;-=@]j-#4!pOdǑ֥ &$Ջ%η ĥ9 xDrmn]<% G~.Ie;TFۯSe]@Tak Ȇ1fM4sg:m$bXh`#veAXJÒ ȠVG;Sc~8F;i !8Tܖ@(4-)7O9 f*2NזȕNSw`3+ʩ hÀV{>TPu~:P?<Ǧ\NCߍ-o>9[Pg> f/dɐ̍*)l-HE Q]4.3bfRBlDp2@\' NgTT b$J&ƒ)L_Jb oU?pFk}fZ=ڋX Чfȉͪ[OUsSMJ\MPb'!2٣#JN]2bAi7I1JG?:&3z#J(hź'5i 7m ӓT6 j8xlPQRU6g桟~"ib*34v^t? Q Bi)̌^3A>Z;]o16 7 6GP_5|Jbp#z-{'L zFlDD{Jq#OV+NұSWeUZ9߻o xcP#HM~%c#ʸI9gDJ]頬n̋e\FUe)2"mu -´g^S$&B `ވ5Ūĝ9s1ͅ=wQf:'דtZya+64@5v>̋)AZnr:%c1Mp[@[]~&Fb,r-}Kob{>[hleRXIφj_}\s`2.\0zvÀIŏPofs3d&\?s"w:]◭>uFa@j3QJ5A Z JֹpՏ/+ 8$aF>bͰJjB=V>%u؟I𶕾i M͚4N n2^kt&3ԝhIyLv|0b=?Pu7hсYJ*)&ҔLK6S7f[ρ.TuM{"{/mjΌCBN;!i(dr^vrŢIZ1ubIP:Ea3r+)˫cJ}D+:-?Hf5 +CYFcm hF?+a,"8MjPׇii' ҍ^1\*ئPcJ тB5VϏu~f|OzȎf3Ǩn% $–jKaaqY 촛ZM7sѹ2%-& ش u y+_t"5o>#K:U h8.=hanNNmU%uI0ݻ&ZO_/q>c߹b%ǰL>a0fҼ: SFz-Un]=tN!Ӫ"9 u#Qڜӎ>+/0. qInV$N} 9۸ͯ-!q2">u|x0J-1(oGk-3VVYVO[n|K{Qo8 I#C1n53rRFNCIC.CxQ`jɭb.Ggp?Al1u"¿ZRWy1j*(_;%q-mlxϵC֑)Ϝ^!NnD,9#K&@qGR;4<tx̖Zz1[Zܩ_WFioSjLx:KZvF#s.k:[/H\a0xB4)gqeZ2Dj-v柒{9>f7a6_g.FkZNm_:i3!E@Q ۤf<ͫ_Yhpõ_yiwB׻c>cPCcDȰ'm +n*QhV{>-(MTA[xf$o9nEa'L>ڰ҃ECswlnh`- gƧ[գH辖mw&\hKxYkFʙsofI2g$bfk(p. ),W]6vU{&Rie3igݒlRUyM23B`/Zy)~+5Ӭb,4-k39h, lM}&\6$\ٓ }:u;as&E %.)ؘ̬s_C6Z*֝PXV$y2%k&6&[38J=O\[gDի{(tqt! ]ӛ1IjSc PQ̎~s s^>YLḾ NhǮ>N͛oѓ]q;f_U$C5ɓĖsj'I߽yC$>hkiahmmyHRekeVD̦޻D*{/dU ]k[k˂{3"CiW):oZ^kI+R+i, š1ToCb]LOg, -^F2MHdÊmPeeB~Qd5.hmFMw*n~,3w$Wt6ޠ,e/Zট J$,ME뢭YGm ǗR( h2%$*mdyo6#vJ;c0S'ױS޷[Sbͳ=n  coḏO b/ E;uX6T<EpiN;*E0zy'RV黈gU*n*c[T >==0KEnˑ#owuBejZa$lqh`X=uv[yUXC%_H-96 $_, o#z 75:m+Y7TCPBKW;Œiyo-tZݴn"ბU%XI:J&֛ܶ[sdNB*6|9_%5-П^jCwM(g-4ܢ==u_n_eO%ړj)znf\=wztp @9C E5i \/,R-f= @i R9|T4ºcJa)x)ҍO0_=AgM"V.!"ORM.U)B,-׈Q*MVB3JlE"孛{=ʶF;Ϫ614]6lQ6lz3 *l#<)J "daeεW'4VA[o$p4 i lÇ̂pA;/9QGIs= 9rދ%ȥ֙*&ּI%ċ:HŇ-ؐ&6d:asxZ[@Qy V6> kZGbh@QҮiBW܍^b໚JB1-*Ӯr=4ZFd} ͊>%N*E2ϖC߉!;25Ӣb$B`ߒۉBS&,i 'oeAZZn,K>%eiXjZB$( jiS%Z&W_r l 2:N&aU3ԕb6/ ߉&N5V| 2M5sj7_~侓J 'PIُ%$4q)bE4ybB&F 0ch&іT+K Rޠ~ FM¯=i`Hzϵ_kL5 6$Kjrͩ aD9V3~L0.F! :ÊN΄ j`x6>Z]Ǒq2̂j!WP,˶&W: ̞9f"X^߻0-Ai&I(Mjj)!PqXDA_OEyNB[C7.}uU4S8 h^̵ZN((.VH1hNS(+ !B>L,mne7lUo3rBLn qMZ,YMflLj>'4*AMٸ[habP3>dZ-iV;0۶+|ꅄ)Ϛ"B}f<524[rʮFLBkFz1qm VXRi7LpӼĎ7]Gp\McAVܗ[O#JZ+ʦ`EWM~5V9[b>#R=p"'8N)⦼%y\-IF;#[8iSj0BWg* d~85ӖX݃4gu`7-mS'鞝*Ҟݼri r~Uὀz :xѨ(FU7loY;=ÄLd̡~~x$waZUXe8)t# +DP#=.xElT,bf-Q`9zH s.bmvmX۵0H T^!K";Zqe(qg&2/9h8yuS/] 3۠ŔhUU PC̆BJQab 1L2i(8ܬ ߠu\wVeE|1Ȫ*q!z ypS-4IBJO}cTNƭ ,*! $s{*+ >&g$_o{;}w G!0kPje1k[ }d SPj CFױ"¤ ,V}{4H:b@: [R17./*fw %@ G>0HI\mD[|c e2Cn46eeե2X\r'3"iW<&YzKԶsO)Hmz}oZvz/u:)Mߛ%3aAԱf[zNZwYDLyDw70] lנZsƶ&3RRS \*ey˗P < @í,klyz?onNYA']ƞ @{6rĎɤs,VI#xL=Grz?"5}tt>W==E]>y-Ia𕌐͡t}{B> p *H&19G$wowV׿|k~:YFDEۜS&b@cRʅHϗXDX{F}rI_4ިvKE ^rǻ/\Δ%a %B@I6Bܲ$$ ݀e %X*PKe(hCJKP7aYb-k}Vw)$b 귈Jn@hE`!"&:v[c XSJI +}֐uI$}POsB@W@H>̒]mUi(HH>0׬ $>Б! l0@$!z!@n (iɴ /E}U@Zz?JZC>΄H8VgH@-@BD$q-$T@}AHKe $l^6S_۹cciZkBF$!:`O_BFCB{ v jZB{ - X%08!l8 uIYrSЄ|@Hp VBH9ODKHBG!p$/ $$rLKāZi H<EKbIm0]+ ^qKCxm-+lI`5%h\ ]!Wa&$~$| ,,+0 l4_}M{״ `p$c(P0’q/n&pi/Yf%y6 j5ь;ߨpJ5C>L$j/85@~;Gbh&pD'Nŝ]:=zW`>*z}/S$lQOE?zt|׳m$^_pj?t]siK6_,/8{jah ՟?Nk?7 .uWB'&$.I M 0(;:./WvȄ@,K!z"),=8VP0ٙ=u3FzP+&v-O!M&A;9Q̯y1]+!-Yc˫b[TsOh; QO؞uɧA%D06 5OBS='D8yvS~4s,#_i~v._ij{w 6rM-k@#~$ϔϣjhm%c6}n8'Bs*N@p{χE6+Kv9rtʢ4i}. 1QܱJ.`n=t[#7Uj@5уؐ~RbqH Ipa",誓GZT?5>nG^1v򔖺^dK)_k;Dz{78vޭ18Ǧ4\,> ro3߼r1cː9\ߵY^DW2񣤋i ꕙTSGe8S͍(ݶ_k5*-׻=Mqy;XivizV] BF0u !nXhXhFm% +Ki|f޳9Y;HIǓ ԃe˔L>$8a!Pq-ڄ#=GTk[Zv%@hB B@Za @H6m HcH `PŐ][HF[ }\F0 JqLiP #k^̦Qzf4 @hz"b9 I$4 JlI$!Kf$h1$W@ $Vbr##b#BH4$X$В%Y K c F%bSIT .I$CsITĴX!%&c ZF SeLH`T4`b)$ĄXd!o%α Āā!d4IMhBK[ ޲$]bim l@ bU07,FCF+`*ZY @IV$^h[v*Y{V<U}A" $ I 8gNW|}R4Wː&"f4ހD$i_T pE}=yYò: &HHIuH+i0}6jBuؕЂe;`..βBAܰUdIVM$ 6 $}f\%]Ai!,$M$ VB_Ăl#}6M`,& 8dXL/)ш J4xB!b>Cgϴw)$mryyM%Y ^0MC1*i.E`*u+i$\bIy~6JM#9'05P>Kʄ!cX$$S(`M -gcI  h5 åhFqF^C.6? @AbBHڰ@؃hASZJm {^5` !ЊX3_Z iS{|KB BI!%& ;y$Zic!nG@mO&g{|yr2Hf4MqVbiyf#rIsXGJ0Aei% 4@cB5#DI4a`@h $a +@ֵ /`iظFMLm!&@#nIU*=33]7 7 f0L E,&b5$4{&)1xLړId0Ki!n%=k vbSjl6H1bH6 4L@^Y-c01 n@!t FՂ$C[+ wRZI.%UT-^ħRbZ@BIm*ڴQ`ҵ dDXi %` PЄ4 +¥y6;%5=-{ Z -;%kh] @`Ig#4tb\;Kxw%1 B `-[1R$w${F{AA )V!"HH9Vp5]_.g>߷ǫbHB/y1-5ѱ A0 M FA1y @toZA!z6 6mlRZ||XH8W $#r^QzFܵm#𴗸iyg@ڱyL {4#=i0u-@sBLH 3#s5Wmru6 m bovϻ&;fn;V`xZX 3ROZ$ rm/MvYh 4~{#`$]`.!$1o\p}^{?eHB$zD ոRzf8V}yfGS#Rs~goa! v{my?1%g|&Z7{osf{֖ه_ 5a?ht@#P;wu{cXH<6`tmu< t%83J$.}^3fIvM!$ѴaV59(\A^ii$ پw #0YP;;Dz.K-@{?soZIgx${/_ [oI$A_AOO-o߾hB_}h;6?k`{\^h-ðx>a^X@dvWcĐ쥑@$.ͯZ {`Vb/S幭6YC8$ 16e13 fF_Gߟ;@#%)r=d% #2?W@ V#u0H׳ݷ5P|ļ-}Ʊev0ߵ/}.iO=ݩZ6ϓ~K2$,1%6߇BW`-ͯǰ9.K1/4ub ^/őo5]s4!.gU4ڸќ+HK|K%^k6=%yyTmopRh1 4qM^c~vSv G.c[ )ug@fR6\$#` [4B[Vk8ڴ$/7}]OFs6M-@ r/a?i$``"kloCH~#3aG4V$#=q~H;F֎wW {׆=Hw{H3IMa>e{Gv=zG=({;=3ݳ۴h@{zN׎I~FϿ|y p{\)q> Ϭt=|&cB"-@/|qޗc]Ť-=ǫ黟Bhťo$Z_MOSR$&~. ִ;Gǽ#Y}GD=׺o_tu9oɴY!%׾ӱzϡ3L/ =ϽT4{oA/S~ւZc!O3y{ڏo=uu{EL'_+3Er!?J,f{sFvEXd3l0xBrZKo! `$D6pssd|]#`iSz{Y$K4z$>=e5;n+UGq^cyڄ#z,7ؤB:Q{~(r(r ab `ۋmo%Ȁ d Y^ا$u+:#-aG}Z8#qv M-I~ٿ^k% Wm~k} 41{Pɽ`dĔ~c P2/Yhi)Fͷ EvUFK NV9dkv!J.&eH/hӰ[aG!n$bG迫Ġ0 쮚rJn3ġtpcanp ' 0aq5t5|{:}Uc4t` ֑WS+Jۗf[:1tsq=F_#l{v}:>_ͥl\M(wH2ގx@0Y,bI k}B̠F|Z1jZ {M,3xٿ2{GUD05#fǝ.0 *% Sh``)AatvOK!DJ첆CKe:bWZ3z*yN|p 1Vקm`Z0 Yp kOdQ uYԅj QU{4@ P  ۆ$d`":%tAhhyg t'{ ^3OZ 6x|ʚ#\i6oɣĈ` X?FkjOc|#*!&#'u\C 2'y- "+bUD "-Y|KSaGد+~Ըiywe(C'5)ڰ',i0׎40pEZ)]@A!UFBBj˟DRqlaAlaF)2٬R|&*XX 巂O/]GC<E%E( ?"5Eo4M~7HouȐq>Qqީe> ްP J;ytp%4WVU5UTvJE;,b4O4%hɖf ] ֲ½wk*.J#b0FtA]<]h( LLeFZ`qN^Պ,3CG l[bMt^U!+`1Z9trg*)iunlHQN,%M˥nBi%q岖󷅌d^^Į/:RE}.GlZF g'b%=Wڛ$US \M4h0$NF a=/WKh$ 8#k,&% f"[]hܴh&w,]jXUkфWh\++0q[֭L#X`pr74|fgBM%wҩWx%֕F.` .-&zVF; 4ȡIO"=6l0M4_bGD.=j1oQT92u:֮2mvEVn>BWCKĄWRE,.^ <|ɮ΅_c4G^ Ky]M2io\a]QF~ i ؚ*oxh#x43&QT ?ƃxm\4h 5&<ĕ{.B*.I\*I{wL=hF[v/' פF߽gijB;.>; ;(hGuwse`g’/4gWZ^{i}Iz (drGo!$ uS@pM~ Xn8A#h@ i b4$_Ť`/b#{4T 9_򞇫#_;{:6쐺|6g]p, ǰLa=k@}'gaqH fvIwyݗ2_3Pи~f >H:W Vz)O`7X/d#ď 1HH [hb]b,J~h޴h!L8z6,V ?i3혖_FGi%X$0l_A׾jPrTF; } Lмw4;܁kђr,GAB8"Kn%w͋0Z=L9 B Z;f[^3G ?[{߳Y]!K/yfXli-46z.˿fX,װaŵt~뭚Yo iqvĎٖvh@GJk1l],!zܵ #j¦g5̖œkT;G1@?/8f[YG4h_ш̍ؒ4#~+㨄-{qkY;^}-I/XpLѾ\h4qlOdk]Zobp0ij]`|vW4zƅ5°`8VGeK|ܾ}QM$d4ͥqfAϴe05 띦}ՠ?jX4K?#^tm} C]7N̮kr4&P'1LhZKusEnt+fXX\!1ܡ7xX NT QfMD O5.򧮊0.zظ쇁wK,0(*'ֲs-΂I_6D,oE7YR)РҮ(N.vΝ>XDG"_/A OД0uٔZ 433u Mk 55up&7BMNdlV̌3y2kXEj'H9X?mh:ZmƏ12 4WմKm -`uQZ[2ZVW`lN=Ὁ+Jz x]o=/(:+VS2 ,szk.rcݡ^b;isn&+eAe)L!j%G,mlÝvqރg^̹ZL>µr緐Fg `[B{B¹ɞ=fSLj@HivEh" Rj *ŨYE]Z?&x%\٘?&*ꪙD 2Iw6ZTDc? c~]Y2 Vy<Mꛞ)|Qe0vӪfSfUL휛 ̀AeZ0P[5=n%w[92E5Ƶ 196RGÚ`03li4g5cXߪR-f=h_̲"^R2K7:Gv~yHηW}[6Y5vQTMnKWN2 tN:sjsL)ղ{- SOQ0tl=Ì csԵt0ѤhN9riaz֗ѵgb,G$;A`}^g^qд^̶ T>%۵4`+#H@чb^ѭ 3(I#kγɅi|?JӼ^]0;癈RajM#Jк 5gi̱#i#;f%}.B?{˛h];Wo$#lÍk͵hG009LL-I k~S?2_SMK^>2~ʼnxkuzǴbMk o[wyXeY{(&frxыo[AbW/Tг~4rRASBU4ƒZ1w>fн V>+\&{A=IvMF^`Ѿh]Aʹ%дev0L[F}H&/}s>#AԵ1+M{sG+ . AװKHαgkaYF8օ]q]uK _$aɒ# [†BI2 {3ϔ9!jg{|."bQ2I M?yߣxJ ΒT 㳃I X 4\cHI I6[I#9/8j")xGj=Iy\ t9`ƒH2А6و|ЄZ^3Im6۴iHi9HX#ܰ4BHI.=ZG"0nxDRo*PD fю00J_XT0k7?Y1본~+Ws. 5.H`{Z[K&bC21ǼB]fNCŧYDuCa@!˰f7$ѳq h,Boސ07Pf(Ya(\O8VL$rGUq$p%EY.=˜sHl2*jD!`ɋVEw @CtE vK,#7%u~,02#kj8CjXpX:?4q-.= `/ w I$ؒ㌌fI 7 $fb?ͤM#M! ?٠B{fm@Gi$$}@ @HK݀H;C`& BX 1$B#i"m@F@1#`y֐?@#5Y Agq\!su;\雃g*İ Ե6,D0{>c@$v$! 6{F$8F @Hi$/KhFv\Bq`\#}BH5!^f\`z%h:!iH:vm }$i$vF%B8@50B 6wR儙VP$)`qLH +I$`K5WbBHЈp-JI#0B0 i$-C@ZBZf0Z?BAuhc7 nZ/D@-U08F2.KB1p@ wMBBq[6 v-$*} . 4G Ki$o=HG6Վ;A6 E$W` ϱ#;$ :pM!y Y}v$#4Ĵ,V&n,#ā}3ڱ Gb^ 9X0=^N$CwMIJygK8G0!Og;A@Z47 Ki@F#ڵ'EAB%4z"i#*AЎNÒ-^q a]hH$0G>З3HЖcBSirHh%״_;aHBƅ[91ظ6ƵB?FϺ~iNK?50r7euU/v21C O5g! ,=/)IxdZy%2q(#i`C-0ᴰ4ՌXB2Xp$)#5ɉ59q[WG`{fu' >#V9WMD@[0b+5mҫy`%~Y- __m̬}#ҰVZ? ~`I{v mmxs mZA /H!4iBZdR&؏<0dX!#hl`MG> #hB^bH-In؀EL[ƀ4!"Gw[fZi Oci$`V$.u@± Ą}s=4 |q6Kͫ_+ m$K}/xu/H0nRT[ؼjڔB(\N'o_?;1#.;圙qHK30MhFUv8/wa&*NӴ4Wlp+ kxdC%G 4_la{y{c| n0qRaQ{Ol#~hpI#q>c6S]( G3fn|%_yI͠yYb$9E7tohXO6?谕2͑`7-8%6' ùqfzj:{dfkn8l.w0j3 ٮYZnf!@nb~iquxǙ,xW/"iDj+kػl}:'\d^_ KLF֊֜v>+VXMF~M>rr/~jktם2MTKSWys2t2OJ!*嗭N4fz̒>+Ŗ3M0N2 m?ʧ]SZ@*n >^#=jLQ96ȦLt&ܧZv&koJ= _֗Z]0bTvz&*oK[Z .M_q2T&M+]ZhUs6O[)hBRJ.st[5@gzRԓ[5א@0oΑm:$s6?g]:n8[zw5LrQMXh"("zaH W]sMǬdƀnpgԡy(6VS.}~Fvʸb4츥<@GHNdau̾*{grc%m'L/%ڠ}AJn\uIg,URZxmOO(. 'dYiGq($^Ts\4h/85R SFo 9:W͟!R3[W3;DL&]Fw4`նT9ީ<”]{/jd2|=.9Pέۖ0T#یd*|V?( I\*- ]:"¬_oKHB˼QJ2yiSIvҊ{ /#/ ʑsV;$sm2aSs/eE|t%BeXk|sMӝg13 Q˵7 |L=8QzYg=tY4WZ5fe 4`&v(̓3urA_ok &%J_?X4T۪(ww.MCemeJ e$[8EH_p5<>R8%q y\B@I, 3MsctsALpt൜׳೯ ؿȣGşdj]O~cn;>'K˞rPRP:ԁq ּs#^-z}uM8`(hucDx h9ą|톹W?ɢ60^7#NY'}J}g18qc9 z {DdGqrхl gy]5<7iZAJp{{Β1g*hҼgP[X0=TYq2weմ&RΚ%-,79 tmM :6Az^}05|"|z 5I~Ҡd͟LU'Pn ^sg -5ul $O`={&\-3 # |jI{񳣛--ǒ2 E/=ip\;n=.]2uel'1*ASƉ9&\ꏔG/3< ,3TDjw$mW`deH<ڃ4Z1qݻb>Uʘs-q[6u f>ҨMa:ǖY$Rf9oԅ՟^]IųkZ;ww~al/q4>_7Hi"'F8Jǒ0bBD@+P[-E^Y Ȟ2|\%kjܫW5{h*{" oZ ZAgxu=1$c3*'B_sc40jl٢3  p6 I!I"`LQkFHfwlv?5lc;SluZhdS{/[*h}.uR`{eEi⫳+wJGDjx5]tQBUJd1hZ':/YD" gP0D*H!A q^dQ(HD~jc!ә܁ x`8+`E2u=&cHr'y%_״SlA1$BߛiA3p8ǕX۵m)VeTp5WE.v%cs?w,zn-?#C+Ț6-b]%W[qiiHz/h,5~i7=Aģm?:wbm\%n̪ݓ u2buT{Bv՝Emm-w;RϚֺN}~l[Mk٫)в&l\]QZ$tmNs{o9]kqu?fn{ۤLm-J[s8w WEص5~z<[Ƨζ3xp7 ޘ|;&-,)Ackk=;}7a+NWԁLz~ gpGtݨc!Q1f~:f_?騻9ӛer4WM`ǩWocUr_3!Nz#y{䙟+W?\/e+DkqG~ћHMWvb2;\g}fN4%ƽJڜց?~GʗTюD[W#&oXIzgZ5}£K!{]!iNg^8޹ٜSטf03)ތҴo:7_Bz \[5sj~&}׈Mgr9>Ұ'}&!at{=0`pUvu9PݼKFmLfZ qC6]}س*w:?Gsv?RuP~&Jzp >^Rιj7O_Ajgǖ[ʲzzh\ÛNAm No.Kbn}KG> 1:ۿޟojWy[eu,;vgxCr?ږ?V~PWLB78;vӭT?x,w]gXk}fړzٚS0pTwWq[& c6>NgRgR~e(brI:<>g0U)M@je<tMaO:} G(B+Piq;竧0px1]AyTX'ױy8mf:-dd,,&cQ<369=F=ec(7T*y.6seӹ<gr?29gוBszX,)xg;Zw?yh/̯Kmڭ'MfIޯstX^x_y5ow]d&wz]ᬍt#vWrLDҟY8@6`@HQY!A2YHd6$3ZK4x |otTpl`.A&$``!wcE" 䀁x*HÄV#g@otL>߃A]5Xg+_\)hE^q/@At;+ We$4lHd'! Hd WY_BҵRI@4P . X[myp7JSrYbEyT_|]:RIa^p1`!4ؕq#z+WZL2d![c)/zeSLbp)#FMfT˛NեҊnhVX .8j4̩! Û^:ͱ 4F#QI 7OĪ `B8n-!(I af+Ȁor3V8'05 YbF ZeHIMDV(BSiڛKi M$6n "s!4v#ao4z]:$1U 0,Ӎp1N$ '1%&CF R)(a$ņҁRp LPLC Q(AP%P ' lP$ hCAH$VO{j¢"(Qg(SԈD  !0Q"!Bj ! !b CcMi1HJUbL@!&1 7q 2!&ӄҁp qthi1 1 6h"Dō9DA "mc&@@CB%̡h!p( lQ f7KZ5z:~lyv\HlRH@ B$1!BB @mqRV6C g )(T %eip$9N>Nmw8ZDf!r_e_ԭMGLKU#BLLE"RT.+qJRHG80$b$*bC@! brV6˦,e%U(ƿ>nXT bPЛfj7#guNQ & Um +lZUI8LLITȬ]H(MxXҵr-2xpew7- %!,Trd/qZHd&`T2ؠ!oޕh EL"]dae'-Υy?bu78 X'C#BTRQqfrӒ#3HzƷʷ466l)`FS (UUdJD6Z,RW @ȸLiC'V&* W+_M'tnZ^1L@0mq>xHL\j$؀Z~ /Euo%7gy.͎#x@J UZyqf2ad㜭KI|4paBeZJBT D m8 ߴ\ݺ❯kX3d!j4PjJb!RcFOr'ʷik_=O_%.$+c]h1Ј NTSP82EIm9~ÄZPX\WՏ7sBF@ +5ED!TLIRb1 r}j"s7@sHZ&:$VGVAM |Ri[o2BALB P&Bg$p "K:YU8ܬoDŐUs0M IaP/ƪĶҵuZ)oemlSOX4 N J-r4IRF}^W^@$ۻ%aQPuܪz0YcVxiu &e2c4] S anq&cN}ߛI]ʕŢ)0@@@@P`1ne8&5?"jv{d4ZҮ8UF8 >tOe&12$4"2dp~ءbX%\FDaIH%=RŨ!,wZ[3;mPwLiPс_sهb IJZbӳZmŵTDhh"b!hM$CC`HHpE5W5g9>mǻ8urI6!8Hm HIڛ6)OBAEgu~2s+_2}ihʵ2.<f1&/ɦMСhF; DmcUo E "67뚒b$6!F#j@qЭPHmtZDyrde빜=^z,b_ l`cbCxnIi Ȑ1)0lJM%& l `5ؗpfZY-1[b!E)5&"zThi[!Jp7(d =]1Q SI´6+CCP11BdB+g'[Vp%Ne@C(M`2'CjL$ױ!J7;WqqպM١]j=S㟁zӴ16 2.DJl(؆aP*-ˌڃC˙JIճ[h煉)ΪoI?؏!ݟ] KMn;SpVï6jE"28t R\@JHrPFg1ab\o!^M67 0RWܙꢂUR2CCiv)UtS FK jkNTdoc.Bw 2b +jldM]>!%^[`_}v;"9 :z,Kz^'uv(ߗ m2pxۇoA+̬djziƐ"_VLj1ű{I+ntWwVqvD8'p wb@Ug|%+++8MXPPi6բ L:+<>w̥maD(Somx'ye]7pZx[EN71sюY=`d[CZ97}uC~D|y</ҕ\3׾@y9$,ߨ(ű'eeo͐g4q`Ƒ11JSI(?u/*qa胘az3[d$OUimU„su#/-^$@\b$$ @Fx^ %$VbA&$H/]$4 Hlii$eH6MڤGUʵoS7Y`EZw85~Dz>q[ېp=&zF4 4$ b9OMSNJ mWbH3МFDbΞZV%i1 R[aЄ-Mj$ijtN6 V&$04Hb4ZDhзSV}i.n՝%@ bB$ֽv5 TaV 2[=.'Y 0YlH6㰘]k5NVhW<չhn#lߌR"$x꼢#E:L.3st0`!cٷ93jnν9!]<:gK8#IǦYw MֽMGOiSՕ@@PА '0i (b@&Vdz I0#ɗ1h li!&Ѐb!!P(`CI +MgBm!PlHCjZ( 1!- BWؐ6JFcu ! hD@UHY2 Tī1"$$ù(I IWb@ lX$Іđ&lIChoS;W%B]6"^,N!(mGBw™Ỷ=fޜر؈Kŧ%)H[Z4'Wޣ]t?s]/kB`!ħ kaj.`8 :MCaf %9w|]z]bkdD f ?y[y⨅c2ɟ {7 %|-)R ,9$abG5!ѢpLV@g'0e!B[7`*#>z'G$bY{m߽:ok~m@MM5 m9VN[L[+,dPDF.TIXu{spy~'HUR݋TF UZbs?;ß|JӥiEà[sBX'w9[ /fEnBD@ 5 +af,>ƨYVⴵ‘lh' ˀ- =;Y#8o$$'9(F><'Lw;h`@̈r,^mrq R rV\0`meIZZb+H6^YiU"*+c" 5"JǦtt I̠9|Nc5\5LZeVkIC]tIW ^UR߯!U@ -)VjCzBܾj]8N&" Q6Ikέfq(cH#00K<OHşc_ldU*xMDYA/7sUJ^nq-)mϤ.\uS9$/"'*B $L]Wf+r]tAi)Y{ 8k0͏xҠ*Q B B5zMJg{V0Xr?q]`k,aD5B"22?yl!,|5gk1, }(O.OB}F#@82T쥘~KiY C4EV˴mO+q4A~!!M{\EAVDrYρDW]I0I^O(&avum}ǥ&CN\rSla#8-5k7q4TC)b362CkrC1 '>FQqWPDcJli<s O4Sbw`LgȷK4cC Ԙh0`x9H d$Rq$P6 4  }+Cvz]%T 95]#WhBlW,IM C@Ii MvFοkcqrZ,mu@L`)1 m 6$dp R~0#L ,BH+1 B6) %6!ҭI00+i"L3ihbI6*b'aicOIZ` b16+"liMĂm !CBÀ S;qIlѣDfڪ :ē7&M: x#.r! `"NpP,8M5tū]j~~}wU΀'[zG0C@ Î@<*zD9|-8dݚ&x L IL3@ȟ,.gsOSU[e\@)i^4+ +<'#AMVt G?]P 9&"/$h #2ܚ`zNNOIb҆ٸ]:b#5VKUhUEᮅVD&k&HIɤ- 1*~SHT-.iގG3# /??bFH}0`Rbi)?Bִ, ΁f l3ְHW~l$، (g:`aؒK@!.4(i ci h(b@2޴ + :b,nkpВI`[h}|+Uؒ@@6H.B00T0M0+LE$*6%!Ј`Xa6P3ؕ !XeKË??j&XVM:O_QWąHP[u0M (xh:6z:\ݕ~\-l1^OyltxBfvbsD5 o@ xK= <-ci]>ci&H!; V^b+ &lYA MXY|*Ujr=N &mqlP֘f퇯}nGOWӬĵZ~?_>VclC`c\']BwdAḏ;X^4V`BZw}``$B"si0}MΜSSDE$&3v^سpfm7عh@Rj YJI+Kpbzp5U"=vߦiu|h bIJ>a-5w@VbPOIGƾRevSjF6Lͳ,W̡ڣ"״6-&Tl-Vƹ$0ҸBᐔ;DxYgIWVQűVތ}jj(Chap493W4bLmTi,}m}Uԯ0WGLtIxi<Z}ܺ8I+A Me`DƸm=zFBfH8,j'*Jkۼ*{ oQ4fi1+-zv-FN` (snozcjM[|cX  `\;2ݗv I:GbI-; E^VNgTђp3VB`(i2`0eY)mi ^ voif+4*#!ɡ 8H!6lY8-w'7tQ^ Lf[MY=){񓷎k_ ҸЌdk+sȳD la h7̦AjolM$8Uf#$B+*Gk܄6;SjVԔW1AYXO~tzDd:0~x_:54$ ;wPoCMŒV4 p]8h̆@>`BdHG\%gj"2EA $2H 8SY='mtW\ b]#(\=AaߒqCrK8|Yb!ewSeOUXZAk }~WE]d֙! |=<_wXzKW}: k9E,@AtG0Rzj)N9_~sK{%I|c.j@± 1fTG~!, X+IuLy(THp % A67B=GZ5D7HߙN Xմ~Z* MQ!lF!Dٛ&^aNG͵wf+dϷGޏ!b `7>NQ,- [8X9kIQzskFwTῙ`1&iAXAS{`E Mg]VBP7RR /Ofk[˻cPj#X(L+Li >"[:; QT픕^Jb"VI:&S+g66øuVO.qVQ RBrX| \wg>٨Jӝ\ *૟B+ lwq-9H],;R,\Z\-fy1U{hSa)JD5:{5"JO dn1~k"iN6|ZJik*CЈS%XCٖ0ka3,'F`#qR;»f|s7vT (IԸU6J3:e+Xhe1ow<[b@6Mh;@OfI%4Iy[MTCѨ>#6VKmNz a$1!$@\llВI!%KI f65[cV"нJ@W` w$oJUOЧ-=/.N/3=A>ح}Qua^i/~|ãT` 0ȆHArlavVz9yxsN[kԚ Г9ui]~.WAƿg76 f^AC6 P2alt6Z~?0aiPʀ%ſ.NU+G3G>o*'xw9fD![. -ap$t+"^ 㽤hJwT&X }uFoqӆ=Ud*nq|`Qrob A ЂU;=>LG-g;~,~ o:ܕ8DG`VgbP}ߋX]?1 V7gДZR-Sg 8,$}8\54s=<#\d3emqΗG]ݗUE6N޿>rb̐$ 20L.ϖ]zz:3ܖ5p.@9Qw Wy6b|H"謈٦єSۚOA(}zR+5myԮwje\h֥641Co!! <ؚ8b@ "B+}c=dcK)i:RO;r*0w?=>=%5 XIL!~eZRPvpije/F_oK|5k ^.ğp]Oz惤HB$ q!yO,E' S!.TϘ>jNY*qĬ' ƧUm^\AKIbm!"H IHi 3'b#j' z $s~InZiйF$ [ZHI,%CSi%t `624.e. nn$ H)`Kiuj$!*hĔ4K*_%~s}!U BAʹ01&͉$CVZE @2逥Fa#g[ʚ3ZiuiÜ$R4liA&qJ7 4 ,HEf?މ%m1}!X,_/זB2|hbUZy<kL;)ju]cMskgE\\Fe<=A/mJWgfW3 Z@*^{QaD'^TX˔jAxG}F OL{86 'r|C.t\ 8,KO=]g/prr::cZgRfG8d$i9:A[]?mx#pp ;Lv<71j1H$HMXղ4BB!cY P2+a B-b@mUxF U Zy(HCV]Sv/X}b'R|LG !U: 57oi~Dᵬ,׸IDD)"KBֲJri*C+W~ΑVfKЋ6CHPД2ν2x8:gv4 mX -j4ӝ@TXlAH+I !iXVQaCHC@-$4d@-CFɈZ I^hB!xrMl壶䡝hTNQ9Q:j`Xp%k(T>[abWˮZ~^ߓ`i]sB䨋wo{[wFѽk*66)Ν`F75\0|W&{ 5>^c׸A9NP~;%#ҥM yEY] Ԗ8{uүUeri _e!4/.u1?Z,.,.Melh5IZH!BG_wwwʭc;W{z's- 0B`$yoo۳,ݪ+dt uY!Vĵo;;-Ӆ$N! #@!J]N-]]JeMc0Si 6bZϝvQi X rNK&:]/ko[ ]\.,.1\8IS,QlUꄐa6LJl LϬQ@A(g8hDjؾ$ T|OcuQOC9j&b~0Ϭ"B)A4oV!TmXMO?3æzF^q*?X~E\^Fv%\w澂zRBs N}o9`,}!jgYj&`xK է<6bak(%MDZe~g]Dp .\UH:w\,HHBDGg7! c'Ӯ)1ds/nn/;я%umq:uG9H[ܶ|KGZPqPnw$"|/q1j3 =~nF0!G3@b9וGVtщ |:g_XGWAg3 Nqjvdg;}ʕyK{qap fIMmJM_Q 1\R憸DEyʈ$tՀ&pdkJ ƨDen2|^0] TL&(( X#5|z얍, bDZRaF@`im_獷sƫFws1GHxخ) SZ~^7WUAvvܴhmg>sa fm/ĭYH]Hٹwwv4Gl)$ bcY9x ؒ#)H&lI 7-Ѐ ~[T緛ab w5'`0/0s\<{(fGtBaЀp46br*jG$+ާ:'t 5,H&>{޽^o#UL ҕ֯܉?{>ykĝ3MH[ En^v #d0.:"zHmVj-I}6 "c)n7$KӴ :WiP5ZG-N#sk ;y!`0`H]?Qz !xmq޳_duwtY{BjG5mVcp RTa ^l_:-Aȋ/^j^M\VYwuGOF8 ֱv!@T>-A@KQ&瀑,5n_fѣ8/Co)2^T.]E j%uiDB3-=M$#_*YE,N['Z}kAT1?GLCĀ {{>8yI U&KjڊSlG}4O@+oYTIZ}o4]7!##*U]/3*ҿӯhoP%|JUYMWy3#i7 0V^oqU|qm| Qb =!{4am?ߦY%T^0M@'E0eD7HB fB"enΊc0r88RtSF;|C}﹌hLUa) ۠BnP$P[ߕ{[_A׸xbU}/~^=q u^ꓗ5je]r3"s3_!O90Fj |k9U_4>A|(!5{֜ߊ-u1b[ Qy8!`"Q@^ jៜaٚcc7?R-"kZ#&מ^O F<: $b͵{ӒsOlrHJGˤ No=`&?B`H<݂Cow݂vAZynH7ł?Sl̫Osڼ_,vJ}ǧaԭOS!NMY!B L[&6%=:\ib," }ܾݙ..Fy*|mekV4_o}O9*UAAa.lNDF|CA 6)9*jBb5D*!0b$1Ȅ"hIÌ`C{1ziv+"z,2Xuƨ|ZH&lDf)g.wOZj&lyz<ˣ"0^JZs %m>EIAHEF.$49:jS7;Sĩ8. 4Ŕl/nӸD^fp>b2< ,nvR gzBFWY[4<٥?[ָ dȅ#c^C#n"B6%PtkVPӋn)kVCoGOx]iK}z;'oA=֩><*Mt Y 5 Ft~%2N;}h^cHr6&) ~3 IA>7LI[9Nx\soYEÃ{[TsIr׮別B̻<m*d%, 6XITx^i!u0+A3ݤ_j3R/ Tc&>Z( )%Hj_rS[IFF!bW5Z}mB5]"D`Xn}obp_[4 3.ԬֆN`[µ 5n-jR;u+h)g(R j'bqy{܁qʳyj(PBgLu4$ s5.}Rz(GF2{t ۲+ ҫE!ZMk&仩tm!) ȃ̯Wnl[ R4}hiyQlO.똵pA^wm$!KmR|擞Kwl'&T#(,0hDZDllm$7Hm)l; C`ѭaC:!CCj&*MbA&MLC3DE(aC9dgc!_\m6W]?*feXW'#CLmFT0.}L MP>/ln[bl[ bXV\ m@]ԳkKs;F-Nz7W-'ĒQ!܉Jw=$|<Ҫi QQ"i)HKP9d'k6M" W BBD#Hd:DC%Ypcbc`˃ v_!D7+uj@jKtzX[+\.%$ r^ ЊHY1jI` UwLvUeȀEqѣivC^J[ҝyk7J vmu]%R)~ocԐڀ [f~WJz3)E׏_[4j3J%,3Өb{8# F b@1\=;O;>%ouVE١g Sns@! X.C-E6f uSG}RI*X$+L@}q%}I!px[վؖ}ʭݗ/6o]J8Rǣkl+ ZF %X #`. '$qa:/]S|1Q^zXadW*׺W'^

J#\EK@ }nܘUsl5UZ_MrWZHD&ӻM$484i!NMKlm[@ÞN ^Ց }+N+G/X3EyNk[5qӽs\6Rp?IY΋gz>zQK4W U\I;x`Zn( >%Tbx[?r:dzeZʸgB\@-e Jz|c?^D s*7!;xdmG: uUh)]F[B65zRm_êZ`qz=SF ]`F H \1EQe8ME d s8TONP=9PG -gj+ AޕG&sw*q-xoꅌ7'X* 4t½KxM}>heؿ{sҨE: 4kvޢu%6k:!D{=_B.sVutXmªwUDyXBDЪ6u 'QQdp(`8NYRs= 7AXtT(gtt!b)VYnjaÜCC@?Ssnag-WBE{a:)C̓@!q=:_Xxcr[ٲX7䴙G+X7DGn֊xVόJKH т?2DE'NT ;i",Q֣F.Xe2WYiby(ؘa 'a`= ܖR N@|(HB.QʺWOZ?Pc5*Q(Q!ܲFbxYO誇@y7zmt Pz UgIV+0U$)7: k34W[wyԝ6 A\^_)hJvѐ1uQC!!>k >OZƈCbb0gx?;R`PM/3 $G.D98dٙȩb]E=ȶdBi#w&$~1-Gv[z٧uΡo!gQ2c&Il>i ΊWL< f'4Oi΁,j/ϛ[o?F' }|SS1eI $2ޝ~>w@2@Ufdָpq=ކvl߷עϳOsHY }imiCg-Ss W(<| a{>hX[,;n#U w=:1w:8Ph\gUw^Gzn  ڮ$酶㣒!Wؒ {{!j#V8ݜh_r`8]1r-7Ҋ뭋ޮ5z! klvUm$Tv4AI6z>.|E7d$z^&H;'0Gm5 b$ IhV-:]wlYX7III/AB I_ƹWKvW^4+K/by[K[ĴH !-]בIɒđ;(I?W c4b s6R aY#[5x,B@u{C1([;z[st8ϖu OspO A%0 RǴxWZ3koҖ]n笐$ %=Ӑ4@:_8)qժi[d/Yz86'!hU4"FD̫.̱ؑYtD1+ ((b ~#VЯ>.ΉЭ7]Ζ}b 9d@$F0p-N@5_$b5#{{q:фZ|ª":سATF5<omkRoFs>kqd↉h*pѬƁ LhT0ZSh&2GeOCfEÚY2v*ɣj K-HE-$Jg #CDs֩FɣIDc;Asn_HOA_+E/P;9eCOc,ֻӜW:)n*i$g (lG53O#xͮb{V\/[ERkHWM9z©4]U*@%1M!p컏,"@:WJuG;<ͽt#8]!qbS7ٗôAn@7BPWwtp ѪW|S&qvW o!I.'7%\VگS&7qx` lJr/ ן/~2-ф#sѵk\5$`j[lfzÄ7Y ' =ls093DrN؎y+{tZ%{7l|41Z*Y̦!BՖq7@ Jʣ2;ҙm*H,gy:阤2;-goWO]dGuYW.>+ ٴ0Cy dGM5|tGf" h`ZT,M Y ~-V)bQG c@ B/2`@/h{mXI"whmrHo/x~ Kzo?r|oB-3繷SExeZf ;VCx#5·p#H3EYȧ{zpn0ʛOqvkCo}rfJkk [ÀԘR$Q`KOGIE<DiZ 8qf<'VP!Wrh5! ؈h@-uhbхF ޢq~5T{{l`Z&1` x]l>&r Ab%٩v[.k0la^}4=dXynwq:O7tƐRbP-k E9`+ݤ3Xo3| $+Z!%!,9\\LJ. 6d6'ȂDbXc>ǐğ⭂ױ*M)4Zb:69vd鞲f,44K>[~1jsBK`%^uؔ i ^ ^.A"g5D.ہnkp -lc"% 9*t4vS*a)r pxl+n*L*gXme6D&6zzƣB2>}'#@\597UQD0ɜ# <@_\w"19U|uS> FSj^R `-@s :/% NiQ"O%1#~Ksy3'54յ.SĽy? Q#5$y9):Vy;@f|\Kv 1U@٢z6ma93Ǿ8rId IgUɤ:25`nk T"Wu2x0$c+jz=GWxohjZے25tleYd4 p_H0J%n%&Nvqpf+ecv<|LyjQby{Zפ`c/]<f _ɀ@ie )><@ ]+P3O:2wnÜ1 .˃S)jiF%ƜLP CϕؚkS<mp:.'9JAӐRvx5O!Ѩ:%.S7:|Jm) ;ףL蓇R$2^#yζ.;R1b0#45)pznf|tsp=m,ōLc`7v+x $~6/1@1m@:BU|#ȵ" glحO,*vdW9%6qe=3K{ކ}v?a/{ z9nN257U2N"mYV>ǐU'aU= ȶ7½xQuoa6J9.8:% @NukFm"# $9:sbq(@Q-]:g4PlHP1L:SxceE WJCKˀx֍Q'7KPnDV}ٕ1nnНwyw¬:p_סd@WԄ̬vQ'u ~=sݢmZn_|C"v"i/&3:駑GW^( `0[8gOvOw'g4vCg5}ŪƘGQCDk UxACHa-OW|MVZ!aN0!h7*XC+aťrQh؄DӣK37:<''WNg8kY./5}ʗ"9`ή裃P#/ ѧ\+4!8JVU[M׉Zo [8q l[J[|tԖF34,k{\lGf=mۢW@ylԴ[ =πqm)Z(W#Ȅ2F ssMNC4(W5`L0wüe4icYתK $ŖP.KfN*k2~?{@BgWn |{Boiο\@M$,RDuCB7\H%APRTT9:-UNKy\Gk(y DcN_uiV}J6V !@H}z^seݺcD5nq) SY@Ob#GMl寧 'Ʈz  4wN.7tcيelya0/4b#vyl֓cqXמˮųB6tKBEF)+Ok50yى#r `{NYǮOqޤ |$M)noY&1f?%"hƼ)u.?9Zt#/%cC8Ub)RJWۍ{6>ݴɲw=є@T!,"A}6RhS %? 53dGa$'2&_dߣΏ\Պ~Vˣ_G6P!{;ZDf9۩v PV#_ ` +D_qvc^,1{Ы!H1^ZLEcͱ_KpCȀ*uF&^Ŕp$mZF4l٥0,tLБsUy2MZKV @nt sk0 (*09iU]sq O{èbf(0&l8;@$o7W۔}F;d۩!z pޝ1&7Z vxPs-=:@m;c9%Z9& q sl42c6q4-IzfX5ÜƋV` ;\&:ܜ:(JYo$8 Zz`zENH.7{bu'pNNG-WX㶷H0lfB+ ^ Jꁻ>n0b#YUlfTQ+J֒n#O!!첇ebziz̜=\g_F$,$#$61̹j4Jo)[ͮ87r",Ύ@!*F/{k AO1%VFHvP-G qƉHqQ(N /S؇eP$!Ul ?*lsj& p71v՘ Oj~+XFs3"p61`5?pMyp KTu:#+֮9fjQ8 `\N,cTbÚqԢ6RyHͬ]W3Z vߵ{D([BJ">HUi;  vMw iãbd``USe6$ //H~c~VIq0˙BҿLY":ygbծ6*4Ev6zy7x_ݺ>_q+gsRXr3nݒ 80Bš螏;aXSugU\3wcl7{vɺ#BZ"=H(2|W#1(ĎKs.]£ ⼗z_ἵGm)6\ ˪%ݲ&|s3Y$gdAwRnyHj߾d3DFL²g/ Nn}9Dߦ5+K)zɇ.ugWl *g3~7[ְhN"^s m}22Dx""Q 쪚j ( n7F@6pef8(ڡӅ*YƧ)>EhaI JWl -<6pdg w+_klkQIy9q F!% Fb?STO!W"FK%b/)b 0Xb1ƫw: +LyX=OiuKrU^;WDY^bAc)zT{t$OWPLydVs6 h+a$ ^@ 18IbT.M]{ ce(rFŝ0m~냣\bn66$^/Ob"^S_&-7BĕPd1jE̜Ep(L.Qvhpn]ZE E¦ JXm^w=B%^Xz >"睜;Ԍ3ҍ|܌4kZgT@n=?.JxXX:UY+"3#-CmFkaֿsWe `yLH/w|لhA X;FYV+i՛Jdj%s{_)?nז MxęT{pNpG9>~YjB fz1Z'g:v؜m8o5kUlc<kl2N_ ./#f=N^LEFB@J=N̥x=8 8XNpbQoq*iI/i"me3-:l\]e0ZbT5Жx4qIT#&umb{鲋?+L9 ̛Xڒlipŧa`4:c\A~NC),ϲ hk0Bw5MW4>O@sNocc^kK iN(QԘv7R6R"J'ݞҨ2"S\܁ p,w=#xp*/9%4- IA@H/+ LP:L-^gHN^V6}L}7BOBDwt(X ̠u"{Dz`!n~iܘSl,K E} Ux.n-]~ l7jAK9x7B'uab),"\oQO'k*tsBƽEN 1AkgJƳU$Ho^;U#541$N#y[f=q K EY>6 eֳ\ZeJ61ߙضj"Yhoװ#~l$4l+opTl X]h8R:*)8P?7m= kCOjMY9rxH[lIOFF' w8u="pj<y~hjT&ܟdǵSB-Q%JWlUdc+GEz[v'8F|Xkl@>r5'*6ռY36| IM~+NC*s|ؽTqH^{9{;o ;3%5C]Ωg슾E/}"lhe].ol_Kپ1jbo rI\MVq^3YEf+% w Iu jTb&Fɝnio|Y)EC\XsD①00dP3LȩGb櫸y ʭ#RINJD`aZ(o뭾: Fj!+N< '= .rS!5Q So<*d|w[GipJgV&=goֱQ+Uu[ le />Ju.#hSMV%5wg{k=du6dIB8IC|uzL ҦioEڡ.'8&3 &=eb*kil2r KX֋6flmm~麛 2_xK6B!@dNb9ܻՎHHB9^[1R=u :wb<~JV ɅဩclB&7"i+gX7أt0 P8j3"(On{9tZgהY#Z-zg@ZYhcyS:jzjI5Ϸw8<3DXR'K&gL4JaHʜu?ld`bS9_|i|_chi12r@#e}&c~͡=fv^OL `/3@΢b`!œpy;=+m*'MRNA7aµ%ȲKJ}& s I˥I3RCy&ҸWШBn*2"E=u& hIIR&(dPRPIH$%4>yKm_?_trIfS1}DAeHMUTzKp@ U3vAS0-E/kt&I?At겵=!8~v ?cE:Ղ0\~Uũ=W* ݞ: ";7@ Ntd!ScdR.\DG$SA'&LPyIdѹvHh,k4a=3"`aΏ7]LFS NƼ)/w"JkKQf-n>K%A!՗93U^&qkr18jp cr+ -o|)F@]8@%=͂uR C(([x(Z֚X<@d *5{G3C5sɁ`$8J vtlq{+U؀e pedC7aN KZ&SCqW@Ӿ(چ<3UqFfd@̕c}ĔCR[~qߩzBNER>!g5[=ۢHa{[W LB6MieS:EαHNZṻ̥o92 9 3+V?R'pە帇z9)(xl*ݒ1.-oۍ:VZahV7xm2 ɹ$1NcKv IDЁzi(@dչ$Vwb8B[Au5{`:깒]7?~ K1֣qM䂜&2vT/7U ˾nY17{=U6UiX1L7X*Պ`I__G@^n6׌+DNBן҆rhۦ$Dc'~R忓B2rNgeSץxc ͅpk!vv2qC]o; Sm{gؔ}Wknm*-W..Ƨv^*alW!H]5J4q.0m*VR-lSi(Ŗ^eVb-zuÂ֡VbI6$6&wۡMih ?/@ ؐ`c9v]{(y4G7b{܎FuO>*ܴ;/s/L4y0Wrҝaew^"ENE ^!YXA\]mk -kz,;<?U$[!xwe&nHh<bhEelt7`ʑUbmd - Oe Q'x-&1m`j ,BJ #B†SamÖՇ)bLK65V2i:,zkuS ix˗ x~o-j y(Ѥ;z(1h"R*=,6>}&~boo^48q_I E489E#7yc~C¬i U!U%1}7YaC#J:Sj{us2n)T$&"M ǑD1#cQDzr_> pҲ^*{$ǃ]=ZEiptqHD[Frn PQo_ZB I :~)&HvU80~ ?Gb|Ǵ1Վ-*%-v_fgg|b p8ѴE~NM@9@ꜞ}.ktci 1qFBϗ5~t:L|;_G |`?yKBe2um 22fB5^LJ=khFZn"4|ZL)d4/8n?\BĈ/J.3M9 J/n7Ummu5S;=`F}y'Ѳ ?>aƿn/6M ) Wx[܌x--«s><H-^mI<"P=XsܲMc9n*]OY#}m̈|[^BwmL>%`2 3req`$O'{{#'d v;@ij9wԭ5ɝE,.ʵuJwV2p{=%ɠ.P`1 ۾b5+-=DޯY qq# GeG~IDM$ˎ"_Jd캺 $y|PYJ$CsƳ^C%1A~I^-7hl[Sc?=Y\Mլb }G @2N0#x o|}M_O+'k%p q YoT(lguI`O[T.p WeQzh1A.U28qN17 S;5<գBUmS2po486ʷ}5Y V^N͊A>smB^u* k[h0Vg ((0qak&>2X, Yԭ"=3u]Jrso]Sf NO?.8:6a)TBwxj@jJb 8Z{k .R22~bpW8CCk †.sZ&)Ȁqx8c5g\c}z Ldr<<[rS_^84\xO"`,!)/=6(ձ @j&I4hwk21d>C)!~%.Up qCFA݈VNoe51h./uE1z vG>'ͭ2>SF}aD8d42k/)ga`;^xe(wn;[[A%P BFF H4* QR-BLH D$jDB5%M(kM*&Bdc^CWi+>cIJ?i 0؂z̭1$؛ ҂LHDp[ |I Rk^忽 MS-$v1$p\<4y~[ŠhhyXFX~M9DGs2db@8-'i^MЃN4{ѷcMѧ58[[#2glIʥrO":(K\p cƌ5Tzi*PFu؀@W{bTlҵ1JBt$x2U&М=rE0$rBAi]x\Yo].:a) fPwF<'ծۣ-+3]"ZⲰR$ʢ+pb? ;;%V3G7R½PQp᫄l꟝ݨwxR9pt}qBL9yr 3"g駻[OvE(%4WcE|IQEs:#VsQ\`Cs)ܴkG3OPo ^.pp30%Ok R1qY͸7:Ԓ" JPBkZA!7mm@q *#s9:?}5Խ)f` p'K(GV[wy@feH OP}XT=Hju.MlZ10N.KYqDMiqxl׶^agAKR 0ZKzFF҆u0)bJ$sMc'XAl3f-V @ܮDpnL^RWZ72 J⊠seߎ ?6Pxy-4 ;6mx/+f՟Xdv )ؗIXw%$jޏw-4 NuM=υKlA t1)l ]!2cY(U{J_`^ZjʠC/!{Iuє7Ϡ"]m0p0E׵UԮ%J1ޯezXIA 6%yU0k9z4˕{/bO< i c:^O&{A?A4/r-1XnJIC0)͡?-ʪQ_#‘ bt!+递RAJcu6nfykˉbR:- 诩v%cD&._Xޅq|=9tFژ_ޗ6\UˣUڴ1_mo j5~Ē2 W/Iy8 8NUDkD7 Ji(e_TH%'wyF rP/̫|FJQu_bf> Dbr@jĥ ͎)]>&Q_+㣫f[kצV.ipϠgY+-Ԋ9YVeيj3H{RG̔m #~je7Aɕ%7Xld BJlR e_woF/Ve.Kb{N|*؏*Vn^\"`}zk?˹99*C|zY5rj>M-YⓆ͏:ZӨNQ}T jX8ʌ/E*!c?TH ^sgGPLCl>w QՂK@RH w3I!WQee"ϝ\q8'i?1ɤ4DyHN#{dߏkq+Z 0:0, 0x A$BI.yzXMШ5!Wm^Ѫs8GL #4SR`.^~8',uk+KskLt7hxplV!̑#d+x  (J5VG/pxK<l XP3·f ](,-FVHg?kB=Z 'he>$S-*1SWO360w@Q~$a`U4_`!ws%$M6I1w50ؘW(d)l 6,: ɡ41$?8[OZQK jkjqi7 Wn$m""$5@!B@H=@#V) H$b4 !Yk~ZUSm,ߓߧ!:Aw* 1)塚U Xƕ ĐUfIR54(p]-NGSQZidcIm DBLf#"mBB q @HLP5 1퓡)83 .!U!0tBĀhkhW+4 -W*W^r h0V&!:CM gY* kdX0y)Tɩ+%|RZK&rkJW0e ^_$:n!*7uP yQ??ZɼńmHj(+]l40L'$dZ"GRU? oˈCz^[ H>fɓY>l) k<ܴ_{uz B!{`7?l[ƈ8 umͥ#Ns/_=[žmM' +N\XyYD-z1L-Bˌ(olIz6x_rZ¦ 9-(&VT'0znfKDzf8'ujX5& ̓l M ޣU 08[uK A44Wtͨl@6h-7GTd m]Aɴoy{C71d(D?Ғ$յf1ֵ+[)Y NC_)BGwFP<)&iYؔ֊_$ͭ J|lkS3Ȁ<&;dèA~^!S:NnSSv]V 2݌GtSiUBsL'`ǧ-MkW'NPf.-sAa#VXO6ܞ PaqƼoZAYIXd09O`bXP_yuts=!]+2K?g3~j|!Y0D?I2bx Pm`qjK bXWMV:F|6_w?f䗔g&IȔltH.h0}l؜eϚKC-u;5wnN٬ų*{?;juύ D7Ӕ$[rc禫מu*[Nn]l OD/[Sf@B a/(Tqu==;/G3d4jn[xTYCD'Svy* N-2z~nkn z[#V<^1df8 6ˤ0hvq5exC"jYi 3r`z6~"Tbv i .-B6JRw؋Bޮ8G)6-}먟XYp;w^Fk@.Al<[/QPXIfVHo(yBԁ[^\D^Cq%Hhi .VԦJAk"Z1fZ2u.@WDw:'Y4Egm\=3!B~.Fnssl 5+$` }?c`1xW_բ~XÞ[w[ .a&ӥ }9%`$`5 (c5l}<cUO0e,tL',>g[ˆ r#%},`C*Zc71Iʒ x[||{6RXOKG56AU '.KVI/+\{h)("yBʦw:d%a"C5ƭ(#%^=eK85߷5ߵC &exY$ Ar̚O`ld"bUA3G1bCV=|e<Mw<0dxR|I`֓i2T@oy'747-nIAN}o [N[ >&oӕ$?/^E@AmL3t숰 E P!>wxҩ߯gGٮMaJ /L8p64$0͒B/1>8 mWRՏm*u7ۇAwf/N)"cN[ Q)񰩘r{a< &|e0MCB4bQZQp Q@ 6 6#lI#hXf |@*`(`HW- #B6 bCOkTas`sI},yypTK9 4 ߚ0")Zr5X?ZǑ=hH#Wg=F# T.iԼ༊:XeH_K:s^H؇R ֳXKynP[BmnjcHaA)q #8OhJ-퇢«i%~;ɺMU % /9:ؼX1/Fp׃`$Mh .8~P"piaJ0R'ݗìe .o1]'+ Y"-_(>F=^`@h^Yz*!&A)ՙj!1[&4pc8+Q3m _*r ĩϿ-<%,D"&6h|!*ޟU4w1˩sӇh6Ts'9!9Wн%i[og~_aAaF&5F -e:?7QiL}Sp;2[1]m0Ƶ+4LCZƴAOXs_cޝWDvžu3`wkDߩܣ︖] JߧP;,m y0JP5Q8pNI\D) 2O8w6c.x}6yXoJD<:F3oev9HԜ]ps0ؗDMh8A^C}vO) 0?b1JQuL1 e:{o҅t"H4L('CQNqf[q9Kj+6NRnc8n ToCć4) mORwçNkT押p[#; 5 =ATdQ#7{ ^L"SW P z6P"Z> D7VҴoNWpJ^o0Qo:Y=k؄#L98lAE(AYCvf4{֢V-G "hG[EIRr!{>ŀܠ7wz}vEw$){b-[M;Iªڥ(浊.A(pKӗ׮-T7z]i.@oИ)|p^M5զl6WzXL >sSw.b XAm䳃Gg7VG7Bq~n&T<6XajnShl0:`H*` cNVb5ӉkbA] P"tރzիr3Lc>swiNϐNȾ+OCF09RRq"r9 hurgJMGqz}*CZзS/=!ԾY#va@Hpw_ULISHg.v2{hҶ,[(BE,۽@2' $ B -fTRG\@x)u}k H 4Jɬa}Y 'Othjnp{~cP!GFCRi1L |ƽe\ĬTҭXWZ]eIN yLYctH@&iTQ2P4N1XT>'^,,0 Z'lYwWlWD.2#Hv*|if%B cJ6bXNU_ED+R֐0AEEi"i$ o)ԻXEّL`EZC(4hNR- ):Q.@,!`H-Ola=UEI3F!Iwδd2JR@Ur -م T4ƃ©ѸI8A4txuNGUS+Wc $2ZNWNJ 扔P2ɿ{W߰AvhM69@4T'}W2\agZaƳƪ6ђXP &k7Jj.,Y*✡+IJoM^]izR:ݨWkwE0峛f#TD8O]F\䊋[zȡ Z,׺_o!ҵJ+͓SH"FԂwO6E:5Ł*5au)bWآB)F#/y ?$.*yϵ55Yn\h6CQ7-{ZJ˔h}2b (ASEHÅ*گG~8XCDs{ ..NO0H+kPPM$X[ 1 /RvTU7ʕ_kݥj`BтkݧZ@)F \vJ%Y?RD]REv75rBcJ$)џKVio\F{2x;iח[])|6bbVIpb4EQ(wW`. "\jteN0@  ?O% L/Dt9oT!EkMR>9lPhO,n֣ ~n2Z.Ev}VH S^"!R kp~5#!dtXMF ST6.Al1掌2  ^'R+;fսgQ[B|6KA3:*w~ "&bB0୽e|Nd*71|J3q|ӓ{SA<>sQ GJ)̯> +wn&+J03ZPR܋~%yuֱxO))iqB3"dpݩHXV]{+VlZDڍ qW' w ܞ7 ƭ$ *rjtw]p/w𥻌ItX0Y ޼FҾIЧT(K:?194yGPCpZM0 \^a0=rq$jEůpkM(ͥ''pJ>AA~]>Yqs@W3ݓHs"<sMw9&)Y'pe$հYbn久qsO L%yO; C!ȥm,m1"Y2 J ]o*LdfdZU#X]QJАF7TN 001; _z?I ۳73{olٜ`¼"j dF>os]۾ |5Yf;h!b2Z7>H>0p=QfT^.Ko>Jp⩅|HW(Y+Wo>(IYi ;r0|OG1ee_gP+`QEV 5]ELٚKY_(z LQ.lؼ1} j{J @ұIRܥQdND9]ZcX0|r,K+N8 }sUNo@YGDb3Jms(Ca KU!UZ>V6iR`a|yR5: a瘄i r$1ʥ>,ξ bcD:or^< 3^_>̞Đh%9D -*qb?FG$brӧsGv9!1Ibމ5-Wy`KI2.PC$ 6!]ƺň*\+YAqڶ˾ M9nݚaWk;|, ޗa0%I#$*X YtLB 6/2Џpٳ! 0JXq\qg+5BXMׁ.?Lޝ< S|i"ёWj -G¸)=UMjXbo`I9\Na;dM"0D^ U[8EUlCIZܫzy1c`Pd0 x+<[3ST*p!w8~+ibO.|Eb\JkA(i\`oq6V?kO>U#ly|y7J'Vf/,f(:)'Ju'!F*5wiz(cs}oё ,z8pŰh~/fS 5WI̡96LJ,9vOmtomz vШtNUXby(ܺсsk 2fQXQx9AA-,$6D dž|4|<^RЧp9gDmC GtJݢOsk}$Ɔ0]Fm+M@P Zdq1HAЉ)b0&C@.c^WrEu1{YOSKcGU5o,rCH8d"'uT䖓w !B¢B JBk#Q̛4| ]uo(}6 F*>711Vj 5hhI#rcZ)LK'<.7:.13@($DV#*.HDəhW0 ˤcg7̍K'^ri(xi*;uGEv hS_fWXc%DܬCj6ޡ != ђ.؎AfW̬P*%҅布:j<03JUr*4(z w$m:  ktf,&uba]XۃGh4y{r&>_D#=k&B@+Ґ8r|>vggu' ^ d,d&kɿq\4r.bMP th (fDFn833Z&ħVčRp ~^c 0Kh6EPQ^x@,Rl:AmvԾ8tV ;] #ـ)9x[.+8/8ɲMI{ߨ$XQ un\hKpK5=~[PB!AAf"x)Ug9-z\ OE0f.C1%3$2~&}!x먐,%LԳeo_8()YjpjKat_ytq1{)IM5u |";6j9K>tN{8tnFCGhD# Dr,]I.h“2z%6w %\% '"̈́B]E `,p@Kh-I8BB&"U[墜4*\d" \㥙t&^@!m-14 1QrrZdJ̢$m$`Tᘜ+O(و MwY~n"NP83Ut $+ɉo䘲k<>bD؞D[%'s΅Csz^##q[^@/~ #u-<+LI {/Z̉ <\̅i )rAX[ǩVgf!@94si DI$O<*@aj@HT)r76yWesB4PXXl'6e/Ư,$?Yf~/^gSheCc!(9b,Ӧ`$EdB >ɐK *ӓ3֞|~uuUZD`HH/aA{\k.SH0n;vuuΪJ1]Xk)SR*qbrf.%' VڪKjt\M~}]-7L؁\BxmAS5)+VN'7()7 S}]UDu؜ KJmCj "+:b))zgbnZz+B241&s 0bH$$gXRbϥmq)=:_f3-ǫWչj7Ay8]}#GnSBBEx]f۽;~_d/ `[w8tGzG7ps@4gͦջ}_>{:k?='g%Zg9 rHJ5 bb//oqiƐ+) H04#HDO@f"`l"%!M:TJJD?꩷$j(^b&f"wEZQm#S(bREɩ[,ף]:T"eCBH(1"%ЀIʁ"ƐfVUu[ S`=?wx> \81@#a탿u?keN5{#ܼg[MYi+ cX|QK{_QD#D4V>wP;ybwI3lF";@v7'q$A߉"TP>5:f3^REw[ $iǥӎvEW}묥1[|E~.BqY<6K0_)wڎ6@[DN5t pO/ɨo0@@f2 %8@B:( . *|IrAx :q,9wև-i3f+_ .'+$"t9DyD 滐iKѴ\{l?2$ixZ` JW3S-ï-/HO\.-b/l X?qLA+ł\1ɡI(_&&gIՊ=.aJuCrq/\X7Lt +So92؁r{3ŠaK/WezjE0N d~gT6oK٠yZSH<+"{pO*U~dv((3}*׃i _ç]ыpkQWlOjǏ[SQ:~vb,@HZ&CcĸqxGZЭzϡ`jQ(q(QcPLtld?TS?ݿR`4aJ}5?+O}ܸ^uC##>a3jEnvSa∹ϺQɒ1F:Yfb'E=U.E?GRy:PVܴ>/B[ACu bcX%-ak 0kUP_?Պ S'c$K5u_ZRBm?tbN$;FI "9y R`# &P@S(eiOw LU%DM=edCmR8w4DŽNLsPi5U*h!#$OE0tI# Ja܄Ȅ'/(}?e{Z͍;Ʉ ?iBYyJTl:>Y%5 =XLU)AYvޔJKsԷ/7lyB^At zzdme8Qjs MDțH>6kY #r:}HU[⹮3~j_-@YipL ,Ey| _aa_lr(L3IHOn0zv 4Eђ9mUb^"84X,.G`d" pw `T\m2:^Jۀv?HA ] ?q>EYʝ| _rzNvg7b cEB`Y[Z(#/%#<=&1;$VvϹ+-iV`*C& 2XfCcP֣\8gU<{ZEY&(@ N6d~S_7BKSǟfM)8D8zAM/$b)7D*i_W=ȒhY^^r` 4draò 2WB $DŬ-/YT|)Jc d PK.rcs|PKaaz9CFm -.m7ծL^$m;*$)yz--谳(c3$餾N|BYzO3w+O}޾hi[\Y#T9q 8 "DPIȆqI#ڋJvm>oB0Ha@ Ǝ3W};?WYG8&F_^ ЕkP"X إo|>_yai}0vD{wr[9k]l8 ڲwƉb"0J+яk A @;vf ^]ǥu_i6.0LB P 0uӿh <=KwGV+|)z^`QzjeDb (DjbiM?q$B eG U mL9ڿCH֬tfxaUd#kD}G愵n 6(VN@W%BxAҨV _o[rrʠVG=Bӡ7TƔ&lCK jM@Ɔ&(A b2P-͍T `sZRSHDoڒB *UHE$&*1 ݺIMM7(H&uo_ ŒI@Sz'782{̒>vkuG\BD;n*2i'h)W`\:|FB<̂O#7zě* R #O6}=OkB."K-Z}l1N3pgu';/]hxuA!ZbXl4i k}$.jFw}|m{Vn_t*e9(dud*&DHPɖF=Rf[JB "ZM8mpy+Mn}E bV‰dm)$`(\bo 2$䙭w7⸍r"2&1C(W )U_ Ãrbt|߽6B1 [$k?Hl ?3q:I΢AT7ÿ'@)"'~h+~-yo\1.-SZW8^5Y,bM4|'e]Ε$x7迅BnfW!`h8M!՜[8xwv3FE/'ȓzf7h,WMC=;2mCvK 8+9&R 9QW8 ЇwGs0>oaq!,GCN$qy9ms'ݏ>?q`  e=YOU^~/K9:g@!i$wJ[bC CϹM/:vpCwTQebEz4>}}3^_:l>ǓIwqJ5}+hGfCƜBn̑. P @ BH| qtȘtOu"`K[bHlb$%ִ`ɈWڬXi"mzgn} wttQDBڋ! ~=o{Ӂۣ2EUDx(=)%P.ԾQgV&:i|gɣ*焳)O<9H]5a N:I4=L]YrJzZÚLoūUN^sI:ozN?+]v޳V^CImBlXI aGe$dFSh"%4)J%@"_*P'D6K 9Y?8/m^譖ļ5it9X2r3x~d@,AdCBՑ\vN8)ދ)RBt }p&14$!6!6 16&СJ1H!!fo!% hEiA eRWGXg/8?nf'|ẉu`s OAnWO^] H)Q `.=&lVC9&+G ,BhSos4!*M~}Թ]_n,\X銍 *1 -VG#*yZ^Bb..<"$TBA~o ^鳃ڝ];QیZ/"&˷uiE D|e7a MM:{#V|"p_eVD&888_Z53Ŕc^ZlR-%W5ʠ*>:x5 <` g1?E +j9S yw`T&d_Ee)HyV}D,weIE{\ggESVWXh8:f.X*:zʊzX>d|C~rL=)} <@ ]4OG[X5-g]ok[iQZc׷g|>tpNkaa|Wcip=Mm(-Hg¹ `M9Rc;P Q+BꚈ!B(&^W, \@7e+\@n;LUgWv2J4Bw]z`!z3c[R֠e٭P,`l¯S%dcu2;MB5D!;ŮdC 2)80WTe< 23""XqB]>W%MF_N>K ~HjY0JJVihR"MY$f%uC=SHgyI$ K u `D Mx%^GB;uĜc_p%zGA}OW{,SO~)B`vq|_tׁN>4YvA=BjbAs닜M!&WX y'>`@|v 侇cV˯=sk=Ï":Y ٿ>^S[q=T=~?I r}eLH!c6=o@x |=gcҐr,ýhXM$``w3"cU ,Ԋ R\+REjyNtꭤp?>橯椸nZNqS][E66N*=h2_> *"lQ/}\ y.FWms|ޒ;1m2+9\ AH>@6e4s=>\rNd(!{)'MֿBsܙL(56w+^ID^keI9OA'z@l>q\QG4C-ܛq#!Ss'i}~=H1Dcj_3,   "g ޚUb~ -j $n$P)2:jms&Io _tDp)UiTږnn-ZͨyW-}E1rRMm َI_?~<{ SVY3ive@hb4F{Byo2Μ9=Y!q}AȈ'! rxa9ciɭEr o V8~17˥cĿOQԌ5,m#YjΓs}&X:dGUfGfPN0NsyeiE[uWL㯀"6;ŗiLZ@K:;՘,3:/{ªY 59!2 "̞ $fHяHOr ?V$ o> c Ō7?ٔMW$2FBo)+"*!Bwa:zmD_<.?W8׬w eAAyjD@V5cf@&N q|z څc L L}=}pxp4ه٣Jck) y{έ[s0WmL⦭͊zGcNʹU@Ɗ!W#8(VQ`PG @B':@h6iڃObD'K4Ds~ʀF}x]St+H{ L#j\2d_@. yQX_efX/'8Z{LCT AClwTPTmۥ- r^LyVNga%b_Xof4ºhU0Mf +/:%BUkEg}ް +m!K4_惿h^ Im?v^96t䂏9Jy\ )g?1%r Â~/5]׳Ofrdk+5hQYQym!/ ATH<#D0!.־VX;zDS;JHu_0ތgi/*Ǔ zWO;q}o?Hom] _'{shs\Nzpux۷ S\lFZi:fhƊ ay,0NMN"cѤK :ޫ?_ &c3zMb \Dc åqQu_o0rIr5`ө4+Bu7]XW]1$s+Aʟq[݄%S@"I!c"IPě@e]QK()~N'IUXoj*_)OhDCEAY)X|o+0`*x%MF$L! Æ!#@ťM*4F~ꤤ:`ծX!_WUCoT^!_?Wh-;*љi!`jI5#q^(|֣}/tXi@Bl-A DH% 1n^bPh:W$*ZI0ٱf~mjvhiOm\IcK{4~FoܿIB %(PM)?l˶7HSPPd@mK_XR,#.VtWb}ZwUvVT3}x]}\Ӭ~\oÕO|8s(XpJ霙m.|M|T V@1:wi'#`?jZ9p^'s5{?Ya{ě֑ YВ=Y<ه lY>h?/722Yh-WfD&#`=֙w iB-#EWi}&{77[\9jvڥ9) .BhcfR|n^5GUc8BC컻y/4`DG;|H4lLl3k֚bfnSHA D7aq1r|%airsZ@UQ o3GK;a*]=tYjخݥmnѩû :JBVCR#U 'oo&O?hz,!2BLY˕Ec}.}`lhlD}V:q@ϼV2lL` xVqYA,3\1;MYdWF4Z \ni)&޵k[d6 }Qɨ9.X-$?y1pָ7 SM5Baj?w/u_>u-ABYKf 4G,\ /CsݕgJ餞4Bq"Eӟa,͹2%6=^YNYW 5}.U:t_^i,! ^tocJTBްeN^ep/en&pHiDÞҳ=5w+}=OžyCқRh4A b=2A6 x!p CkwSF޼79?IABuFXBkn8p]q61E!-|7RW4LJR ~+W-Z[|2R)(JbH#-sZCʕp~mي6 @ҐY^ܝ@ ꣛yL[`P@ C_3Q%a?/(Zcu`/"qM*7}lKjȿj\fD s0Dh8>yobzyxxGiy52XNcZ{[S+敡Y<-~[O(E,){wVf\¯,e帕GKݥ*CtĠJ]kzuGU Bd(OAȢڊ9%O=k0W1zI_*c͌(x ؐ;W>־,~l; tV\^N1'9OIn7~ɨw,ۨ!Mj VTsG&[ܻq}m,nmt_2ҡHx6d\U=ʥ"QXUE&%?e 5 k0 Xno9skm!}P,oN:9 Yf4}:P;. сᬂ,Oi()@+6ic4$BlHlID4/s^UD^a7&<^GH)c_`'Oy!a޾o{hj_rHl3s #q"|gutQc ]#0$: y8~( "4 nq547LϩpO.u n}vp[N!ݥ6o2\dKGZM} .D„/pk :ixli!hy4K:*D# `L:V@`)f=,v=%j!r%SUbyx>^ocΨLfB+%//R"|\ZA|[3,ԣbv)sLߺp3P+Њ]e# % "bcEab٥GHoNx||АqK8$adf+ɸTQz F_;Z }2~EݮH<Շ?B|K,4f;ĨxX:y<T2!A vܭOp~z_` ,6 mڃ]y RVh+p%} m0nřǨ#g!xs+M<N\bm[hkHݼ 4 vЊ;p Vj;j?+==-w G)'Q:p֏+<;$jFjWi] хuAXE0Ȟq\ ,[y=u_+;eE;JP Ѫ!y ^( =w?^ \}qc i?'RHI $ІUD Zhce2Ɉ^vf5DR)2zS3ف>T'aDesCZHfH0?k"*1g y`+!`Rv"" >6oyӮS0F/>Z|N'wꉟi]?zeT#])}lYZ^o`8f'M[Y0w7ݶygV)w`_[&'= 1Z]\əl{T!~lX Ko2>^^[ГgVSZl#ǒ"􂇪B^Alӥ֡g-z{^׼ 2SᲯy=5߿{_s@k 90p j(q`r1oe#q! 7zak!HčU>rh8gιy@ rD8f R|\sQdB#"M ;gV܉D>i9 I&?#&֍l(!@|'7Yoyۋ/ϕ 9A FSKI#¼n,Rx1T-Rnʨ_Z!+z=88p` F WJeiVBΌXAl uKW@BO X g(s" ?v,тYuU%/xFo2Ɲ؅u3ޱ *QN}J}e'jzobTk= -&2*kjm9T !(Ҋ,bRхix\@,PB>I^3-U$I3#F)<%8HQn`[~ =*.Den \N-tBLZT{r!! Ve{B5TEOГHKu#<᥋BmUnkNi?g#]xА3c9s|,x5N{{^P H ^b$%$6]~!(飑৾{v{b&Nvۚ]u0dϟr$ FB  ݏq,lhm$TS(`SN)pf[,Gh4\wY a0Igh|j+!4< B"$}^ lm Y.uF>Y*UUF``?\(ZtOߟT&|z[ тB(7%*"eP_Y;W+hҡ=#AKMCeQBO""S' #$r>IQJWlz*xihEDS4]=j/&$jf=̀; m80)|t?u0@ hIqi:KNouwߛ'?:re.{W L$u}nk:F.Unԍ@CY t4dEowXk)GIonG帾ܢ#l z/S$"B/1$.r\M6 bE0^>H R;8J Z-$-H(xk1~"z^Y1FS9Qi`#]֬x@ Z=gя[BRѡo=ӿYLxlpFk6bl.c) :Ftk")Î?׵:U=R( n>xxY'v\m7っm1̎ȾxW;ͷsI04gzzAb|n a,nE/ѣߕ};?*vwj祦zq1KERBpf "@~)5Zn_ZrN&7akVK!X|vz!tSu0;ŏܯ@XMѝkh1~57o`M5 15XKK 8k%5DŁ\o}|b mX \B$=D^ (<~ZD꾶e?3QP0(ࠟ7RȒDő+9"JO3 rBУCx(1]1]-S<7kw.K|*zH6 '_sk۷%+l0lv{4;Gz=3w*&"ո(#u%'BX缵' QqB6؏̛(`'uE)mP\s) )M9]B{[21e[ѬW. zkM12xώ.7ʪF#~Yy>"^2Y @ @B -Fb8 C"5օ9t:f 4 ܤ̜2lEؖ96bhIv嬣K̻cHuD+̒tJY>d'CRY]6a7&IE  PЗMiK{w>q=2B5/t`Az N ; l[&JJJI4YzC*W/N}To3x5GQǽׯXI!]]ؽԔ ݰjM KHJ6%> rkև-(Q3IGMP&Lʤxx=xQN>[VX=2Ib0jpu h'Z($-"+3"Qi!ڣ;B<իg5}?˪ۂZFgW9!^hr`l`C`v 6M(`* m &CBEj:+0A$QB4ۢihC&N!~9| jH+( ]Mi̡ lK4 ͔$r@#%%m Wi%hBS`֐"^#BZ &&)16`4Bbm!! * i)*&HےPr*r;M_Nn7uBRiL.4 [iHm OSBIƃ^upLBʤ!iۄ0`[p26!CSJ44@ГeHm &1!2If琦^RmCi61 `Y=VTS`"BlMA0b"\+ŘcW<R ޴KLOC73pu\6{0@{[kq-?'1nGVfE(k* H%- $L {ZZR!^*֑ PC7u/-JL%0C8: D†$.̥P˶5\$#ƤIbVb1yi(eMBi!Cci'6*(mӖR6+ewƙ 6LAJTim &c+6g K.a$"NC sD*AOi)J*&&cB)RZI HG"T"@ XHIk蛱PD* 4"R@D$* LM %Z[{QĽm6koCJ *efwr>5ְEL9Ë%g9& rsVq>NOƷ*BU YpW[+Zպu[J#hN# "WKyJJ0" 4aV&! ǫA֔fE.TJJd1I  &""(?TTJa5w 1IW=v$,BgD 1"<RpHkF4#+m̂HI0D1g+4ܕ>^!>>lft6叝-&Cr%BX>Ӷ_M?b.+ כTJC&DErG )bHT?1m0"Əs"b HU3215j8T%=4ֶ*Jhg׷V'gV+_彪"1Ҫ$bPwS H<*QʦԩQVu"/qDD#)7v.mfwq-eEXn.(Q IγdW@(o H I`M;_}˵.J)7sE ?~Ԉq(B! )ti8ҨA*RjD5 )n>_?DŽ̷(/;yI ޣ[ݪXYcbo̷GE  lz|G4+G `fig?蜥wkI9J?L\K&b(N-So|ÏI{\\'CZ0ꌰ +kp2pHqD6]4q羁D;+YAKc:%4+_Ef_nE5"kO#B5A-ɹ{ahYC/eKpv;gWHj15=#lvRs o&Ώ-ˁX"P+FRK x4a2!{csU2Ȯ-βV pk 2PijX{eM1V.;csI"oT" ej gw~i3 &wLPPE7@dI@N!S|F%„\搛UF@Y֥nSZJ DŽ\!xhIb"Q>99G) i=KL8<瓜HMZbJg\ ZU(\[k׷!(3a ;|_`.z~e#"Yi}YGt$ DԞ*5R7DB@?<3Fʔ;D8aˡU QkB!,óI/Nsmmh`im6 m؀Y$IѱEDA@2NQ3RIӺJbcaO[EքT(WUKE i-  ǡҪWg6ѦҼn( V.)9M@AG6κ U&{(%7 x."id,'RFUB;SRY ]?[[V ޯ#_wΏ=-w {fV4W#㏦<ۿ)pyN)(Z_UϽ.9-vDEv /cFt2&8w/\}2yX]ڻ\uEz^ Ń{!rWN@!'媏|] |!m-E>i [bMhbR{F(a*$CDJH;OLfeFOs˜=U*%Lk9t>`qsWME1f`(U"2e "=hzbfå^Si7i)z@|^%:F;>5Ӵ*+.21*i"m(DPq!PjO*j޽Yz!\ߏKS6ZiP41qTGɷU3Dew;+@X>i^N ۫9L1%A7H۴qr3jKDؓK>4 GRj'tGkH*!E'|GUeIJ)$JXq=)8.n{IsƊ8{T%YmQ^ϤSӻ]e|&ĔAXI[`/:$iPQ؀ M@)1 MPc#\[3EyVPݡT2J"V!`3T8[\HE=$#zOusF7Oeiyx5~i*]wOeDŇ~89=|m#[ehʳ\u'[ݯKP)$L=U˝V>ȈpR ؅Xd$$^E"Ѽ^9]1{NݣEPXk`^_yՋޤXH@j(o ?0.ڸ"§=Oh#X-""&wQ{ Ha]Akhъ?)zρg_q቎W T%b\o pBaBi\_hp@چ\*iR*o8`]2 VmuP8!8m*/Ex!.ꮳmR4n /Le HHGԱ[9B:U1%" NG6'9 ԭH^SКlY}[9!‡{kA>4@Bqi=\Y BӋ;aSlc¨@2RkK(塢{h+@hl^=tб#* EXM)^AH2O?S=چuFmQ9UVրqqZBɢ*!6˛Q+?C5'AIۯ^ ZՏP5bwI#+exuY8>F,ε0ڭߝK^IzMYvHaPа2DZzz +1VAY S| ~o ^ϙ!``n%ISCj' qnu|yF7Ï4Ww]nZWOqRru3O2L@fN/\]PDS$if+;' #׋3CBtpo0%K]n乪M!„OτKSFD"G1}d*˟˓Ϩ%n>1|)eDOR,$ՕD h 6g~ъ [6_"xOtB'd{|hGPѢvгQ-(Cq a% 51~jnb*;$0nKp绀tm+dF]~j׹\nY@`c롳J3q~4UAͤpjwz=#0Z_%ZgwxH-۪C/3+Vr .2Ύ3s&=c[7uZ Ιrr v,''']"C\|ݯ!> XQ~&O!FڀQ Kb( g%1aJL|Y[6\6ā > Wp]j>RJF?E?L('-?՚$^$íHъ pg~>D$rs}϶-ƞPbnyƢALcB%y?aa|,] sD4@?%G2qNٺpbь8ux}&Xxȯߥw;w>7@J]h&7[veHnؿa,벶W1wyݯodސIh&(76 qA8.SCOѫmT Z(DCB V)NCM!616 `m&&&B4K5 `BP!"" DchcMI4 b0IClm14OpIm: NI*BJdz - &&6d2$ GVg_*&.7֭?uvչs\\'GZ`yRU`p'2`ׇyUb_8CZ ~GW]~Sښa/hٴ.=BL~[ Ƿ]7;*Do/~Cc/5P @\P ZE={ MH؅ܸ`=/2z- HB}J6;}B tx!q1@}Yh+Y0cS>N0L#,NVOSmr_yc{j+1 jkP12kN 8`g5I`ML. E=#0N[{T&N$qr1RAJӤcI &z}9$0-_kj5 s1dHSB*τ(9,R̴ @̠ ƛ (J^M|ZzCw{ 7=z/)$QD\+v9EƖf{S\U&ҼߺCh#1*]T!Lɼ&PI!%9Q2I 1cLcp! A!!1MbcL@i2BpS i6mcMmNզP mlMCc4LBc1 @6ch|}~Jtr 4M&t~1\ * H` $0@$ !@ Vh%]JhXUI҈8tRk Ob86$V>@ iv;{ H7e|?C)\31p)$O ~Ss+rָI:os<.)F5՝@҇- _{a2Ă9EXJCaηNJDp4!rpK8۷b [ԩ-i_g>3ۓv E!,1Zp*6Qvý8vcz[9Ax<MB-Tb)\CC/3/g_#U[73T~/01L29Ԙ# =Bfj Ųu,l.0Z i: k`:F=Iu?7udqOGfM{Sf[=ĵ|Yw6sm+5 + OLBaXJID⤨>AMEdx YfS<\!L)s{=f;yN7S^meeD1!Bq#*[G~ob/IǺp HއHZRO9kacXFQ]}g9W6de槖(LB s%3A(4lFf)+Ž]{^AVURI)W8lS=n#]m7{'+om_ f/AOϗjs˅'X~sq܆RCbwTv_|_ _&H5P,}M{ tng2cn[$1I4f3ƏQ9{ZHLS54A#$k%+o5exg<{O%q`r6j=o_Onukwr.T۳&!ys}^{1D 1^&񾾒;kelΪ@! `g.q.[5d:]56:OSK+Ve]iZzݳn^4ќ7-'G'7fqosk9w~5+ՔkQᑂ[p[5u/ ^߫q;MIȼۆG)JF-a5kEyj<\>7yˮ0YW8_ {m H4 5Z :dOu((5KWRy"E&nө|e$t糎 cԡz`H PNW ERCY Uuj?sR[UmdsH&k9vWX\KW-%ђS-pp SՍ4d?~m=Ο~6uaj,?^ bpkrTW^B IoV#K|;jiU'pL3jw땺jQL[ATNZ(1ÅDI/IN3mi TNeJ [%Pk(Eq2CVNm{Л$Ql8hF"=YZuOX[V ga/mMiUv@Z²CΓ7S'{ )PNf"d_p/.d}!BaK;"n}}Ѥj#ؿR@M$kٟ/WOliPlLޙGy?+o9Fc!'$ QOQ)-=4JqaPF<զ?_k1C5ai}M9K/akrs3ѯFq:l_BVxO:bGB$\W֣i!&n?S޲јlU5t/A>]!&Tx/>DLw ?=1?OIn(-{?{Kj: HȞO7xz{!5^' 30d f/IRCm 0HuX)솽'[/b6/O*ל:Ejw>~G۞l0a)$Kh)ř=6k+X險by?O-oc|Z}|߽=?^-4C`?! 0+>0m*3?x o%5c !P m)&q2'R0 ZuėO.\y_r)vH!xA'8\G0ўYV[5]_w` 0=@.bH&~& ;PϜśD{))qS;yx-DC|QNPG9,4z[˺WnTzSxh)`0 @3~1rX 0@ %i3bs4VU$o-ғ`Chc^ǐq9>bg~x>tEb*/bo]\KD٭B^~zwTx0}ڲϙymϺW<^a.E$wc}x ~R}mw2!)OFM˫AǪ"5:'Pm0,ʄrm4i I(!Q0(ԓ@HB7S_C=_GOׯmŸƮAbYnMwȳunº4bmc5d͑XAFZ}}fFX6D h:I]ް,@l᳝:v{NN7eMvN7q@BJs8E-b*Pj`:s* &@+&[}}40@ gl̸ߙ=)iB'mu6N {iDG |䧅c@`hWOMҵSBBȤL0u\l~tkV}bKM%3Y̨hB9PnO_ E H;ec_<9;5c=5 b3%cYOQ:id~oI[`ŖKgJ2#f_`i8x%q]I]砰=Bt4~i/M߀9Ti+[ީ*ۭys-\T>oĈJ9$4膳78L lUhW4e&B>тY8g7WG#sށTLRhxE>SE;f>!)e1JT}Jyd5+ODOK}̾$$Ct}QHH/jh+N˃|đ s RAޫ.G6 '0וv rT臭pq_=:]%7%,i߄@)$ad1!^)κْ0=SnnȻd |_K_In+*U!xd_WM2#  188F:6L B0 P*l<J/9MH̞sϦ7Lͽz_cJP 9ãi!}Y~MZGO lIr`޳Ǒe,Bxw%tЗ\W*((siOzK)nt|)>jvAPgzR=Eŧ?+~ QN°! CI~3PwPMiNYꂐ]%F<2ש(_eͳV,Obcѿ?9 QN|%H3AfϬH HXH4'Z[m+ vH\XWy2AxomV 8q6۫M=Ix 0Cm6!6!0:RIb.`M|.<5K߂49x$ U(́Tۄ';}2Ԇ-68Hcߥ_0b|kk\,wp20;HZ#^Ow;?'_t&24jѥo&訬 gT}BZ`B1eςB%37fsJqj6RbZՎ/W& `gRc@6b "93P֦O]G^LO= ܻiN#oGi+]03Gﮍ;4ZWjt'iXȄ̋wh53/e0:ItzD  -k9kƴΫ՟ Pq< Ip WXeDmЯ6u!i c2Rq(m-Y;nr,f B+VkX.֠>8>,E WV ;?]{"n&Xpxڟ80*^>seDWحF\h247O_b=SY{?GG_;zv9&굚k#YNhC^PGZѣ~ އOSw]2X_K-!|@#"1u  f8X9zuiAW vZ?{.?5آWty@ bTc|{oKu1{'Z"|̷. zfl`} UͿU5e/8y)¢#['SacX1!W˚EWՔY-? QZCe&YxQK+8ҋA:!%kjs. +r3eA#;fi:. DU:@4PC W6-| +ΈbpԨUkԱ|]X%/!j# b@R #OyOB0zTmm[DuӷgɧͿXpΒ6IsEr[ :<+^#_GcXZN6`OЍ(|H .A/LkQ{ }keR ™=Og{n^6UpLCD>o|֟|j:WhM+?cY 4ʈS$ d:p2CMN>OwӀ2| CaE$T"FY NqLyAXvw:=ArҚ#G:z W3gw|y~ MM^$ 0@ K1JcQN#O} Gq(K^o$IqɵcRWbΟ a;RIz ,o+ Vuc$^e奕H09 \^ 8nQf ׋$!!1SNa[<.kW6^Ou}*yT+6X@QG˖!&1QGAtЈ. ObTְ@ZB"Wo UJk(h=mdJӾT"g4ۂH|z5;6els΅SMLvץe0A(C@J2~@Rt9T 덩<LjaO|B$sreԼ4ש++Phva%Tℬ5> D_ UdaJ(K+/8]h VZfK # ̤}NQ93bGC` V.BC-3"B :".{Jb3;c$l/g 3%bo'G| 4XCJw ;ŊR[QglU"TY+`z; =1r܋#GޢpG7i4\0ۂ@Us}!4mMY ŐSO?j;>H?1G}>03;-% $/9י$he'hvXU~O7W2\6 .YZܖnE,鸱.=.ǹec/KAsEx Ε!qr9B`,;x; >.qb?US-7kJQ]ե[:NQB8.9<~A{V90`>KMbZ 6n_VX1Qp|[b `r}aH^W' I rD*ZOvkt }7'wQ;{ iQU\njmrQߎ"YxD@I 7/A]2'(Gx9yyޒg^ -ey^7/@eh-,mLՕbp.le]qДH -Kr?SV_quWHf8F\i9NĞK' ztK MBAs08+f*bYQTtjDNH௲|,ޮ" =1]lVнH0~uӰz/Am/v^;$G?aST<1@POxANv` Q0ƜXd;jJ >GKOtl+wu17ݯ4zi&`4 ZOFRm˶[GtYE]݁C`ua;cT@y;vgd6r +19aK!voc3JQܲn D1р!Ř0X{ ;{Mv^{QsYTiU5uz;ޟVLPuTF1/8HcԧhY^T 7LaKJвw0ZNZƘk ]}6-0a 2@ hMM{A׌zgG+\Uipw:@,p06Zn}P*,1bë@U]X,zO>-{f.f@ĢÚF0E<3{qv!}y~QomgV $"F,]Yg"B  UB-g(óZ63cBcz\?=-qxv{:զfibotpyW4J{PRM+`R[j((rRZ%QHbv~3%a{6Y'e﵎EfʚCD)yh=mQ랦En6k_l]!@B 톛O{2{_{ҪY-{Յ7M b<\4JiH'KnUKmӬ^ 9c v54Aj":V4+T [::Z i%jBHQL;z&)D-䵢7 HM8R [~w78 `A?.6wwp`!2 6@~odS45y?b)rsmm^=4ɷ;5K֡%0]lm/'o.e>orJ7Q1?n{)"a Ub^ FD \Z|9h{+q`m铆KS$6 Q`$E6qX'KR <p ̶/7m2͌:q|eOJ.xAxܥ CXY/Lv=bsE#}'jH ?J'r<  ʽ2+@ϬVǠ,_M$`ǂjZ郿!ə*dpKř+P 21ݞ2Sf?qˆ]lt»l2r nP|/?]) "k"2-$yo^}iSYXT R}ȡ w.Jf-*ڧ)rQ>y0)bvbdGsU&aK T3ʢdxs W;si!!]h+-Zi+.뀇.?rA>Go*px"Sl?OlѡKv=8_!<~'NCpoN6yXV}` < M 'jZlyϣN( x7C?m-7_>~FshR=m06%.ou{"p㌞G7yhծL`1>&DAA!0q(~ƷK ekፓny #}u/QzL'.$v8rb\f9hNjt7BHS3/ sO ] ]I ŇCiʻ![6{5itȂ@!jeZ_e0;絟U9Iv0oSnR%:b?]#E&wm'͉2ɻvFȧ<]E&'7@{)Y@#=VlSO<*T62;~jЊ0/zVM:-f-'|7*B *j@YCQL(,c΋ V4+,nQ+$!saWo.ܾ0$еvB/fWJq3}[Y~mRHY[]SN"EtTXq{?H}O/oj1.߹Bb{ tN_Ab/[Ϯ]׬>)8]I>fݍ//,-/Go#p-ә}5 ҄\;5B=Sswإ^0AݭEnsn?yt#A'5/V_yz]~ێ!w!ț8Z(!CS2V%Wj6Tķk8 a24ܗj]7,$̸7-4@[=6X"9.jVt}B}9ŹZF5@m2뱫}ʺkξKFT|%'Wdӟz9`MR b=X+R0 Bޠ~iY/ jY?GS/D]Lo~=ㆳo}(2dbg=u}8^"MiAĚ)g7>N\SӅ!aAP~h~tV?*/>6[>Je񰵍Ӑ]rZa«$v ehNZ`ꠠM]BcX;=rY|rΫgC>{n={'wUo dUV dֈ\b1sZ%݇=&hNmԥf|S Jq1=i᷐8A[4 +㣎Zɞ 7uq;?M MC*wHZVӆI2~Z] AԂ"q,fۊm= zMv =PspNaLn.R#Mqz8Q t:qg:S{VrWWʟfCQ Hl!{:.U1ūhJb xnj ,¼8pݽ=XFP>MP'߉k:ݍ;]694MLb`oRj]m:=D%1snD˙mqJ쎯'YҺ5xT ݬ(}Tܐ[4e@xC!jyMf_ٶ[ (˅3%JyY^/ʼn4vВbc N?>T.i[A"V[ǫPd9!,4R]OjQ!@hzx~V'Z wQO`66Q‚Ŗ@=|Dw/cp;I S]x̼6g}n^SrTԣ7ƎǮ"Xa-1ptalזL}oY]w)t}3Kuª>i{~bwP΄ӔFB'Ӿ;!rAob';+K.VSoD_b?ګ`B6W63DcSHrC NA5ː(&UZ35j*X-6ib]mdbM /lChl+q0c$` @@@!!EB[zqﮛR~l7fd'p8=b?JFVέ1 mOPr=-#+$yv]J ŷgՋ6xl}}E?uiC`ޒ! 3K'"9q ArA Ij% e !Jke$B "QV"X~qՄWU/1 ӎ>нVuz\#rń,ԨjjH4 ci>xQ)i2ݺNg/8wmm7_E1t_i. kB4g;]ruTA)CjcU&=Z^_# U bx5zst~k4d!@(@/285BIA"\ʌ!0 rcr<嵽$+&9_:M#78_]%"bO;+-Yp\)FdkvEѓbkBD6,юezMx*"&+s@I`BFAؙ#mlu*u s I@L.0jtV.U$"+1UNt. |VpG 0,pDKB٠Isʪ9<]ZW>PI5a n+NǦPE8@a3Yp0}8tDX|!*j->Pp/*͒[[rNUb b _w}@dGLbBz.5eC6 C`JۆK0@aDi~i6uo|e Y~=R=y;rgW E-RՆ7U}g{Y:K44g"R,Dm ԕbk= ">Fq``y J^J? QA 6ZVzALZiAtL-kslNf 37)ɠ/@.&oph'^Oƶn+?GBGt؋ymlAu,ՑzFcjkPovFZo:%] Gi2qN˫=0 6,`C#adr, 44AyXDvp~]1-'{/160ic.!Lt_")D`4><+ыvր?w! UB{յlm_m( []_Z$B$'qԹ' _{Cɺu"[|eu]F{Id6 wQ'uj}Qri[W0m1lMI4ƽU|Loe滾輿^wk&O 4ll1=cPl|j\f e֣XʍQ_+RJj D^~9uY=J )"chq ;w"vAaXo^Ivzyz:?[mƸ䅛KR5ycbnMaK`2"f @ H@yų/pGj;rs=em8 U־sI 3d?nSnj-z8+qzfeU zRg:Txv\ޕge2M|NNm|*R皭-U{-Gx9 x.󅜬S W<=; Wabx hu"ŽmVs0Q k䧄0w|7FCRܘ@2HNL,Ryfve5zHpwdpqza‚ O.W=&QYYC:|z'.^>whW1juկޣnzgRIALYHDByǿY]$}RzTVW~{*v{dKn.[|^?t&m badC/Oq.AGK@on|u)`'ŅuD#"$nbɅ1HbmRfS:Drt2 hv˭-\>UQN&dIWIyk7VNr! |749}Cȕ_Zk%Ԣɝc/ O=DUV bENhJ  ?ׅ~acJ Dh|Uj&2p;O{וȃr\,hDH 27 fXӚ@s|hOG9'Q1ٷ~zӲbJ(X<ѝz\# H'6EWhob*bUpܬ1=5c>Bs.ڴ Q*oiT M'Q\I mrn@RT WI5 ;l{občV,{۵ `BNna}8RdL(^H6'1ܤ2~X V'nD+-1MltwevA9Q! ^i*(iZ[+}6%Z0`cI<ސm<E-#$anYn `yFfW4|EB^׬G;m5#kVsrN AI#(ա HЮw!Y!w٠#ܐ+?dZ  \B2SaS?IIX2^~'V}AڲL!*,@%}/U/EX{ l57/Gvi)N# [ڦަ|V@_U){~%F Ƃ/o&ՊM N7O\^ǂݭ85{z-]ء`@*yaN:'E[7xM5ۍ-͆!TKoUx$sx?բ?1,MjQp<'&~v/K֨`Kzu''UFܽv#/@j x9:ϖ$b?~9mAD4YmwM|/S1v٤Iry}=^.u4IVGY+̼ۆAfUMh8?Y!Zn=-2Ha  sI2ipOh3 x=Ur^v5gapG{LNP<'KlQR. `Y 0Db_䇵#ؒ8s"Q^w VҿK+93۟.RKz' ?W]0hMd]A=rՉ ꆳEer.LjWai4K@&&ÆISQAt7RL.B=¿}^OywKWkyie SQySN7D|亯Ҁj)L?B.l")5m%{8C # Sv5ߡNV$Hß sP"Ey聐e"eP\`zmiߩ3q ,pelb]})fH,d֥zYqd03~\;>-Fx9 Kj loNg3' c8dU3]VgGI*cJ0e ZKhX!9n!ѕ Ds];cؠoOumz?AO-e1<4ƿQ*N?ywGN#rlQ}X^WCˠNy]m#l Z]ncEoi05y۫,IY @p$m ?LgQRi_<;DpT< [T j6% /JR~7R?>Ok?};O聢S4stoaOyu |iL=q)_ԈB @t_ҏ?0{gս,SRfԁ+Y+0t-d1^VSՄZJB8ɣy"%PDn$ݵ朵$Gr I  +6'@DBWҋ}&oY%-3G#[]5G "D] z?'QPʪGG)0ha7\ϔ]pbP$;DX!~x)̛Sl,~s_2ljiF r*Rp$"^dZ٣S{-cUںRy;-Kk)YfjK )$(Qke Þb?3}H=DZ3Ϣ?3=ZyTKhaj#br1L(i,lzl*j* K4{xVfƒw2ufMv-LhOg^`~ *r;nVYz)>|w3'&K%~{H3>SIK^<5e`Ct؎)5!YWooW1ʅ-؝tu6[Z]|dATl>.JfSt7}\e'a~G,;Q<lsYR>i7 XlGB6qX)#*(]?szSvQČMxņ'.4(% nձ4/D2(CԬv3]i6<)0פobh~*-|gyZ;j&T|R4 NZ^^6-'|q'+>ݎ3àP@ Rk䛡T)>ePE{X R r3iFh6my˷IDY̓".J^b֙{Sa09i +-;N2 t3⢏7^30$1\5CD{Yo%[t wnE9 4|n~L#CSj}WJv3៧lmW !ct<}6*NL:[S dl!!{ő(8Sڏ j9F7|oTn´e\\lW7k ON C}q";{^FK]F1ɋ{B=e\YzSAYZhW)9l] nG hɭtYK2F)|#H$.L KE=j̯'!I(Э+_7'O3u+8g{Wy,G11 mIbS,P <ȼ(<.[4 5uۃsۥL/* J4[ʫpuK"V,FwZ=*itZ"grM@X 'V. 6`K1 ԢXdiH*BD@ǜ'en nNfFD$#d8\K-vcmnmLNtY m0i%yMQi 5Fൡ΁i(ux4&|.U\tWt~xJ"<^m씍eK`Η#0le:@ϚH۷WJ[M꺬+/%5įܘ%2g2gC# ȸ`1NGXՆ6.4 W+P94*#Iː_E_ɚm%{iR2*h8Xqs">'i/$3kxwi#fvaZ qN|7%DNËd[GRn̮b z`]?A΄6UbT]XoOFA8Z׳E|gcWBEP#]3\9yGiH(TE4yU#Pϣv634DE nk~~O?e?=鮛hS1/XwONWģ޶+~`V.9Q!xvO~~?ŧpJXmwGx\(۶.WHʼnmP?,?9D ,an7GjSF&vrie;2p ͩd7\G]^4/;σuUnP.XҀԩbWsX17.ڶע۫V4򹝪y2U;_3kE`:uNzķ.{mb7WNe|Z*oe_9@˯Yumj{q% 'N-[C ) @>N6\mi+|WJ_gAv_[0K?1}D8w}AtDcO:JSOvFX8, i:i`Ӭdr0ȁSYMִFb"R#JWn;xQҳ>҅( Vd *s5rCH 3Iwmq9;"sBHB@6 &lm+}&CCpB`GZAL'JBLTs.!VYRlI6lb li6Bim66m64MlD@$$$ ƥ JPPIAĚĘ` 0iHrr"IR&6!L0B[M0BBV.L̍ւ"B D!B$(C6KA@i53(Qۖs1(@ JDCjA_Z:lVpe \`mylߥ|~e-aFegַ,_F'FneJ ewt/ߢM䠲r5& ]NebVUv٠0CFU}[BbѨ飴H XŸ|)v ISrNBp(GBKU5YUF%^lŊN$2 ]1A<_x~Ě5uIѠ <εrQ)#!pe,*zOw=kV6ZuEg:.B␀F?BEf/3/[|~aq\Az҆bjF|*B>:Oe ?2>Ka @HOw{=EՌ8-:N0 іݵ𪮻,!QRGQGf}ҽ!~ާ7&_gfG:D]L#+c먹SC_V!?[\V+QJ3un k"o4uhZJ6| zvQk;R-V;Wȧk!{𚔁 D4B^HB]o*2 U$V>?x[-4 䯰tzS}O觔I=B@_ڈV?R6y°骮h-^/@lKrw1z<+c9s_ʷc;Qs>#66jC꿫B؅GE%v_XvؘUA4%g΃68:<-t6|/ejf^ ds->pXo^GSOޜԽ0{]߳ L%|;Y$ 4h!JX' d]7_pq9MEEAŪZ3F{ u=5 ژܵ[˱ϝCin4fbS#?TOـwW:Vq]9)'RV2LJk@e!:h$WFa$"iA+6%2sPFɆ\P(@ dA.Rؘ_ U02d8hj !a zGO#9AfKg]sGqg`Y8z%̽8[#)Vm.ق{0Gs8P-WZfQ3r g|p Ӌe{{ޔmhͅACs%/֫qzOpYP-Ie2w*q {D)YشM?ҮYk/i2kׄYsSE85d1= _L#v@ f)MI^#fI)0'Un!u:N2ǭi-F\?}(WB_W2,kI<Sٰ@΍硽5N:_jFMVzu:1ukmM`nܪsSV΁; }bDTڄ 7fjoOc6ℹb:S}DZ~T2YJUc Okb ")m i>vfS{_ZcD!֚uDr5YuKqsAkZcYmP% `}l3KJH"*/Ĺˁ}H@1?e9q `HR'ΦL0#1&AcQmE%R}"{ uO-Zna#9y.)rqүsޜ%D! !TT|#]22@$Ux]:o_t$9_I^A㙼K;?.FN:0b?[3T|7yv*3#U,jh X؎751 J,o\7K8(˓żHrAFw)O=G( ׽P" Ųd֛VMA4U)}-6|;:tJ2n]>ιǬ(N'J^6T.=T[콝m]zkxd ХSM5K]Qq8p@준k~^oUo\_S]9uS66uufv(PXXd5Dr]+B 0XЏ<'hrvOI_k ]X6:AuV:S~u_ڷOR9s֨=#Q/?;# ߓ`@C@dwS.џ.@EB:LIm]H]JmĈ 질p#۟uG 1$15OĤ~ [M~хS*!W_TQԗXknz'2uh!ߪ~C7b6YuyrOڹ{kXH,&[n7BuCZwtYGi؏Mf[P>_K|W^[]O[X{;"t hcF0JGQcṒ-zPٓF7x էcU}~T+Db?B`o +)m+~k1Oqk;rL"adIێ7 BԽ)CTʩ ! <0R/YuΫ+ZAZ֪G# `k+xOA_<{T3`hўB{H"iJR95/!R$M=EU r^ b+?Qu\B¾msY;nP|}"L5rL<./Ͻήc*G|6\"j̿'KEwV>Qq!@m_yy^_ky>.Z[a}ssD았'ߋ~~s_gr1,>>;ւO~WpS<5Y8_cE|{>}̶)u`_IphOS%P;qp/X>R~1Õ2 |K~gU 𥎟5}Fz#4gʜ4 ?)"nO8GD'+G<:##=p!D3~.` KAA[ÄhsQQ7eY-@<P'`+ߠQOJ8Uq,0B6<Jݟޝ]/3/?E/2/*xA]m_枙i℈5XZ*z'j5_W/Ur?cNx:b_Ri+\=IU/ǵc.p}EfD&@osPJ8h u(KGc&k^F8՟8s]Ix0"찥Iarܠʺm݌/M4Gx1`XUa?|/T9֑ =Poy _ zrғ#bI+Bv`+{%$ >K/{&`#{A􈊖\eb $ BO+ܐ"%5M-ܑZnbr9I/םJ` N}zC ҋ>DžlS MZOth@J+9*A!EIc@Fhq @ɦ $\/eGiVD*X(<@J8K)O*O9H٢@$ɔfq충eIJytpyʨC]cwRU]{o$~j{k93؇7dN !Y8\Ns*[Γ^Bq%ON`VŒ;8PP :NeE!LIe!XrwRIj!y:h@Em# :J5*쮵kBN;bSnOMro;dgMTr]56mĘWZ}}sG']x+A4FpJui"qf!FCh>/$˶zzn?E~+ki.f}Ep~זO}◻ɠzdm0hc0h|I}~-D}e[2`G~ my]+{ pK|yYJdEk\PJB3mK& o'fW IWr_ | ؖ5_?'Ṻ㡤#lwO>c)qu/;2(xDnn"ٵ{S$!ZP=bOGEa <6%}d3|wEG>W<ϒuޜbD.I=M_6T;"dUUܵۙKh-_n/ {:E;obn9T={>g.Iq 鏍{6Rïsf,Nm;؏wAaG .{%nmq0wls+y;ګ9έ&OzwN{MJEhIm<渻s}*cuO}O?PЍ D0isAp ؔ>]I^k^p[]}S9,h5do/[k2iڿ~٤TF؊֏&>e{ N݉,b#6\Cs(hJF1ş&8I ຦"GqWᝥQy^{)g(bR#;ɚ0]ۏ0}kˢhy'=$?K;;S۹;\P\ZyӃ=@@1!$1#êVRb'a bI-١cSd|RMTJ V 2P+sL^P8sgƙ:}6%&PJ,,(:4TQkTHgz8>BiG'awEԡ}Z-6vϿpkLbYJ  +0A{]y5f7ViD %tjBik\p%lZc=;x Aq²r9%A V/y}bJZe|# f"EWa'%4L{.|E[@/E1?q-Fʚy[EW{+ߋ۞sB-tn)^D?m#?zJb/U|_u)- ^sdDD,֗+xlZz;گfN)Aʥf,#RǓ_cet^&Iă`@4rvmYC[ |U?rݳ޴k=uZ{ֶc5²$ʘd%\]qE9XAg Q{P%t7?cI+g "opaEaW78@# c j+H\$JH!?Bu+jYB?}ڌ+np +2l>mS4%2zLjŎ6ug#kqW`,?n Z{X<hȯuƤN_ ӵ_?guVyW_\~n55r\vGn(g&>>i36ݸ,0mW]ۺQ*=׍דjW3;)PW(J d~[e6:5дSClաnZzÅ/ս@O_62j?tWL o}{OvC|7Qj+si_&K] 4!Z\-}7BY2H@b~ʑ1Y$8{gpӗbP1GW5ʹ_01U1вrX!UL%xKدc59)ugX8C skHLDBGpĔ$Q$j+&[MΙ*(=N GKʧuӜy|^*Ut!YP$jExT3,;>9bI4f@ Z'2yHIeJIr&A/Jd[2٠5»Y04blLRBڹ~L,˃sTsgDlҢqSA"aEI( 9w0BEDĶ4?{pb7pWr7T6ΞD4xd5&SeUE~TtDSZy?M{7ag)rblטʆY= MaDEګjf+-vϕEc(vfi@%$!i+w;`{==gLȉqQQ=x5ޘ ^tH,HHySC_4iG16 !q&ԒA;,yE@|Xl~IT Ї  Pyǝkwr(,w`k~;7\{|8⏯Ŷ.Ce2#UO+h؛5Nm\N9ә]f>hm~|jb >c{2Ԋ#_76CbD)wN N' C |_s='yKÎu`5de:WY5+ӎ(o7AV| $V}; ]3kEèhG\=9gW_Df{.S.ŮPe+H$ -=",h#b0d`V2y _xهRFؒNwOX߷#pY@p5Tkgiaj`_[о7 )v- @'yD|mWcX2#'\a5 E  ` znՃ =tE0D"$t #feED0r]]pBˏ>= 2 ca>9_}iwv7{N"p{>q7{sVQn{V4J4%Y _8돰Y6,ɤr 8=32\" ιkpz+F/݈o~ $E~Y>^2\M&-.,!Smie)uft_]o2/2lH8p{U/ <NpFbžNd*z)82I(}חV"^kQkN}XYSUWgY: +Bs]]SRl^u{tr?n+vE W10[{ycW3->Pʶd6uKq0D= L RЎq::%?a羯l?)O{^*vCZO)UzB/H/qMSOIz])ZId v=Mr=ׁ*LSݴaZcY[ F6:)!]+f:ׄ NBTtXqPCVwO5Ф.jp(RU_]y:y.\0Fxk>4>`ji?&խޫQ_:%j5+7):AG w9qM+'=໓P:`Y3GPJ?E_X&F5dy%T>w7w(dOA.N&:>9U3:{UcO_wDPX r}|nrmU]DD)< $^"\/i&՝./)L.Ul!c'_1 ]זf9j2.*i+_R1YSX%Αe| /HAmfl\IA:-v)e#WR@}44E+~JMXm}8 v!*`Q$NN"F ̡-!S+yZh]oߚr8.JfLh R,ҸyarY';%~Aukkko6ETraZu/*P)UࠛVŘb-*LX= `[1V o:K&O/A#]/=o|CASA55Cnkk##JƘMV$T(ܔz:MS. Iׇ֯ՅԟlӺo~5z^:?~]_m4Kq}= x C|GCtr>c]av,wĦ}˗B!cjɱ!1lMm&*)NE Q!ߙ'c^{h}ߩ_Z UQnV{~\0N6Fܹ͸4o8|z㥓wQ4 jw /b e1_sw~emQ~g6\@:%D3d^`6m P6G>D4anwｧ^!  fRN@Oݵ1t"vY=sjx.(}0l3Y)aq(I[=VA D#$Lv[*L{Xa6:)ĢXqI@$"!  I@0\d@- Ӏ%h" `B|붹 (`FVtH'P616nM2JC֒hM\{@BȆ5l_n#_fTʼnd!f1[6'_xW MD"F})VJŭ!H J]Ngv!)߾JȬH126U$31B" $*"F` C`:7I"te[ŀ,`pcBٺ"mEZuI4 W1 Ci4D%knu^a(%uf͂Zpx%R,I]x T&R(7hxBuJ:fhLoQYE{luEmF ?Ţ\g_]C=~{T ,yÍxWvչ~jܻRDeh=2?Apgl"ߝ]6e|sqt d$ǰљ5~ЀNx 0\ioh_O_uUa| %W$o%! z6zº6 /&$<Q 2$$OmG0J !?Isџ@T2)W1&j|wkvD$ &j#6$^YLc"1 3ٴ\9#ݵTd& X=7@amp7:?d+6 wy[|!P[zyV,[qsYfJ|\rU.&S][R*JIOln#._CGdkg%Pu?ME$*Ϫo<.V+%$\LӷiĒf.K;a~u N{VQclJS=x oz.g&`}OtS҃9ٻStU[x++ q ;!Ĉ[x0ݻ.h51xo0S44O>oU;ح߯TS&?ށ~fjwv$^WԠ=<> Bl:^mW!P xN qdrH*jiΦ\+ a^Q Z6>ÓJ}Yh;[ajtU9ݮoRұ𯀷z`pM'aϿUG9c`n-Fׄ暲}7M[?n'6+wI].8pFg`?d̙(P|N?6^_q`(jٍWW/dY;em (buh%Emh̓~R3j&<㰉ximH^$P^\p5|R|%|8J(('{ G[Y8٦6ٮ>q Z3JYPPr ڙɈ$ )SJ*88)exAp3Yف3XH əDyU߿焫"25ro%aUD,B0KUgV7kusC)E@,U!rBBnU=En,BكiSRNFycM;q SA!hxBZY^U33rKO okVUT֢`j 3`cQB @l\e?yh=9zc %<*C: C|8cv#g|Q*籍2!xbŐߗcyAs$`ĩKLMd̽F9X)vAK9х)SIW2zl{l_`M[G5ӒQ!t\rI~꛺nx_NS,#LOdb•ϓh`vXNNvմlibQ*Y$ g3,ph{\.&7ojK}S죱\L\Ů e^-2hAb3:/.l\,`h=щ>fZd 9FY8KMvJOEuHKe*CZ(d羧BZg)',f%'],&HuWH D_ZkR>Krs[G-L[ N[eYwf_7U5~/:+s9} >껭֦Vdq(6#;WڀtLlm#NÃfϿE 9H ^?)\VB[5FTob/?+/ǁI˹?uY7UKAyӵ#ʟiSOje¸J7D[?ulBJ'KH8ٹq4;]QyР}D@hyd@aBg#j b  &ydu cOeܓiwmk-Tw}t}/>b@/uW)=hI (b gv=,U.=.:2JRt|X+ ۲oDTPP̜ ݝ<vQ]$M!T"889Rol4>7r_͈Bp :#FA_*e^;u7E*ڸl?M\lEwg/GΖzpbO /hE-A݀;H@s7i֫ʔ *.k6z;ZsUfuHqM6{CÐ^٩|Bg%DAbg *+ tu2X\Wj-KJ;8O у@y{E󪕷3DR-&1"u%GqI/i`mH.e60IAU֠]_~v]uʝ%Jz5hȈe86 yNk=xw8sQ9uO5^]?w"=CFۏ;ѐEtp'BD0!):ɤ }&4`}L=_HK s{=iVEA+ %H7Ϊ.Ϯ5VRu˽[xi\> :j;XVVz7۸ug:=f͓߿6|pQ`s}ǣ0FIE(_7(  {^7ZEw ϟ⣨b]݌mg{XWk>ؼ'!+D̂+2QG9G&Y͑X0p`\^-}2yh,lB'JnP*DE١iRuv'NUm+5a/^po7T?0 _nZ _p*=q "|XfL166)g qbv:x̹ UWY(BV8L+Z (sSt@G ?ʟu_{}t zKikByő8i)D%k,C\,z_X]̎ AmʩN5,D9 C@xe-JeJ ;J^&bu$1.@.br䇉&M!F^5/&k/H΋T817\s&=oMٿb>?tsøfX w %1)i^kTq6{Žk@@Dr-j J͋*eFAȴ+)[Z` cMzaFNP씖?͎Z|v \ :h㒞 B_F\(RX'EnpS+r-JFLjZWR "&sZk јd)t{{`EƂXĚj͹&Gх D +ߥ LjSK2XY CV֋0WY`,eefu|Q|"7sNO쒧-FO6:]B)Zݕؙ^e;UШVskr(bF4R^`(L9-s ؚ QD@.sz++'8 8S*8S-mOn,,g@߫_X @ބKB] {tz$ӤnΐKWA5fʀjXÔHۛ/ɺAM5a4|AѸ;5G nOH"ċBЮF XIrZx{O+]Hf<(%deQ4$ۇ'#؏qE1=6_ mݑߙ߻bǓr7\LsC ciLnzcXE\e`E˓u|,_zfAQ0{NCxhy Ճ=yaLKZU):ERO߷TtYEd uy!`E0mo6QO(vXJg:J8hqzŵ:XJғk^lъqLyo0rYe0t)WCaeCI-,R[0H c\ID(@ TGOnM{خ(V6^v$DT ^5G>-zQ'6R2"%^ ɖk!:ʆKmU 4B.YcCh2 (bl|cfϴGe,B@IlV.7YD =6F`+_yQ:_'|]ʯ.hke[c;[L<o%^u|=JAM&,|н݀?yŵ+7*l 6wT`%nZ]W LY"eSD˅[*?}wW浺,'·iX5'ddĖ٥jhWr8UZX{ԍm+J#5U|Dde#;xN.kYָټ2Q{t6D :Nd3LdAl`)`z3@dڑv|2+hwCdƈxɮ LЏ٬5ܯxk܃iS 49=TUYlb:_Bx<N 3/$~ǘkg  K" h8<-ܤIw#]Q~mCEJm@$0uX#2qV(^CIBOQ${bwM+zz1G%u(_ܤpZF#[ W2 =1)M€(#DV)_rDJS`@B/y-(ѥ ZOM٤zE閚Ňh<{9rʅD@@A@sF V2]."e4Cqǔܼͣj7ar8LP*3"R1)SWutl-YT~G1aw~ݞ Y h-Tv#^pGpqF((DySRU~ .CqxTa-@e$ ı`,'λԽstYq 6D@ǀ(#:G Dd=~|jQP]U> e#z o`Y)b΁Naw0UR&7ZL`W]9غw~Կgl_5Rz/>Fig4jI{ǃxt QƱ$hY~;c|b;!'}*GY#/"N~M?rz23҇Tl׏UjO v/ήT9lIkӷZVӑNk,jXkUg@B ~_T!bf]֩j}>Bud >v>Ln БXpPk]Nge<4$5 g*  GS/*ROG O3ᄒxGQ輹8t_E D:U gGm9o a<KF֌+`^W@d3gX \(s/x?4GZ?c]ӗ*|KnKO(MM?/iU1PP:08j9\&J*p}8Љ:c ! Ri;>ܾkc݊vKc&OOw觖> #5 ϱW{ | T>,Ƥg}ILwrT1#C:4O]}4ʫRĬ-H) }6>s;c1u&ᣃyȑ ڲ}HDsZ;\u)25 }ו^WO;d\;.v[Ǥbͩ35Է|HvF{ nT9C$Ç?* Q2y)0pCx=b|11 v*zzpԻ_Y5kM˝V7:9. .mM.zI- r6+s{V0 %PA0X,b},AY=CdX4A~zR6zXx6bF(~![zXz&RhPbQdj&QѴX8CO "*B_K 뒴$4RiH,8V[EFK0PYYVd5t7 fѝ$6A:£7ٲmާΖv:Q3AǮ=ⱘ}Ys˼vM,FoOtowɌ=#'^`g>F`ώjG C.7SUʣXo>۳UY1_㔄l)H}2/r< [|՚#/ .d*aO` xE*nJ6zO)>S/O̩iNy(5$HG2du>z‰,S8mE4<"|Sv%_٥xk-ę}(XlQeao!B7:uJNdP8pGW^9z#L(̗$-ܭUzgM~N'ng"=uC@tܯӢYih>{oNx,wUvQH5&ƣOm)H3siSک{=/x7s,axJe]y@a_!5 <DLLts8 G{[?SYXtCBI*sm5';$,6lR{ݫ^BI@԰]<1/˪wS/∷٭:bz&mNjCB|)޻˫,Њg VʳTFe*v'8Q 7njto!jصk)=}s/ZrIRꒀ?'Nv(\ k×:ŀ}AeB]. {PH)$lN哟[ 8ŀ(ʫ͂7ޭ_qyP֤ ^`Y~aMG+;eNA3pfR[R@ FjZ&|؋m̖nsq.$XHUl3M"8##!90 L@9.)G!( l&. K C37ۣބG^z[#}On–OBz}-_q(2^61 tqk9j 5#;p F#e֑ߜ&jhC".q>4Ҽ(nяf揖qޠTs 3'i1VQin{EY~}?8\͢DSB'}a#iau9$X㡩xti4(gI|urgJLQuͬ>&oYלE/N|N^[a cÕD)/$ H@D1M֛xe64Qӟ\mP0۟/8yjWC7kq私Kv $ > W ɃqYy^+0@mMDlܥQ+px-JI%xO.?[PFFPPTVbяpL@Z ş7ŀ:B.n& AT,9"ءux.W*F,%Wb+3ȂeJ>TI4M&F$MХDc:(>=tsQ/X[pPڸ7p12KauX :P5AI*ėPeR$%b!z qB`Qڔ3c3COoՊ/|NCrP :Au88oʭ{`ϭ\ڧ T'nYjP 1se"GDx=+%>> 8x}?) k8~|}t6MOc֟n`D?~aO|noi? 2:^ϲYop`^/V뽿gάJꭣ#FIי\(K# E͛=;5P+HN!#ܥ]&_u&IYf/+6K@ƤICQMSy\sP,IfC?'2`o6D|bPĄr/Db^%dH9KsBJ%-Qz4 vrNơ8!Yk04ұSXu ֲ^`L1F{($$7Vn LN=ς@\[ܓL̖-}4wO7с{ZsB{@B y QZ.v!߯x=s5QӹI4(b>~+% }!Ӛ*H>h /{}odh˿<]I4>gQDNlo?j]ڷaۥoKZ/~WǕwJ)MJ#Yח;?~X| 9@p8,H<յ[ĬwAڟO$Mb]ۮ//IO3s1)'<}hRO<to yD:uɽ/>Cz! C%Pp02K qh?~O)$9~-[(u(F!L&0fqCĂA}L|3iƒ{~\S7"1 @P*>lhHp\e dh:aI_f`/fF~}F۷}i ͜{%]ʊ=93K{Dmgg8qÖx^QH:|e\]YQ]kJI{% g+>v6:އdsw,'0ިT7P-ȩn}j:U5i7mj~F%oiyNScL;e>zev͑z)+\}&8MS:\Sƻtiw32(@rs$!}Բk:9vޯ Ǟ"fTV"X  sT)D[/Mvs1yQ~ˉZ5~ ˀ- F~3C( KD0jl|zJa,h`5cCp SpqւLjEO"!Ȓ 2ԧ `Fddͨmc/Kķt͒LA-6nmWo:L3v cO"j؂Lm08= C 9 Mh4A68N@s(Q'4Q2ɼLhrQQu||Lf"u1>JB\㸽2ƏPT J{Al`"p~_G n=J *Y /h `2;0Id8-zJ'5Mc+=1b!7梓En$ثQK{,mpp`KI⻕}0XQ?iLk`{ Pl9oJͬ=E d|KWanzJEFO/a5;Xbc;T5!M0M5˵ȭK!u^G/Zܶڔr?4SHJJ k8Mv#SV 38,t,fS|LN8<=TIV;5XΫXXbmAk$[cBhb"wW?AX@w3BS.;H"em ~6ng/헐.uOQxG@ ɕ3rﯭX}󺔼/lU2*'DDһ]uW j;,=K?ceNm '2?1JfߜDvtuA?0 :sϥ&m@ڐ8 G>7.tF|!n2Ԣ-GM,ovbkQڑXbBL5mf_'x;I (]n/峵@L/n҈7ϲ=ӢyE*yEUY_}ٖ8)f r6+s!g:T.yOֻt6Mm^$]sިbX k왮3 kgߑ~mߪ;fȳ RbD,rJHsr-8ʥ8wJP5i)_ &͍9~/l-:fkgu$~ʸme?o(&.#/ @Vѧ 94gbQUtd`h aK =hE0Wme6ZʕEg^Iw~=k'P>bk@(l5ܫ UcU^qr޸ɠC C>Ŭ5Lw- ͢Z=(wij-¾/#]ه\z+ѨP B[%ʇ]G_5P{ ]!&[bmSTJ)ϛ+_KkՔ MsR Jv~/a'>|<oe ~NI@tH{5}& IPnS^z'{jby!"@aB<уa?e/,^V~2ʘN# bU8p#DP7,%Fƌ_ 3Ltg"|{CG nhZE@J xf GX 9!mVKtƼ\gaIN{38# XC'11˛ÑGS3Y8;?jq?n+;V?TJz#l]סoѸpU Uv𕟭p'I vi'u]A ^NǛ˗NNhmv^3n#ъ( !I㟦,}am q:d8 y3%Sǜ*QBPptEϓINhnvMg|%7ff$>}4cO=qc*kf"Y<2'Lu~@d6*Fܷ뽆'鼝NZ]dgxufQ܁%D}[y&ph;u17B~)8L@dG7}T:q?H',#${&jp:eL嗻fٿ39!񾻫y9NR)['eٗ@|KT^xd`k,ShH$+Y Ք'ف h@Лh-'N"'">K+?'|J ndV10/[H @B4lNl=#ndBZ7z3vzH)8$TĔ0OSWZ{ m :wcǞ^KL?Zp&a>[ͦ5H^Y][! `|Z;^ʺ?D@` _* k4^s#70f9 aRl,\lp!k>:2#jw\+Ņh]Ʉ%"h"M& QO+wWRŒXVoݿ0kB9$V aHP)jwI9:SA?k z* JZ&'b ҃x0Tie>I \V.77UVq<t qi&_ 퍍N_!Um~0씚Y>Ჴep z2.J򷾋Н?Zz{]ͧoՌ}gԟhW>A"o1{y~?Ut:dz3V}!R"љb<́Elpjk&WOծkjXR`&{a.O3P-{QMMnzB_0k~O>l7c&롛Os?Tq,YEqzp(kiJݫ{(&EZy"Dzj&,^e龗u*d>lco0@ 2#?9\!f![ Ha|Rq%_Nƒ Ʃu=U&{nn0!d|mWbzd(*-% ^7p8U#ACZcE-4Vo5M(uu K*H^S2A)OFdfxn}f{5ӕ{蘝3 \xd2bp_3d>Siy],{OC$[5wwwv?-F9~¸sq"JMp'1s^(7qD NصwP@JB}S'&@GX;}L6trtyKo-䙍yԼ-:Q0W͎2s -gC$Z- <KHCwlo~}_]X&NxnW 9p9 ,A<@_,n$VEo>f\D0E?]} "z_JKַe^ΥK&)#^)nWIv֨Zb$/ZtMg:R+t֞%]# cIGp_˄2>"i&0(Hԋ˲9&qcYꁁoi6Ϝ1bP[+{הE?< ²".RLoY@XfI9H8{/l׋k,r<{SaR l]MO=>-?ȯÀ뛷?wU$cD=3/ 'Qu_^!^Dj9֏ĉۮJ͇/. '+K9ɗFm=} G,)vggPDα XɈylg#xwn߼o#Kxvռ6yJ!&i,Jq$e>~F͇M#ԑ.?xBw9}#W&!3yWNUu>GEUX򇊻GI,QNSbWRޏ?t1'57RSpWk実3O|]hf 9ڡ'_0G^;4]fv/I,Vmc2*Xe`, ~XvU\FшNb"ێ}~6*?iwkab:q${귃]yGnw7tJo>﹕1~)|t5MЀB\]/ # ,vNrK=K7=/޺<%=aC]4[O9m0CɹF0 O_bF|njzi6hlkuT@N"&M`D4E]vSUYF)w청+D ˛ӳP}X]U5}oEq8׬zEP:(~m; jeRnGprk?{V8\i۱4FS%7m`и9ۯvp.3y o`vD.TL9s.qSz&!t7UW S=@x҈|]hg 4kX*] 3ϛ;_y[0zLc*=X/ކ褂8;ʅ \~D縓j(a ! %fJBU!O<*JG{6J1ɇl " =K4g! urcuƎtqBSʱ[gVH)Rf!K8]*gE"u$Ӽ qA(ƥ;%5B(!FHrC|`Y:ɐ奦5BsfFtʌ IQg)ô-JШ׮u(h+YA</-8ĆƢ)<5jTw=%Ld1x5bw+XbaM oU-,zO @75'A;.W2ZƂ "*Xfj8\)uծfZ7|vUký|^ x ceFwEYZUQs/]e&)|b1 EܷܔT49_^zc|z<蠩}>Wcy_x~v&d*fn/d\|TTܡW>" ͡ԃ#3F@ 6K_ajl}vxѬNU DCaW`\@ ng%d<`{4GWsВ -a'_/9YI fuŤ\a&[0[S9m~Y}Gno \hCDT{i'wsJOۺ^n\ zk~:dɡĐ3@~WvߞJYEGYLn .c_3/\G4{;oGϳN翁-ejV\"7w5bߔ׸kK |)ܗwdLyhܙ*i:0E^jZ^ew a#I74 -E;0H$װw_}V?F &81<7O'3~;f]ԡ# 4q?g{~\ѨXWRbtj1٢mm(#%6es)I Պj j ΧU?;Yp+;P;˩/Jfߠ>>Owyv'A`afG7huav3l}A}SSw͹\: fGh=ٖFjh{͇mvz_ξ;{y}pJF^i 噜,Jg,IH/V |>"cMB + q(`"ܯ?pisf q?k TN@ 3 @8ŕX|~N={u_56h>{տt (#_a\-m7~,ɜ9D}ys}?g ŕoj|߿a5?S_f69gg->f U\X-B~6_'S&PTepO Gcpbf̈+ D0ҵUbCb G($!^4jjA)}-g0\\vvYP*hp<D*H=]xJsJNb*;/[!NxĖ'ʊ)qJZfۇd1{P$Bd@2?$K{m6&%0$y.73 QAU%bIB@F#bYH!/ڕD EnՖ#^ѵz3[$7C$"NELrNpy9w]М{)BgP h?TYK,dnj%1!/!Sө:m,P3b$uHRP+GӔav@u>Zxl7*iq:GxK{O{"o\EBP~zwD*  } 䚕9&U!t? G&dʡ6 & <7/ 0Z5obwm{ ,נfq _qH/H6;isDS"t`{~ 469~UikA%7:7}?[E|=>x@s5rGغPHѿyz,~d O잰bkN`nDACy?+}$%guG[YXD9A7w[tsKJ^_~*xP<;nH"ZqxSe3'X33S@TC"\XNL0#=޵ ~TR<ߖxW dP]W_[tĕ ΦO G` lytν&WQXޖzelEft"4"SpMTO?at(;D}]K/s*@ZZ^WyHbX.Vj0V>UL,=sVx8ZP;{0?J.x20Spݡ@t{}٨G^ڵEkY26GG$lƈ0%F$ρד}8ꗥ` ncooo(cmN[zC5C:тŽJ2 Isq9{*QX͖iz[|dבt"+(:uf:>X|4W^-܄ FGEoq:ls3UV*Zkiq^ NrCi ]>gD\x PU, v.wW8) GQx6@͇5B앤\IC35qiH2ɍBtIfWzYjrdC .$kH&`BU0vl `u%MXͦLbz] d>t$?g䀡oLҶi/ fDtL,tjRo/°NNxhuSyY]Pi*v;),@DL`+֍f0x9u 5Bs0@WD/]9\( ЪԉNP$"wJ#yTG 3jc8If%B0xP ԍ{P*fUvj"!1:4V5[82o/EaşBEv8\ 9%u>l0@/Zp83Ð-d:,3b,m ;i0i%mzԬH:@UKK VЩYWSHf 3_b]6BFeoW[cԌPZ35tTR;cA8;X0Яidj2UpL:%s¥i @^'gх`,3*ZܐTt:xz[{yD,&Cƪ/ׇ1.6_R}xld74DI1,O/JB+oZ,1 빴XNRu'\!)7{j*(l `ΗkQGBL˾  bɵ)27ǪunCo^tU}LSWJjF&\cb;Z#5+9#CK6~@;BpBsg|ͷXJ%U6lL""kL(rU=&팢 :<'n}?Lwh\첬kRI  (#OS*k% G| .-sH(ȩnE ۳-S0P֫a_.Ÿdp:Iq8"2q&@@^>xݏZCm븉tuO`cf'?MtSWYһS99qM;33՟| I*Rku#Vir?hͥ D{w]֑LY]&Q3i\E:&A}Y L_@ ׾H5?ۍ->C !N1@ܝ,OA|ga=Si$RlvZT22Id}]+PS`JGQE<5SD qSoZdje))Ӥ;,/,$eπ׍&R؇ٛPQ7`$gLQ?fGV+ C9v _]KA!;Ԡ98)oU֭<#R#;8z C -(yQkuyD7-ÇK}s:F3ĸ,J[#"n>Mi]r) }ݸ~#eϑOzH$3o-zR\Rg`{jOvΟEc)6j! h"s j2䉑X!@e@wɮa1ʬd3wNov^FYc\]~alh n$?fs{^TۯCK_N|*ҿ1PlY^9E>ţg`G|4:ЌǮcUL8t UPBEP<U>mr[*Icpw͝ȄѬ1B,-Ӭ(kMj!.ϫxͩQ"3/Oun[?۩'<^{p ^t,ڟqGTPE czp`b{Q1;+Y?_/~_>ĝw~?Lk{s&o^ 1S&봸KVX>t;vcy#25l-l7UkB8@6*=u$(e9dz:+ L[Wh֕]^nZ15dZP}$;羽ɔ@SuGniI K6 / Tt,NBvjC`B Yaq4sZ|:]_ ft@bx$: s RU=0Ӻwxh4)8h6SFG:/P1JA)D j'wD*[[js+bQaي;;41`D D0I+|TJΏdfnIHDiSfzY{.=AKW XFZG< !ЛbV3? ƮR,RtU hsj+*Rʐр\@TĬyo~w%B1!捯} H=?C0ʠ/ ʁ3<nIÜWY'A8CYE@=<  'uш[<ҹ2bIa (/9$ zQI>h:sxX&G\OW::P"X7wsQyk{꼛Sa|>̼A ?8Թ]O{{Vbx3Y-VB{K'xFJ6e~^؟f҅3"<~k(b } 2ҮF#>z܃v睑To&KϺn'6 mqszgrG)4ZӬ`Z'5\8PNk*ZOV|]?LNOgiɈˡ Z_vvT&Uv:saO*Jdww{}~!-~ijVf#?5\mY ]'m^k?_Yc*_WU8QT:Z0Xa*5`amէV澀$04Doױ*BDMUԤ/QT'B`+GhL .zJQ W d0Z [ܗY4%;3ŋ2QeBfGKJP@L.P8\~ԢM |}* |(vɼ*)u=X|Zj?06[#j2Vܖ.tN>y¶z:ӼIӈjX^6ߺc(B$\$/7p洌cexxl}y*{Vy]eo:%6'gކl}`K&'*ڣ@|Dٻoch'z,F͉k̋{ 3}.oRएnrimn@EOB?4S".Iܕ13A:޻F~G K2"y3j=`}qpAL#E12/\[R<,ҼCMK}~Ej?-{%h!I<ƟJlXk9Z2$ u0JzbQjl2BHLMAx3aefCO3 n2= ;Vpg9zXT8Ԕp8gnV^_ORN?Uʾx]gOݖ[' HCtx],~]}-y~D$vyf"u&f)=߯l R3)5 Z`%}W'wWQyN87"dcG/üITP' Y6BdUo}Xi}WmIOsIA9 S3D}ۄ^yXcA%:vM_E03%S,l'}EIgW$2T!75{X|Bt"((.xgKejGz Ȕ߄-*msM ?&pxmzV!?G:PvGJ(!}jUGouB:DT+ D_~G*eRq`>!tv@2G%LU/GgtZ7->C Z#}~gTN|qMQ{=X! ©"xj#HIz^ >YGbg\ jXsִYʟ'^ȟY~- S :U fpbċjGd͞ h2$d-/W2jo޲c--g9 * B- 9BJ2 C1YK>>~juIV.#3ұ r SB`i( s3uDJvmy RLZIMԘ/nbA#>x H2C2 ^X^})%6Z0!A&r^6T?Vl,ZV^bl~v^iƘY[nXˆ,lQSwI M2XE#{'R3?+M*.|tΓi؎{b_8>]F)mWJˤtjc|KvЏVtNlzdXq7)UƠS 05wψpz]y>BppЯ)`Hb)8##Ph搟]5&|_zb:o}y5 6*W;N p0w>v>zFy h,ә\Eⷑ~ͦ!Y+ηoPXc^졖}SA#'3\A@p) 2c$b# LTzx@E5"fO$ W7`X,;P +Wm'0{ NeP´bz@,߾1Q{~)lݨ~VTs--LO]"N( a`8h@0Fn4-πq*:|PZ%S뭺^G1[k1Rl5Axiz q  5} 6e @ ,`닖+kT%k:wIFy.>k>]ZDDik:ߝ:*EAkb+Zg<3،~u.C҄tpw`|gR+Ιlf$ճ8c}SWvd6;YM+UeI A1>vo~]~rUesVv}jmpjsouKt FR'!p.7NDG5äT8cF.''J+T̪T^Az+ػNVV OѿY Ls+}34y@5jE:gVr^bv*V9Z8r0yTm%<Ɯ)lHڦ_-+ihcb 8'YC,2%`ytf}$(>%hP𿈿:+02!=7 p-xR!_{K p9D_w_!UP 2S3_@@YAyIܟP!sZ_Ѥ<;I8Ȃ>Xi)$ 13fI [}8s咝Z7KX^?Zyfz?oU>Fˎ;/P)t*/FV/$*t xZN49rW)\_m˞6/Ǧxj́2Z5w", C+FRɤWg-s(i'kl> c#k݅OUm$HYޯ֤,3(#pȞyi}_X_e/χ\ZYh=a H m\OG{LTWU{>P@ȝ2w R&6+U9 ~w3:IM@>h6MՅjo/N&Gv/ݏɲѝ؋1?rʝh/G5̡$N.Q{{-C~HЏ(P"- _]mw+,Y7!Xk4d,f"bpOՈ?w2"ʡ,;GIv2 u{!0IUJtS.O}fgw|ryZ{߿.+O>#VH1R9R;ϧ^2Yq #ge)-& QxON; [-/¯7<^3n{ri;/One >׿MtUr<B G<7 ͵Q1/֣GD1"ۅ? tE!it$R2295{L}wG,3|7~;n *ep q y@DE țpϹ4A̷7Pg24oFF oBTף#}TbK}$zJ=.r̔}w4o d~DW^WRUK\AyHQCF.W9ʦY+@̐}3E'VwٽЭA9*%8 2q2<ٴzdSc7lo|OX1==r/|^#-_1"B'@h)Fn ]49u%>[nCsb-Ӳta5ZTlA^ d.mihY'%?Fnʼn/x+ E2P!z`|rݯ _-!}6W%17Q[ ^j  sdছh:]LXv#ǨP:/m7K#d*M!i"kd+ek%Egnn\@ A翥p'q=ݿ6Ɲ^W*e&-U KI˗aۍ} q;ïn`mhZ+ATTs) *JGWVR򾪫lp6MJT=mS*:Ohrz4Hb]VWu٩Q"#亦޴:лJ#sHYqs8C=W164m/Y-SV&1T򢫕-K%jh°R٢Ą\gȌM3mī><+mO>-͝F*8+Z+nRo+'ˑo@e,V>gZQC_.EColpj]FpFO\y> j DƗ]1s(La 5=mX3'R(UNyeMRZM8//5, 19VLցbNzI+ҩA7|lʋ oh~}cN>Zk?h@KU&~j <6  6ɛ" S 8L(':LcSG'(UI_~n}"PG{XyQ:+gxs G5I}>N*}*W2IqϨTz`+׭.RO"6QR棣'q;B-OĀ ul@3_#,ȯZ3 X_BU8DQ![\-Yop璪FD,r=oUBտEBc ~& j+u)Z2F(y{ub!#F/ S2m/Rv_Fz4ʗRTQIʳs#]9%'8QY]ka#)Y讨wL]c]E|OtB 񝋤/>=^۳55yO^6~m^ +ƺ}~E\69ʮ.rh` hz/ے$8|C-CpD!TLE6r+˲\ \,w(϶DC SBIr#c}J%0Vo" { !aɬ'bX&"zC,b i!9g!G"ӊ(.+(SHb>Vo^?/h/_@7 Mڮ ҁ͵C1Eo**j6E؊t3Q$+8{;߃*Gj bE…#&uXSH!΄x857}J C]) G),ɷ92-b2>:)P8= ~{ypƮlYܓD:jSWKD06ݮ7|p5s|r&<[n|!g{>Olh1*C,Mb@3LyqYg ڻ(;?&x6Z0q*$GT=ں)F2:X"]5i.uK%f=Lh'N%},&]_d6;dNѐVo29AzA<& H\)?7 s5k!@r3vK8Y@*i)Q.R}b`NH(PO}zpRL'0l\&ºR8 KFh·~%f$/^Ot>GchB5!ZĹщzaPҪ[9tl>vw{EZbWyg0wڲy[$_Ԇ è(/edհ Qsގ?ٯ8{"gt,6HeƿtJd2k dU_¥cwP_q9%dïh[u娧*$q "V5bXqNA}~S ϒ04"@@$t. ks0,٦96`.Lթ^-zE՜\Tk qs.#baő=rQ#-mf&lJ (RBƑv+Ü!j0y&s[hP ?ZW~ys:NH m^ђo=~gT/[??wixBWG1#9 Ns$`Zz'%M H86hCRO7y^Ye 'ztyHݞOOibtm:D[mÇUθ,%pIςVA?3?Oآ"WGU_'. ݖxWIiD/QeVXeI)BlK5 ywߣUypv2_˫6lח{LzHH6 .ǚo-xKtkwNR[ݛ?WUBT * z s8nƧY8FR 7SNw}ޣܮfȩ,"X׷5Xc< snNA pD8`yM65#d5Sidࡊ16$bE Yr?nlv3aaď"Ϯ"HRZܓy݂/6 2 hzz^@}"Si߄D- d16!60 vͱ=>XWəg]lC)vpY7)^hE4.-֜ĘTЅ E D tD*KI +$; "(D\(LXґ( 6(h9(1 ӞO+N(foh 1ZcOUYŔ]AbA*Gq=N0֛dP+p\84v3E@<3)dw{FMspeqqqU_B"]:h6ALBl*);蛔`Cln5 U#XR7d- 5Y +ɧiI=J 8 ǐ1Z^'"hAI9ᗁ}[3!=/=ūMư󟧏nvbs¡K[n$co *fnJ8lEz[TOO(ۉg.*r_> \jڷS ''sC WFY;0)'wQfJ*&:'Sg#7W2lbz36_کx|>BOɹOvՕ,mzKpeT^\4,~k*26B3!$w:|42de0EL%D27u %UP:/J"[Q5۰9[Cq"$=ow(TW^掁yM9fOoV A?b }0` :э9D7UqTaఓ[Uʃ%ꈚqK0tZ!fuJ B68{z gin>#v?ogYbpui&r; mJ{Zo>N">wUóOmɡ\X yؑɵA BaⰋJ~dtD="?O:^#ifZջRH3=bj{\=c;aF Ȝ25TYD1(mqkLEw]IvPLb_\Ӷ.dgD"`Y-=6vT+U /(_01h9R .DtD1CD]lebzOCEjwEym&/,GUyW5 sCc}58ESY;HYo xF6dC ;V_g|d)lƉ_ l*5:\ӘE16Z ԐWai.h!C|>xwvk$00Z\i+--uߌu$@Bp|+lޗC4տ~ "2Hk<\-4M!(&E5 ^\wdUؑh@`D;fZTpMfS1,'[Bpʝ^UKQ< {cTRxs!I9H -WpQWg!XIxHý֞os_gWp;0H Ա5C'vg4B;H׏ֱN-־"hEK!z~i~2@BteQoh2AeDfv] )ʬ>ɥ%}BpY؏V:"\^$g#5hK8N,Q+y׽G|$^&}bK\=LpJsT`QCUPќ6L4 MءgBx+cjw5E˿nͷ;ؗJ) b:m;N5\s B2s] oj[388JgR7,8 oSxF|d B&xŹzk6cg1c6 $4@CyC(&usZG @&MDD2NqtB:W,(YM2(?kSW>gxϞ]Kx.zl mېD'a,vyz-?7$)V,<a?5Bj&8Ȥr"%셿O%ؗ%lb?%UʆzԜlm<}-H^dy)N'eȗ4&\)5Z83q#-lߠtJ6M??? S7!ſr T~oXWLF>,M3.gTB3DRx˛LK} )-^6mmq} oj }" YޥrAXr@x}tqer?8*A,'<6mo@9?Iyqlx>~HQlnHW眿&J2UJ03Ĵ|-atճ-qFP8TEft}!Nq@F c&3/p{jMF""z{TX̀v iQ﬜3|C I1"Swݢ/bT@%d1e2E|ɇOYoоD:^#`׽Ǿl]a1_vBr 'd¦4s^>B6Xܥn"B_,Be @HG6,G n͎^Ym~F|\Q3GEgWWu=]kX#^,)! aT ~)?RuGNIV-0/-}2Uq+նVtj?yu+?fp>/wFoH-N0>7 w 4|R(Vidc栍MKjHU1_oYZ3z?M]vetI!JJDgWy!m<틼M8wc>Rcω诊kHs<­oN>|Zwuv{ݞ4!B1F΢wuup912 %.gUțkm lƽxn%)]{SSt*-%Š.=R>;Z,Fdgbs}:*^ׁ/PUZf2ê_'DJ{-ދp v_+AqE TVK-[pă֠DaVupYJK1_Q~'kBc%?.pՀ#;? yacAj\%TF(%ǻk%y(hwOaNs6] +klB^<7UJ"A']JO6h*4+Ϯ-V##_PދSWdaZB4:1'|~E6\{H-2׌}4Iw*f\]":p Li1u$b=ǨoUg8+chd@P $9|Ӝf8\ފR'}jjFWe@y8Bhsefrt",p;-[n $p&[t>"8/uOzʟv 0S.sΚ}όCmʏ^8X/Iy6]],X_kn(aݽ2v؃_Ksa+˒t"U{KgD,& g$bԱRz{?ip I- V{*|~v`!m; E!.5GRQvԬ3?iۏ>mMR1JmSxƇ%?4N0d>f".ppfFPl1c3KL%K v*@-jU }7z K!;pc6q4jJ>2h=X{719SqzgI]T(Bd*H=(Ns{40~,BUnr [7)^.n#XUy~ۇ$~pdZ1T[85[7EMV[qf]1GSK .9OR);69zڸ/D{f+aSdfCL{?*~Vo͓Uz]L,2kӟ;n #ߛ2zF[(/ⴠзL]7#=z攙 &%\\B,B&bh${V!^s150N/_澔3t8 w| iEgSFzqe"$jHQghQ쎁A^-")8qSN耢79Y\C7,Z$ ?ŭb R~{&T-fH{O»x[fS"4YőuDo ]¡Tx=Qs04-8dž5c>Ĥo lh}K>`46_4iAXd{HT`-9ŚabߗkerV2="֤^㥀 ,ۚe#s_+ ý0FrF YD ̞1, \8r7$7(;)@AHN7WMq9P:c?xw.CLf EG&:+Ea)% ?SxQx}>"Xw`D!cELs\Bq|^^GRL2Woo I&E.0po?Mܶ,THr?aW@ך_OkU63ܻc4pܣv)sB !˕@$F83c60gW7ׯbV'Mj JL9L-aoI0l;V{KaP?(U ܳoU E /\TwjtTyݗEס&'p9:KR ļr>g6m[;(HV Nd1~݅Ykg\yi?[3, TBH.i2k}D5) dFBCT&`-Fni˩B %}zc q?wSjƄ+jnK]пү%ts?^O>N,<#-G?`b ♘]'Jӵ21'3U:Es|:vpi^P蓱aXwׇ;A&i0~f}/v Eʎ'y:.Yorh67l נD ez Dq"B54ps|p,ADCp2(?J;'E}8>J5A85+z 1i?rάx- ɞެ@ͩ GJA u7vcbM/AQ/A՞l4`?\^BIj}$2yuU»GzP<+@sʴܐÉjP-?j▇4R*YC/W?WUP!r|ZV0  +^Ŧ??թR_,ӅːlI-rt2+\.ރѮLho?EcjPMm ־T5^$G\K֧ԥÓ߮R%r6K*d˱{9wvMck \F#g\Z+EY/d2JV qW!>b) ' Z6IAܸǭ!QPz(8v)P:*0z.U*^=D˵2ܤAMҕ)% A zK2px6𿭾a7(f<-6lBYr 2׹ӳ強g_KX7J͸ѣәFN%L:, (Q)=˿FDzh)|ƛ&h&u=si&PrU3RS_d |R i']=A85(Z~ٛG6DRP^^}KEk];&|XKe II3Y4} uyBһD IޔB=y3Y~RGo37Gy5cd2b i^I0p*4cwuv)%d7 h@A?vMXߑ!o/j5ae 4ŽAiOD>|7 Xӌez p]&ѵlGdir@GaiwD4"VLL;d8GA9^@-#7S덕GMpAB+H T[kEB-eBYR+ӨXգSS;l)NHtVrCZq/ >7})z{jM'Ւ`C3S#A|XN1K.DwJAׁYLj\B05Bo9Z("lނX,q ̴’xXBut Uǣbz:$1ͣ֊s뗆]n|2s0ts2 }<`i:* mZZ@:nU&\'DP?+ëWLj+).B+mt=ҩA7DR,wHm ip1q?RYsh>7Gܞg;i#oK}S!ЌCv/bK"N"3Eqk.dV!Ʊ\Yν#u3V^`a[K-/!b3 1ǫ^Ip_J}(ߞ`a7 T;IPF(ŞVZemҎїQZ[(y(9޺±5uő:@!0%ǠBZTmy7(Hd`w"+ܹKyxTױ8~CMG-URԟ?g+:CZХ Z[狋+ޣ:ܨrSWfP90" HI/|ty&e Ł dFxNՊ.{eq r]ĺ&XI$'|.cp4S>C.xV@$*HBbr/©ne^oh0p=Y-&7G\/L,sczǡǞH^NAL]FKbM豟}U> eƓ8 [an3]M=a1fxD.r+K LսOAur~oU3y4ᓖQ-S-5HcAum_6*T:&wu=ؔoNjUԆK0xشL2xO3t}9/ vHҮyms3= ;J=z=+]ޑ%tߒz=FjпHέsc(_s_=֓m+gqq:%gu Cа}UNy~NJȱ`yݿMDuz}f~\qf?#Nَ}jY/σ#V`>6rOơ[AhuJkP?&z/NVrzK8^].?R!Ê;)lkz\gՕz~].z+jxkglu3aIb{_lܿ^G[^9zK5'c/'ƣ?ot}noew_ZƂ?*_Տ77̰,?\JEVn3`Y.og{Ϟ~dȟ]hP<CrWMv˺4X7ڦd?:\م_7;Aslx:Px61Ak3zRuh}++g#$KEPiq R'w~w]G-qj!SQ8y&of7X?0sZQ+I +ml?RеŹId}yOMOeG2)EΓɛ+f\ǒԩ 5`$#?DQr.w^/?\k4PFaǼh "A{C>z_cy/;e^h9:B`yiB ?j/H~ު*+_zkdUj͔!@8@nq-^&U` <2=kr4\Dp Q>E5'^7#U$# fMZ y}@0K~c,9ܙR㬴\>S,};>E]p!hjxO۪yW]>]"Yuf/3s~<ҍ m=Pѳnw8Fމk6Kvٽ>?6HvSO, .3Ta+Nۛb\9 xxP kJ;f" Fޭ\O3Oc&FA-rP(! 5IA L_oy+,J)~診 ;rm?.-G w=QH/ĆD7df`Ȉ#T<6|wosiNwf쀦XZ%$)oR(U}u_ntc FzhEFp ☞`?Vc-1v[ʬ;xZƜ=/[=-x}B&p3%' wv 4gqkݣ Jc:b@j\]j]_!F0d!1 AA j( AѱlgQ3=Nݒ*"I mWԲU V%oF%FfFJZo)I~hcc9l-dtdY%Ae&6rd͛_[Z׫a兒[:PVR&R }f˵w7o/,|KY< }1NIvq݀n2_ōRT`#:IO3ӑQ<0-Y=-Yq"0HFGAIZ8:ףOaJ%^ȶƂ*hJXlxhg\g]K"K c-`Ƥ'k,]𥳐&PkUiѡ"@&nnqր8}1 Ūl?g e'PO#? 7*kE$2e;@8c`D[e)Vؘwn=ţ{@«IpJ4Lз'6ڻ667qޔ#$f_>OW1i;mMfle(F` cF[5wb ]`+s) ɝ*.FSy(*h X|.pHBıetBAVB8ism|jul؉32L"\<٩nU|/Cd4~q1'٭=6c!mz-.e|oq<ۛU;^}c! !Z*ᴖ3+*q]iZj޾a*dj^L%:g[gӉz4/=F-kH`B9A2f <V:kvWɐMueJa!QplPr&u"f8H(^'Mhg-<ŋY'RfЋ(5*m _A}jBd^tnl>" `(82U02 A ';>_F"U%DUM:@CYWO˜2j;z͎oe,Z ٴJ5rcWT@qq(puqxZ븸 _UZ4yH NUJ5۳k4 \%nljm-5.|gƿ ѮՑs9K@S9BlJ.7ɢy<'1jM ѕFUW@gEJB OV7x63fܪn.%*gv\Ba{, ڹ1gp60gS>b{LNJhk_WoڅDAƕ3𹟗f68\^Sňj=;L&%呀і/A25"'X2 ֍ӯѤW06qm[i+𰪣at.H4K ĝ@#;|~T2ײo:68!hO7H!3.[uG 3EjJlBb6ᦃs~˼UnoɼY<8x͜ ߳ƪJ?ދl(D PLt9 NdM-)C L}Z@[֚Xh2@ @LCVƿ{Mk/q)}3qO ua *OԔ _{4RD0"즬e!gbo1Ve_* ~;2@TJ@}.̔+UVIP%@(Rv[3%qBZw@Wb 7IEXD (>}׸6'c39.$.WN]þy>ݻIRw$wjRȨ{=% l݊l=TvoosxG퐻 Ս\r{{wOF]zѬmaӰc˽i/{M(R)O{\诣y8mb k=wyAG%]f6.5W{J)֍^6y׾^m7z$ꘄ7}ƈsW|>ݹJsmN}|=ʃP=ޯh=շ9k;`U'|oO|;=>ﾚv_ysݳΦpg;\==zۦ[v|ig9{oym}oe:{+* rkۯ nU $w]E>@`BU@P9l:X;]$V׮3y[n^Yz׾C/]xo8rmkp凈XPbP!Zasv }V$ p@ѐM4&&F@&dєƌ @2h0 &&#ABd L)zMO&)OS4TƩڔ ~f=IjlިFP51A1L!0h4aQM00O#`hM0Sɦ*CjS)&b~M5?JdAM h i@F4y?#FA1=@jOPiM1TLO Tْ)6'McM@)$B 0SɐiS i=MѦ 26IGC j4@ M 4 jH@@F@ &LCMFF4ɦ ɀ Ѧi =&d"ɚ Mz7"g0tݎ0181Ȉ.!xC0.`&PAujPK5 ; M$&JxfN#(I Dc"_E' 'jfX6g6\^9>fDŚF42A"q%'?n xA0{" Mgȩ\v?0׾Ou]b˅T31mXZ#'SJ&չ˝Dwe"ejzҒɡF6r|oټ.Geu\UdU0H ?*w> #ܛ'_JY;(KYۯ2~ܑ\3F78j İU )cHwD z3` ɵha.zzQe/"Sr X ?Eːj}yS>G3S쬐Q}_˜iwtׁOO oB09eRmlEA` NEZ12\Bn+az]\P67EuR>GIvs.㨒Fdxs$fq*B|zNU=dts IrYk-?J%ZKGZL̈&TJe7q-s>91ľ2 "4 O_k9jw?VG]thuFyG/P}~ٷ}_fb3nN#->*M\PjIi#{Y".%r1O5"[>XJD/0_2۽_*iĔc:?FOIv 3wm?E^z Z7YOa6u)'orJ["t6pQL]%xCK pFHDT*oHI.(Hq9;]37ۇ}x ;MBmGԽ6QyV QT>8`Q2N42XyD] ķ,_AkBDL H5DJ8,߫fwﴶi %m@y]ܺSO`x ;#uo=|+ @F~ìMB+~\f ױ01]+n[$i md'<0|`%W8(a1R\g;83wujݹ7(!d TT@1gmrEuke9/g!Z1XB&&E02SqC*l|x>Iqض ŻfgKgs%`Da&@q!"~3p_re7SweGOg zz2>zَnK#,8ڨih8.J%⛔:Z'h)y w~’mFQH=`֗= вP&;ʢ箟.vRrVܪ9yZbGGWaM;Dsd/JaŊ+$2)~u[@[U%';>kԷ}ic~HX4W5՛o_|4㝜H a05!>g$ImDIO?-, ©+RS.1Ҹ{Σp]_ s̥`_o[G700GmSec!NJm3gUMλ_ ^wOZoC '?r7umRGuZzObu[`55\gDefL䒙$Xk 4p˴y}Vdc2(;ҐKdph(D!ӵu]2g0wU~Btڮ+IX2K[$QQ<\ۭ+<[ʡG^U.jv̤iFB@$@בh:-+8+ j^}S ;U0QmE@oì?9D,:fr|TmS{d7T_ǨK`n5JnjfvvuPtӍj,VYDggr8x VMmW:\涣3wPIL_ kwVl2:kns;ji=夰c̩EcQSj"fhMhql*U'vvU{nU;6zKu1aa]{&zMK}a**,|KGibiX` 27(r4f 'A7*Zate9ou< Q|K}vSz}fu*%۝{h G $r݃D(K#@z5jKY^էE4XYiW|}LI_=x17ɜVG%5y{2q: `Gi)mwLx&5S|}|>l;lV+fX\eWUhV4rmvKt!~nd'8,4 $}ajl6X9S"L;ZVZ$·1aܯc3Z++z[R Hβ}xU͗Es!}L]Kev0Fi \|3/dIMG"`Cp{4߯;MHziNuU=!=T99Z1߉;ǵ&GW5om\Cw>gs \ύc7 1C첗=tOY6cKl%QuMͪj1;ߵ]N>Bl{6\yf]M'I&(:IOfxN5%+(s;il [)?R%2EqkFZ.w5lU|iӱqTWiTn3=-c0ͮ#<~d^;eo#!M@9uɌ޺`s" @A1/Ap(insɗL1l^Ӵ6<'9BCIq;0/Oll:}9m.Oaή95)9Xq;te[h/Fq*La`n*(iDj3-+oUp#G9^֛,NjNVw{AIY0̌b`}mչDIhGS/b*1PRUWª[%:촯6 YqEhBjK*U![$.Dk*5aF@#DE$5RTlbf#Xl%J~u]g~杙|gPW.Q!A)``s- &E R#R&/=Eot:jÒc&D) \b+[.: 7ۦmExF6 hٲ.ӛl1UjacKZ5@K<]ʽ,jsuy, ЌpD䔄vll**Xder;vQ8Uu\dO`FΦ~noi$E )%-,df&e3YHq[< w!p$J0 A-JГ$:'r]QA29  1zGJͼ 8 A%b䫡&H\9̺˔=0gL< S6bePk0M^WIʼn]8kK::PE9*BP\+)$|le<a1A; Y&|֢^72{kTw"KdCfZsK8JrI@roB&IIfcLfSf׸搯,, e|X2Zf!4+jJC*LI ,Vn3>t}30$5{Ƥ_[xuR"10 `Ch-~ykgcB Y%.x-MB C9` S6%sqD }{D_`d6lB McHbrJ ĝ )Z@&)_vrm4r^c8lAg]ݨ\DN|hmm 0*L^K22dF!d*sZq͔醍{5L#̽L~Gk0u>ȢC-2LecmvC7ʺtIuv,'0Nc9H>6M~%I Ar"2X^M[5gk/)Ei`9c/<m9̗Bvg96ɇʍ%E]#hGj: ]fuuXF2nXS^wJQ溒Žf~΢S5^31c3׽ujgm/ǝat TƟ?i%2Y\w3RZ]dZ-uR"=FgKƒwAТ>iqU&G;GmGQixk G3}(Ytv]nj.{{ 6jCMD]QlgoĨWa5$&P5YEg 0}PmGX*}46Ķ܋;XS, a3ą5g -ϋVi)iQYڸχǴq7K?]%MBBѦ(AeF-F!qjM4}F(܌!W;wLe%?޶ Ia' <Ckr!aj/R}ÙᐢTY<]Bz@7Sc^7 P ϜPu]gs~:mPcɷl.Ybf& Un$i25:i 1✛1!UCOBe~ƷnL$0j)i+q (0`a\As_PL) \UL$&c79v$Ǽt~PUv[kkABI0"WfvCn9 I4,m')KZc[bE54VEI$)ɮHI Nn! gv 5vX,X؋gW񵴆 3HC1c S_@tL߳!I=YI$=zHl`@u;v$`whВLw&"I eUT--s׺ܺ^m%Dk%ܹnɋc)O*჉+H_d}ʪ}܈g|.c+hC+2roeDK8#f#נ9Pm w,!10޽w4prɇ ٤E̒(S$3i!XuO.IgBCVv  㨐4;!P0g#ntjLhR4 kqSIB ru*0"F ϳ9h&tAdQ!=f5hԒ}L(`Y00;aЬ 'fc` ,)l`D4`Q")(01(Rȸ 0 Ob3) Mܑ O]fwR^ͯX _Ol]%y*~/U;og]prFnc.Ii'I}m u7\:yΖ*¼<~ 69UHSޮeL(+BfL;ԐZ'>Au n:iQ98 C7ALgs93|۬Ёt~GNND00l3%hΰ` ;P i@7պ=t[6W(Ծ6Opq򿧷5 Yr0skO!x(ߤ%K0a*\4 |[ڲ ,OxNA9TD1 ;W.]5vM.t\s.hbgTߙPMHdK٩@S\~Lq뜗yİ\F|tהR *OC$7(FP"DZPfp:B mࣲO,7REFe)?Ȃﰊ("@Xċ8-q6Y./l_u7"nzI*SL!TイI 3_ r.)%"0=J %'J0]qtv/8A(t!DuuLH 羯|ӿ2mPB=lm+픭'sC`c\ lKy#F[5uJftXhI$t0P‰TQ_OKI4ntٖ֍G#[XZ[t}mMnȮQ2HMOQ owƖSl.DQ$ '6KYej>mM*/fib=Cd _P_D\TـfzJ6 i#!ƞu<9@DBb:ilR"D R|G?W3e;dMH@H2I eycC^-TP11/hC;tCm9Lwϡ._Dʳo}'i\cI;_XdG-=(9iybZnzYYaLRh@dZ3]h?q !$N##AD I.+}}7sAh褵+[;`Y냑X7,[soid77GPDDGPy[:U1Rα aItRȷ= yJ*/2¾E pTf/kQۣr+/G볪 ",5'abD3Ggk^k2|~\v=^f/'٭5^PUMc]ZOPϜsLLYceK  'cVzb'1m !DW/(X|[VWveEEzT%?7)?Ԯ(F5 O-26wD'KP$X6~6?Q?wa $ ]3H`3-ҿ?tq545w clb8HA~ }ux~4BדZ@ 1.srwҞ|lJ";&Z]u zl 3# =d%7R0F>CQNq @Yl*~Mf07fa/XHYޏwɱB%%bŌ()mb_\8S}x% sf [Za3 gZCW4\yD;@L WG_s&睶www0=ؽ^NrNJˏRr]auP="X>s@x9>a ?lsBĆ k=>x)%t{2Rg>K.m^4˖;nѧɕ7& L;][h08!ztW⑃]m̴ rfZ0`JFh0֑iOV $R3 }=8~͛Fl#Ur4a1 I4@p:#dYsmݳJi9ͱa70M~\;K@pi2Md1K\K˟ϯKDΚ~pKT<,u(ˍ v֨oI8]\UVrWG/Fifۤ:#y3X[x2GHݖCBʼ7|whi RQT8,]ɈkZpXZ!b.00 bPeO¼_QwY i[?ir<|f|:w}~ewMQ?N='Ŗ/Վ9&*(j[?foCn0ZYoxpOseɴnW}08.Wޞg17oX1YfXLv ?/58gӝz6 Ee%mAeEodqi0+nE)gaWI%=QCl(*EPEzr~J:lTOSg'>'-—gb0Ud̜lG{JWN)-vl$^otў>u:wy>t2B@+4%xyT#VA2յ T$%BM}ѐˏo5A `c5#CIRܵ3u5 y; c\ks n| =fw&]t +Ay M(RdU?uͻ_95kPdz|Ɲ lrӰ؟?@;OP$^yx~mg~&{TbK[ڸ},YL&TV29 -l#.h9d 9{F ؽ)W=7LAuG= - UexMړ^m+׍Ҡ9ϊi&jsF=$oIo~Wպ|ZLWl7=BW."1 !<l!Rg X˘wL3Aٽ "\s[>߰Vy{S_Tr/T^f~?(] }/(M\L0Sm)81 5JR&u=zz|3}/"ck |<}Z&L-:6 dē u.{V_}N+pٲ+)~oy\s <ŝ\jnd\Zmj{ۓ}L}(Sa+<`V?N>(wM<|40%A,cFtyvEQ,KAd_ H4CGo _|OZޢ A`۴ u{Ϝo EG 엿+Q&AGIQos_.s 3@0vAU=|dKzh1ݳ(ԫax= ;a?jNDfhoRkduEf} HkۑTA\BaMcc(gF#q0Iܽ<^SڽWx)Nv'8J|ʀT@V K+(BX$hj|מm&wkDwOkq˒{˴SI^˹ʀ9X\G{@?OA=ȐWʊ["8^FX k&k5 V@:yprfqHG,*'f&0`V^Dtf%~;SgtV\\+6E`Nft cKf+Gr=j³]vs(ffB`$U a@$aYLNy5_u}g+B!&d I5;-^--˹ Õ.ޱo^Ca2EnMesz_g 3O06Yi:oN>X9ϿOfޑN= HvYۮ:u칀N}^z!f_ѳz]uW.RHƳ& :8fMaᑶ?7_{kLj -C|8h bX0G!!((e{N!͎P>Wa-92ɌE17^Ko@%n3=,8}j|fJ =n[(aPE9+Yj'Oχf]qxA$U)~2'PQWR1A54Bh$U پ`ː*A  .Cd&7Bctd.B𜼙dYȤE$,3ZdLvFhPP L4 6Yfal`əe!%e 5! R>6hPA̘bU’I20Jd).@dQ JJ9ArؐjbaX`HHׁSaR~"=L ( i$Id.v^jUC,MZOײ:\s+X Z[>95P.3\LL^Kd `D=n&޵5:ő@, ^1IwY.N7aqkbӯk+9LNzIPYA[Z:Vhn{^Q+ yI0p(.}mһM+k9׹=uY3C'C.0G⛗Ѕ?5d3_"[Y"nj oE)'"ϰYFa?!0j "(RS"Lm#}Xn@5ul(),E$8MEk Mz.:%|UC=tZDS̫Ӷ'ttçK!*z׳05k ÉQJCe[r JEt1qxw dSƽ{1`,kynI6N}.凥YGYARVMtsɡ92/ije^О=s@0%Z_6*zzᘫmD;{t.O{ҥOB0FQ0{(bK7<ob!^JjG9gON{uֳ|?-u9Id_A+=r1N!e jt#CM="C"B+i"ntfTM&AfeH?r#0W:˜faHB;ѣ!ʮz!jZSh_}4k#kN0Ŋ+gP&3ɚ:G0,Հ~)Ě:FZ]kfxwNދYض# dB?=MA>SK)+#u3䰝$xJg$i3 dzͺL9^M! h492 2_ tnޡKٖ0K 1JM^B4Y Jbc#EKJchFHTȮ fSQ[kxMU JKr2su7d&D:]igb_>/UzO0 hѪYY=h=yL:7mm,X< uR)kXP?.輝Q~x |jjQ˧bC/* I^:1@.q/x`~H3Eеj.O&d߳xvoBR?JkX!1<-w[2oc|f må6&(K9ӷjNO`1k& ơT:xwqqzwS [ݺP^:z۬d+˳LVֱ 34VR}eE&|qkT5S ئik_)*qWYE4imFZyV|eV.3^SGs#\/̺`kq!Z.$򜮶(L۲9Z^Tt^CWqE>ZL#yDp(1# q7GFU{:r='0\:!6f-83ܾb(s֋ӕ^V411BnާOAg Eke'{uW;ڣǜ88&*j28Oc|I LZgV>Ш!<:P&a0]3:3m,3ΚKc?o vD;L;gWPkaXs'H4855jZ?u "DQ. А}Wˏ 3@tg257vmdp@m^Ƴ@CP?8hݕ虮XfH2ţ"H8,-Ϙo @Lp{,e/JҰe߼b٩Nu!GƥItIrxŎ>Iwgf :ڲr]X6oNwMZy(aSY k2lh,e`M<FqQ7ҁWk-ty_M/xO6q]:…F@N_3&i)bľ$RHq'KtQ%QTRW=k T~}"R* ]Ӏ򌐌I..]&N .6?v_<ml%p? }/6<~uQy=u̱+w""(q{Ť^Ԧ%n6O+SV8->i*K_hfPfz If89⤄i<[7{yfԤKpH1|Ӻn2DvvA m:]Ұm#*ARo*u/m>ڙpq1Ǵ%I@ܳb[}6%QU ..gD8HuJ D<@I!!VVDTCKA[Lem,R`99!B+Ԙ0l ;7&=erM~!J P WIA-ȥ, :#+wA|.mz-:?e% w܊r$ʝ^ճi*Qx8*Iyt ͯR8IZBLe1P -ZqO]Hj:7'>u( lu@,zpxFV:1!j*"2XWv}f3L"Yn5dJƖ>3J,b_Kq{^T3/1˂”rFAuR^<0BIկi[Iܯ|qA+m]%FxxMk`QĄ2(b="'2LjtXh$* L`ⅷٌ̩ttmRuCv~no^V^(fԠZClxBM#ءr~NX=2*b{\ b:IFOe ki( ų1|1 ],s*L;ÿӦ@#N4Yyq7m$GZuyа"uƗʪn}r{z\\l܀FPWF\k}%Zɘa2T9wH--_\KkWZݠ7cLL"˴V*$!}A,=%iu ҂KҦ lcxM" $f bJkn=+A}_dC>5x$ⳃ<ϓtSNjdLUkIKA; ZeWd܁PLb-8F/[5$g4RvHnb2AբاT"QF$@~"zBώ4/|W{>$.1-(a0T~h (LmfƇ 9GI2r馂 ^UmR^ůUB_v񗠱@CrZ]UQ1[ic"Ǜ\O.^ iaw@|du!aS$z*5M$(k.m̕4r_[t-4FR%w!ͣJ[:@R90ß\+%+?4-6N5A-oF͙)60xX.7+NKIPX@œv'vxM!0 V,f#]e8/%)%  !bևs|!K)w4ee}JYT3 Dddp"uoIff4: L]+Ri%TTrruYHҖqҰq4,{]f0 7z$Ru>N3g+s*nK_u\AB6x;v|Pwgn+Q&ɍFB~ߌnhs&} YWn5xrV⪲[jHW-p; U |ea{4e[_Q#o\%gQXD2@f@SMJcr ɏ*0ވfbn Tw^Hzx$琔6,+JȞffoBk Șy,&(.ש+O̾r$݆ RZuCh3oc:eLgaٌρrʢ}dt};7]OAڝtJJ&Sܺv&91=j_Xc`},*IdE+ UI`ԙ=_RL)3 [|jT?.B!A-6+h!$" ". *wqu]I"eg[saU\šwW9 N8H*\|~;<Z2 `H $%eY5^+Ψ[驀Xƛƺ3cd3< OrZ@aAqd wO>y,@CRs2W&jJSۄPDy>CB ͏riHM,8G@N=$/,8 cxv,=߻vظ>i,4+ZBV]R+96>:$@G]âw;O'b&傁M>6fue {̧(ȕf^c|7NFww o9]BYԎ9}'{|^Ν U${ʟxe.; 췙GE`AY=%0" zԁb d९Sҹ5)pd,Î]IiU*6I(u^`X1U(̖E4pbv=]sgx#J4ZL::ib\K x_#VSn\ZH* L1V!)[8=_% +]Ut-j[f\4{`ѤG`B~պgοO U[wp6vvoƒ-K6Up}>:/i~}7?Jz:fֆ=! R#: Y֫(4}SZ[:yK;a.e"-숣5Hd:@c'_&6{|T.ܸ;鯡};ǵ~[n!`ƶm Lǵ "e}Gdzj<M__?=diOݽhک8:+kS5.w_h)yC_KVM0!,QIGI l༧#M{} WUoY%e7p}g` &확 `%'Y~ _agFtG tCX8J;!65B_񶚺{`җƱmZ9x~t3Nҫ LSA9\DžZyINʀ)8Ly yk0 vw_ 0#d$qPOs)yQglLQD4;~^b=o%uFoDu̗bYFe/E," 5sN+_?{u:ԝ :Y n|SjY2d?DYz?]c=(zwSMU@lB__"Xt"L^MO 좈nxﮨd)hT5URJ+J7d&(p  !r0hͺR8 F6(2g#A*@\h^ʘSnɾ `Qst%@M D pҎl ʕ,++l+UO/X]+!BG al36zӇ=vྑW:U+ZX-8}LhdD?r>߯/}sfPmcEw$k#'՛\BʶKYe=N+LOXC~wqܪ%2/@0L%"6.dA_pgܶ6wiZh'|/6莉_[t UHK-1MBk;DjU}{3`&w.@cZJՆ`s$+w*yƠ+nN`&|in TRyGpm,I@z&8/2Mbt\0E [[{[L'/}F +>juM9|A~;Z,Ԕyz7O=\uc` ,N\>5|*_8K8/ɣ ciO{M*Q ϿK&x1^ jLc&´L 0(NCh:YAwF¡NtI{wTX*s-JF $G:]JVrK*cD,IYZqO詹D a8"aG$/7(a i: 8/(o^Fx7j> h}J0;,^{z }o7|# =4bYwKvf$۪"EI[ASo I{ӗho#>E8:` Gu|޴z vM_S[r]8{qnF Xg i%\7z%`iwP)@1ygj-!Ҵ})+t7~LKmN 0G1 Q4CBwOko)f&]?wxKcPlW!'10(H\um/oN&+fr  .D*lD կƀ( Ѹ:Ct{mqD^" {s> -jN~{&U:,P|̒y˺c( ٿuhY B5ufH4crWP6r}-@ւz֊чWQCm#x]&ԝӧ-QlzQaG;/he˓8zk1G0^TFx7{h _7~GO-L!e{^קlQ PwB}9ܼ<\%}r0$9DU-'Q|n*˂l:F=}R-Oǭ95PZX Bӑ~aZoVI_bA(&'&4lq?l\y6M'PR3wW|Bͤj(i0l76e>Els5W'85mTPjKy#_ p`sKScC倽aʍ졔d,6.[\ yATQr""P lJE+@rqJ % C_'g&2l7q9{ZojrDLx;q; +:>}bkt!6Ճ?^Bz<Ԉ]H(eN j,VXl|͋حc$8]$v.Xs275o&)h\[9&%޶bc5m/_Èc1b1]ҧ>,J'mY&%) 'Y/.:vЙݵ38a= g8s N t[\0#Th9GzZlgX,Т.#TTLW;НD9݌d0asݹd\ !$0*ɼ{SI FՇSWRJzSͷ a*M`+8IHʂ~]&&4,ͨu'/{A\b΍?FeƅQ J9 |̀ ^+dg9zכm#8ŃgAUKL}UUZqOq/i%#_1a0.NU/_F ]Y9D5"|al CP̫ƭALxb uͮۛ{xQE@c"@L]4H+{š*B %yOk-lp˵m0am{zN&8!E j\=.7[^yWɞ=FK0d$i, |y:$ Fv;3" _;iy;22S5sB{ &+rc 7[q0Tŧ2Aj`3# m3!<ZQ,ąqhm=.ʺ c7-=@I &%Rae(ɡo$hsNfnak #{7F[(`pӡ [HVKuHS`uK ¸ \0oҊ[:E7L|>)qO^ش{N<ƹ>r(U<:?Bܵɧ3ekR 0'Fg*1 A~E?4 ܠ_ 1 gV:x3fWvzr>^OR1:vd#f{gN̴  `-3sv+AJN<~^^ g7GO0QVn 0FֆE! }!Uִ gfCnØ0X xbR00z0&71ߐ<`0~`RcT,¨^5 gآywp=?-k?fFsIc!*sT(fj+OAh ݱjACg*6ƕD`! ΅=}WwzFiowm^0awi:q-ZRg(.u}2^a-}k[s!y*WRe)3@P=#sQ MUshE&/U6C"AMw)ՋK>>=>phÇP7zjg=dG 2u$:XBy^Tz""uL Wm ih7wu~2]nr۪4jWiY6({n٬ppƤr%SC X=NfWίe>6I a}x$kPSWy+w2y:YN9ۭ'0_ y} $i.#=ON@zLqCIT"D!V7 !ai"@eCok\hrOESx(p| ^d ^t@8znwW~33WtQw6~͇)hC6HDA{ $I=D_82 䐈E$*-X@EN6I2T27!ltbb ^UD$]#VZiLKL5>w=qK%áU8T5DCOo[uNS`ltu3ٽprj+ 捊l6ygo$ܨ4vb ?o= TU❠,uq;Ҭ0 \ki,,VORAM N#+ npksq,G뼩[e2gĪWW X4Ŕ <>] ތz0$N!>>Yˑpmu{W;y[^Zvt^n A<3D9/LoZ1Yl1C+ȲEcRQ$DMF{c@9\eT'k1|%W_T~CG᳔hɛ sW} 1ڒ\/[Y?3/|4NO-%RފO“bOߚ4QŬpG,+P=939=Q2b]o[~wCoQ_OSߥD{Fq1ՑUv▓.͗BQJtMV S Y x({<n j[ǶkMƘ&ʰwTG :st (=0p/-\]{nȺFX>p%&+ r9/zky'Dj.M W}uKf/d|04,8\/gz~UX`a,fF1?T2eBOefÁR t[ɘo̪]};0u%ҽwՓbaEpKVvxBn=i͒qBr"?<K1Lvx5JFw jfA9mFgwU9f ,(.=\3G:bjd@u򼭘#֟b}Qh:,VWͿLm)vsbnPNyU9&ҤΨCꮍd ݥ,3ۇM#Fh 8- ڂ fLn(Zar3E4íjno=~[\MEv)2W>1=d)}_zIc~6 J=<VbKem&[qm6z|6M!{ @&- Iijj>]y~OwHI!?I}iZ3y@BoGhѧR STESߔrmQ)^_X d$^X'[bka\ =SWhݷwyk ,mH@$4@=͚[s11Wu07p9D^LGk(%Q.j6O#-tjYΈKn7t"P$ +aFeU}) fnp~EKs3HOU'>?א\rIHI]<8z^sN϶Hlmql'3WHsfTKjѭ`ycVe $ݣJ&؂o:vXMP+RvHH8Ww $?{*I  : %^[6J.2f)Y(Z wh:m@O$ ^!@ xVut+VMd<1/ZyLNے(EoB:X2o> l̯AeYMv6 =w;>|Ci@hd aeJ7K礫]:@_Y2߻&9zԳ=+ȅ52n, [HBz{ G6 ekX1*iR}yQA b*Wl BfX:㍧]\FK3l`+!J+( PR1@L-$с#&i,\R:k](HW(3Ɔr=2lWp@ByR@?B&eni5JZ/& ,oPj(N$};zڿL)KlLb udOjR_ JB\>kd/ Ǽ (Xȑc6lFRƩǖܘ7 BN[ުfR”X͘!@q O`wurVg~~9NmΉ~WoBϹ0  @!  H!^_JIV0*W2Tb dٵYy n\t*Bh@#Rњb%<٬V"* ؤ)<ت'dY$[v'm9]*Kmx3В@ǭ'd$45ki<8߲r/(ADU[@]ju`$,"즵^:6ָnf[PPWL@(+8qZɞ;/*/ٔQ5θ(GZt|熽Yw5>ݩC”dsdv],ړ3>YfCv5zldn-2:qcc>Zj J ᐗZhd(x6S" 3F`6iS&D R汔a#XJyi$Ze*v18Kѡ&BH"C s.B@  MӲ2['A)Z9=Q{n{ղWUe7"v€\‚˰Ͻ4٧BKpee1K4(++ܒ Mq;S+)Cq;F5sDki( POB[#4V.xbU Eszx5Q&cR? 47\t2&-5'1p4JؓWA% q$Ji2BFėyW7zZH.9%lPNKi.kTAN,-"+ݯ#0 ]%)Jۋ*գ%/Қs%vב^Vg='OsxײLZtF3PP9Z%IȢ.ldr-,a&BE@ _`"(!KXo1Zz%i=Jc ?X> 7vgdvk ̴ݰ)^d VfaJ򸖍%\#$ҾY{D(zR 4rU0;\Ś(ޤiˬC?S꡺b3WRUy_O /g=\̻Hu۳'*+Qij#wueC%(;,6182[cn6I4,3!}Q~D!D At>X!]I= VԳo.#-(^PiߋJ&f6*ѤĨEza !:DvN8Jg$UUs9! Ȣy,T)j9) h-"`e'cˠ!E"+زE(֭9:`KBmƣG!*zV1Ѫr!JzQ;&c"R:+y\aډSL5"V+F c~eWhhh[EqSԡkW3"`I!'lM:w%'xY~&Zu)Cn4St>DB2 2W<%}B @@RWadvsFzF5]p7u5k:!LF(7:H+B7_8&ۅFҼ!V$ZyKVIk/ʵ1p<|D!ǁH&msts-mG*+]5Xǣ!WRrcԌ`15?}]kX>ʉD?XSو.5)JPW^@\3fυɚnbMq}<}0 y)zRxY+%E)ZX5,7`Q߶˯>ekLX4wv RەͲuv&)JVP o~M3B̮0sIkv6N6ˎ@xvfM-q[$7bJGH$5*>i^Il\2Ñ# K<:D2j,Ά^(}.UI݊鵠qCYaXfJ]6VBrFݰҽn" Kz gB2:: VrlMW|!XE%A*.4ChRe[vT,S47*M:ФRuv7 w#6P$ *7% NhiEO+FLܱӛ|\!Z-.,nc)̇#ZH*̀TRZgT;#ΤOB/ЊJVN185ު -+v*l 䜉 #I]'⣑ُ:e pr0"ɀ3_n`eƬݢխE4?Ŀ13VkKg37⌔5ح X=5acTR6Rմ\m܏I(JɕqB"o{;ć2@D:%ؑ JVWKkQdR$D~LLۗNJ˧4vNrVd^"ܷNlOUX]Fb((ָMT.=ЭE,XAM;wR7K…wT7`)J{]2oc*aMWMQҗ!VRP J`$ aX+q*~'kpwHCX>$s }-@> ~Js:$ 1 {Fq:<}/HN8{A= ߥ49},w$qOgt$'ĐR|weOV N/9w~^nt=}tIо\fm9>F;IS;O$^~Cwe[{Q&swWW.I ?Wﾝ]۶!oo˱9^M#b6) m@0f@qp$TBC@@AXd FQCz/C!NGB;v|66pل;xHg@>נPcq: 0q¾Ï( PP <b`α 9@N;Hjb'`OI5|]Y ۳ CI lHl'6vԴY=N^°f̆fo32`I }$<ou@Id f!v6:I!> }t0;-C@bD~c@$ r = !$fH $$NB{BBI;vYIJda .`Ia q $$tL0!9HN$ϝRC $=N4Y?$ c! oIJ$BI.BI 4$,N"!:H'f!@ HI)w}~*H$LOa =I Sg Y$?Sw6'd!ݲ7l$$$<7^IW{@$h$'wP]ƕ=jɇ.:t^_Fo9"#$I6s]$0$ɞ`H=g'|`(O,$J n`o/x7/M)0;Θ_j '&yW?R׫VYR@QR;{_̤ޒg9A,1ZՕ@eB90W `]G #&e)a3A Q'  ls)TlɄl}3]ꫛ&ژ@ҲӽݼCMK*p8G_ ʨfہb*߼VѢ"!>p=4iۜC èc͋wş2F7n3P$᷷ n|U68c=^ݚ0A(zH ^V,0,[9ԲE.s$M#rY2x61"Qjy'\GJUM+9kPRiegn|ِ8-((ßB'17HU/bؔݦQuv@=bDXܱu&UnMM٤}{ J~ gs rs 40^;;ZВf sWU26FNpc7vv\XMtsҗWk<='ٲmk ' '/ț1rg0C'dmejW0?KD04ǒhe2k#Ì aӗmwv&. 坞[Z"Ʌzp5l%F%@ yM5/i}sa n ě."sϑs'{~F'qCv Oї'&et1sǡ8 ѳav9;zc/&m(U[:3I_Vs&><թ/ Xb>DkNըNfSȟ}{9}k*;^>̓"}UdnTn<)»4adKf7{S:/"[vc~* RmYp>Pg:YKt3.wMzѩ؇:ut$qsojpn|sAq6}4Sui0ȓ.(tO.ϛ0}sofݘU^w5:k5CW!䇋{US5m]bke\P^_$귥lWn7n"ݖGV~#L4er: ;'َn*WTaԝcȏ+M59g7`՝ty]ܚv*h;%9ۺ>t' Mixb7jG/WHZ5*PF0;` g&!"kILɰ纼!*,ݟPAFlF0yڻ5_ijl1^l~GbB읎؀|26s#6D5Hmuqi bU` Nguf{W]1R6@c7 Zp=8x8]E@@V' ^ yؾ Z0>śΝqKv W^p{+ sh?#y޼O]`i˂ kְ Mw=M@s9կןdH|JG`y!j$\cǿ]Ր/J^~Φ74An^=1$0<{{:w?Q p"K1ܘL іKKYet@zlUnJ7.{ܶ d#ȴJ`葽{̸Njvj{묯u@+ Ob`K:6BmljB勑z\ŠW:KV) pA7k:2P ɍ͹bAD:,I, ʇ:εnKYˣuv8 lυ UV01 2 ,]i̫uWߵrH(1tSQ#)Ӡ3_| g\|-֕hl8@^\E* 4!@44l6[ Z| s]pwnPY*.]TЭ-g=r8{=~nR0l۰-KE$FbӼj۫_6@moh{rFH0)H6ų)V6lf]f4wW$Җ"N4/Ea 8s6m, b2*BNXǒ[jfd3Zs:{H3 hII@\r .VLn wYIe]ñ37͆jԭC0by9yBs?L&yPJ TJUJBrm99HNKl2@⢣*o}7˵x9!M;Zw]{vMLQH!`.> @2p_{0$,VT!])+b50y`1ԗcBN.OG84 UZp*u bL ZEidQŢ2lg@ &SB}S5rΙz2/Ij%u)RЫ"~l+PWC3n;q]nٗ JSoM:]7dH7,x*k$Z }@BfnV(1pȒH!7$]A˯fX80c.e=PN7lL`рf&GjZWN\~cpA*8Z' HF6zX[ZHcԛ%0 ʩqٮE̫x%jyudK )Zz ԣvӕeϋN~i櫭0/~kǃ(셈.w5a\aǿ&Ռ2K8Zf۫l X Wd![u !35t]ݽKoc`fXmbmR"ϑږ5ZA|jjan< \%rz Ir$\FƋ%Z6)1S{K b:E)uhV0dtA\w:wb> #лge,( C J\k%z/ i Wn$@{Tpũ==/=Ͷވ*w%5%zs:zJ 88[*옱3$Xܚٻ9TB&ZNJ{B}xM( "{;Å`җ%q#LmGURǞm5(+!oj>ںՍ[>W]ھMZʾ芷y5=ɝ@*t_ TBX>^lˤo9D)F,J6~6}$1saq! .D0 `!2^9kU4 z2,'˯x@hr]yI&ܝl-@;ic V`#r H6W_vsA p4 T6dyH}_d,Bm穭wL ݰ ?ڼ?۲OC;-;|7v4pmŞ㨵=oxw9]3%Vݱƶw]+k$t$id1(4sXerM,R7JK2k<@og$#4W=.Z~bXLl h<#R(/,L CJ2cԫ|$-m!n1=R ;9- H{m!8\:Mf?K׷nܟ#ѳWnKZ-g‰j1_AFcR"#7"v;t1?ף>Zz7=?u79&鴓];o{KzNlj79 a*KUj֪| BHwHHI$ F \@$ zHyd!$O$!$hI OʥD7$ѣhDZjlkU~%Zڶ8bI k I$7! 0t<Ή!'I$ t{5  (2B@bI? P H@yV!$P'HP$I@' !@$!H,$z7=|Ot??.K_)yDO1ad\6u_?7l@(Ada22CHN*zD~Ճa'|*$̇`OC!>[! N$O}'RtOX|HBIL"JnOWXqzwѼ=} 9;:gٮ?a&&'E#ʹ8̍Jב{SdXB= )HA`Y 9Z,>Wu Hu,<+bOïAd^'/M¤NQ6CbOi^֫fP$XG!.d BS!( Hf%Rڵ-cUƠ@$$$ dҘRH2-B 0@$r%0@Xj sjīsUcH$9!2I@쇟q v Bea@SzlBI* ,$)B$HSՄ &&Hy>Τ,ńܛ:$E I/Jm}IB}C:@:Ƞ& i䴟V zo7i tCQi| @V[m HO宅%I!u(y?лoTN$2}_A̡3 3Gqo}i&m X! @/ͯ~N>ɱ첤!1.0@']&&AĴ51NR}1 |/(9j@$-To#n(yxZت'ft*?o![Xי{)N^%c_(v@ZTlԗQ5 >Xi3Dȥ @I2{˹(j^gŒ!p^D On} 1OfI3X&1 ye.<6h]T e:O0A2X O3s_Xϓ]XjNW/5جz<Ƣ٢d@!C5t>GvT=prLGlSB 0F뽗MbYNE,uT[L=iDygk~䡽UG܊袑 4%gcBwǧ]\p=}Z8<V +6 ^B}^:"n[Iw aǖ P֯bW_'J[5;ۭUmV9WӃLIAw f¢|JWa.ipJΡnk@ jBvp8ѫntNN:,#dUR,;*Fl$?zCwYʼnX&Pݦnoet{L\&q-4dB+][FN/Ox/`fׂKE`%HF%Gfr0AH-:Y@1_V +̱#a_) yג@|DٳH Lv坡K)4 'e1kQ ^P$k2\1AEѤPdm.S@ @8b:]7Hηս:6!P%!m4 r!' +FV3tޑrnmsutL@ 0'3f!vJ"ܠlâ@ }:4&Q>B/P!ن{p"elz6 @«O[# B BSz2` eLs1hLaQo] ӒD!s7;>3cYQ#isuDW_O`#S號_ ŋ P)4iLvOsJ@:WMbI  =ɣ?)V;9nfRsoi&w.{AϗwmWkVetNۂl|eݽ`]6&Q$" ?uD]8zϿ{K;a_y6ƫ`,b$$$HNGO*pB@ 쇛HCBIs(@:'YO]q'A:$|\|kBku5۟ X&Xg03JTy?b~MCTBYaT<ڪ *{NlMnZ'>-5򩄎Az uN L c̿xpfiìءٻ+m՚\WAMIrQMWP>{ьn=h)Ha ՠd;jͣD[\@DmxrcQϩVO=C\qt6Oh]ilKj-uK:$0Ej y q"<óz,2eC!ytXRN]963t:K d7!]4QT@=F|d _szՖuhZLߑ6/LͷCg;'״ۣߴ8 eMV5T 7'`O+fjBCA#M< @6IOǁ_ |?qn֖m&G̣\]}6*J@j;pKizI$da\ k'Xxyk_s:ݾ}0@E 'ۛ8NeI2Cp77qR"o|WBͦ{_rqɣ\s]3! 1z2ER3F66AIψsIYM6~V0X1;\bKd 1NWN }&cs$kЮ& ^vBUnJj#L"/;9ݤ<=VrFLҼDN A!}v7,cXE20pF9^$Dl=אvn8̙ớdU(ÇRC5t̉ T-VY ,]F͓s.{N޷HiU@S&{z?ui!Cpn$;}z vJې(OSgj1x 3m!OHrt[m`v.ڤ˸UNi^1ؐ(V?3` ؆ٽ84Nc5>VpCS/Yusm@Bn9t%Ȝ㣿Qzaʼn6喗#svy'͵ʍM{%f HR@gVpxTuRuY]gڔceSe_EkyqM;%rQIv$}A̬4!Ziq@lͅ*JN{[V'rF hBtqf5Ocy3w]*Qx.²Z\g&8 mB1iFċ1B r2ͩ.=gLhB  fC+b042)P,Wc* bZ0z$./OC$xKLŖA0 j7Вzlر!z[±2l&eAV*B+,NPsNNCi9V͐$4 \.`N3( [=$KdǟSdJ[6@dx co(γI^@bQ d#**H!Ж1Iix_MaJVTI4[ gşFmyyo&4 BY BTf>l^wC=GAug`8|߽flOlUnu4= %mhp9N >$zyx?VH$v/ܲCgͩ,P%UH@h @gaPa!2.=mu,0C.{@Csű5ކÏ.[6>3{!H  ըڨ'xcAF@D6ZJח_1b )dLrb_#aʰ4.0C H+vIB&!_WY ?aRPVN6J8YC Ċ@ (Y/6mƮofnZs[mrQEY,J%_EjQQڥ &iiCeBI@lWK`Z.1(#5#|>N!0\+ D{#Gԋ6[7#Y7oe],[uIW}EKP2on[c{sYy[V bAhYT4ٸ{O|ڒ`%B%X7i6DK ^,:jRɻy]16us(|0ɇfVg/IG-!l>Z $fRc>zt~gkĢ@죓90AJ3lb`5d*dyyVU-̠"J{VƏk_uU~w>-9^VB$UY6Y(1 .:݌H 0y.?qG vPZؠq+j T`).Ǯ` bb+s-}ִ].Uֲ ֮( xץt`7%ηz,j7:cG=Cb޿ߘ{b]=]1qyN %c8as+xÈdfLz]v.AADAGqɾ\ȩyx2+% Tɍ)I֚Br#[YPn4vJD A,u;%4LQbbϣ5tUc *}I@25zHRB*ъ ydLt+7t,@J (+1~`<N7Xr?ߚRv8U:[L~7XRXխlj@P4㼽/E4hվֵknkmV5m[~[茋PQuXj֪Ƶ5EhoƫUj,(AIe0ACUvq-Wʕ]߽7#O}~ހ4O jn~ow E7\$r:Ltf:ո=01oDug:="!tu6nΣ2mpn@ @4,jC$:kK#W()8\$`ƜadII_{/dSw[E>o?=/k{PY@ۦ A4SPc,DE]'=ys:~ݳYИ P}flC|wYRIs1~+ѭs^}t]1+7yF3g{Rߟ+ Iŧt?^J鎮-Z(fb~[S*8 a%>s208Ab4?S_, 6m57 +dIBt-%ӏK\SiڿR=.zI8U#Tʨ?qw'\SȦs#eoρO74ddV@d/aMI Y5tkM.[$sHۡy .Jdγw4TH2Ds/ƺ#( l*\.+y>@݁%UhyH8TH>e@ΩF)M1a.`CWe ct|KriIn_yPġNOYSI2RףL@Fj¿EI \, ޥƀ8oבɺ51Qeyy-Hl\&鹑:qcNj^pu+TZb/ĈGJkBdb6.Lԟ }Fœajl2h#y"Hhs G"2JQ B8)W$k[r_?椝UhbfSb5ÍB$.qi"J-9.[l}Hl}J05"Ŭ9'D{䕑- ޲md5j\Eq&;Vi9s]Y%"{qčlOxVF,$eλ8sSم(EQؖ\ؖ:;-WZF@&ùpi 4 -h&_G#u>dF˒h1V@JW(ti- gRX8 >bhӉvT! MRH5 T$V@$/Kkx]GQ|.G-RW:b s͒L;&!TƳnCkJJsDi׳ſpAOB'I 'EqŎ<믣 /6V!aZn?}ZuipvhDܼVM x+uNst98t 09:i38/GsL>gᒹu8֬}_hؒv9m;'-D23쨄f&=<ˤ=]1^7 ð=_9+) 4KZk_>3WdD 0ˋmXo S;vyyi^@; w2y1"FK)B0_>-k'u$wwwQ$fcTMUِ1(AYc-^O'81PC|xcLD!V9VR: rՅs1 LV*+̏ji!ך\#ŽcaTC=&1d< I.D:v-cfeHk_K)7rs7{!x$P0)*@oWSz# ?eBqUzR0*f! y0 5MtNVt vFا_,3eϝвMlH*7 <P>έ}>2PPBP@/m"+DպEkn^\@n=%ᄮ+Ӿq"7b{ ׶R\)xfBċD6{V|G w|KK]}X|9yjX۲140BR̈́Ew HN->:Leߊy7׎a_ǮءQ \w[#i74zɗ.?貌xދj7*.#[̺=q]9W8(CjpIظ7=ӎѻlX0P~JuT,eIH>`hA<_y?khiq,dPݥ(-cO9&wszoQteEMSJPS)4(F9s}vy76r"6րuBBS$k{=]=V~~|1$ )!)\<:4k&[coh|•osŔy~ OOw\j5aȐ:A7@:e҉kho) pdB.s H#۳:* 䝋D9՚1-Lx%dD(AF"l?nhn#hdO㉮z~]pܯ MkT ,U#T.ZC- ըULp&mdռ,wiOYeFT魰 00]^`h):Xa::3PYq@Nv`[&Wˀw 9LdLd((>I >)՚CaX+`gQ 7DW u:gH&(]>Ǩf-t]mWL8N>ѿ~jriNVSw+8b5h JPP2$=CՊ^J @,$6?bdhIWrgb"ד"̨V*e@j|'^Z@1XBlcshAC+c]ܕ0޸7=7ԻtHRяA,L0в6"SJjk^]{L7*mqm](O Rj VvD|K6Mh{d;w?}whر>G¼C76rl-`BJF֢mӃ @FVx[bM61y]G `I\ϰrW5 O/P4dr5e٭H"? 1 `Qf|&6%S *dIZV1N H&+X &%h$;0&rThALL9dfljF6~gU/F]%tm43 ʧum{[edF1 vvؾSgkmyR$3N9,'CZcy9ѽZqj4ntr>؋:X*)VѼV;FZ[4C\SuڲŸSqw'Ѧr5q!)OWD+{6I$>sƇ1$}/kσke|G? Ϳ۩&uxHb^C!>@K="B@nϦ:M sk4 mxoP0IY}B)xNAxyD8vS[ y?("S;iYEq x`5}77o RNxwOļ#EcnZf]/S+C9#/֦51Qѧ6m-/&"BC,0]/{]}x[*EHeA\N]bX\ٱ I ܻA@l:Ѥ7e$"ձ~8p=]\ݥPt !Bpz~eMKk +B"f ނ\;P-5yo].QZ۲XF  #5# elwwOV?_H/|)Z];1Md&Ny}ާɷ(o'vޮ*!v:k\ Y]+s3ҏ\esL~:bY4KS_ͪ¶ yoIsԹq@cntM%əVhiUmgSv߁oޓga)) %!dجߗuؑ)@ a@=f &LW][$W`m68Aa TkfF9){ $i0"{k/O$횦d1܍OI ?ʎ<|Sި#'.oCRO.|Һ7k]D:>6\AUB stu%Vp}dia_UN1qk|ߘooM9]`c$UM]vz_w-w vĺ<LI%Hs 2A/GIY;s$xcH5^:[=ƒekmP?ɷ| AH({/ CaCj{ߗU%Urp;zq-?{qjGd-&_E R HbI }lXlA^c*\֊ MLJT SG !W.C]$Рk0(>" 00F12_qQ%We!J:Ju\ͳ>;s{I$+'I ąW-ם5!d'&Sft}=|-l[l7{OOfᝇ '' Nv 'HAfuv_R]H줷e|OvO?M^ǑOڸVѻa r1D ??Ʀ"ź8U5WHV:|}WLXm&Fj6]'Ia3B@%'%.@b+"Sn\p)X&xB-Y@~aY!./IIߔTT" F5FHPƅqOwW?]2e_fhř$7ܭnQf>Z~-ϣtd,s1[~ѽp!Xo|UR.۵oi&R6@=ˍ髓õ{Wu 0x}vW];oE:-)2ꮜ18}S}&K!h\ȩ-clL#""QEF&{ǴI{zcTX @Uhh($F"U@6d7ǩ{n=ǔ!l&ȁTHI8?dc4P@۔*յwXW)-d0F Ql61hZ6hQQAI*-<6Z,{?Sn\O5HB`$,vv@۵M+CڤR󨜦JH66%0CP9cß;.V6h|nq}-ĉU[XSWOg>5~GҐh9x)*EFw0#ٛ{zrDƒEvI0S^_"pG0v4l V%WgFnqLecp0"mÿ|@ `@FUnAS0?#@%rBy><|t {EYj:P^D)[((L{O@񜯕ü%+lGWM((6PX39\\Xgr_ՃkW- [bmC6<)\/ܭQT9cA  PS~6JS2ZԘ)J BW\O34.lgfk@ F6z l\UJw‚ug Ʋ(wմ ̴4Q- "?:W uBeA`7h<`qzm8UStš֋2%a>Ug~<>dp?ֿ߹9ۘqhҲK1B֦L8)rh}֊qj$~BI~p0^sC^F8+[>g濉NOJ|~'S_+Q@,oU63K5`UZl`/yCcъ -. jCǪ5џX dFLi.d 7lhڼP\.!f,5.4g9M7FXp=ʯgEy?Zo]&?fcx7#UQ$%5%撩$#)!2vʣm^52xoszOO۰ HTbYlbmm 1&1lP[R7{=icK2E A{mchhJR$bVTaX"kVcXhFe*IsִF(-0snE-Fcjke@ ,o(>Vy[~[ok"_uWiT BIH,6 Չ@o*Ѫ#oߝt{='eSD=PSt_~^`q]B!$i6@ϏW'|cioz?`1UXR ״q./WDXTw&C\y Z[MspsF ˙;zz*VJxZ JsW&=>oHJ?ӲȾ_Va'p&j*Rjiط}9JZ ~Zn3:#AB~Sޓ7rbn|3.kjM6Br=Q{2/t>b_v嵟G͗d}&nB>#."qZR߂T%\()Mo'_bl?d7 qDU/ޗM>pWTP,cTT,גE!sH`O!^W&Oʡa [ JͱGqώcqID}7"cBTf&\IU҇P6Ufh~9|Z\TIQbJs}bVIur`LQ5Di8 A3NA35;%$kpc r^E D! C=OEb螺 |`u#1Üo򾭻X]]z&1)8E\C {lW&;9֘i rꯂGV-κy ZW UpEIZA AIF5ƆN$nЅ"+8@I"q&rP)Clj HF@Vr*C+R0Zn-ZT~OhKI/upf a ڲMYHlƂ:ՂUb<2؟\6NQ.a̼K檩e~0du>Y*lW ʛLȠ}#h[f칗~:Ahܟ?^/cT<8@ӕ 6Qg@NpV !AM]ӨvgEH03)5xx:Ƥ? 8~ Bcd q:eRq^$.:F**U&q@f!ř! NQ7(t@筘 [ʅG}(%Rz"MϟZ\ɋ߲hfsj.xТ R}x,B`Q$->hUXGZC:{ Kҭ2hV瘍B 6༶j9L3m)#i*"P > L1ܦ'Yb`r6"#>*RY}%AQf;5 GɆUy!Sa۹*PBbn;D0MEDV,m2 1j⮏/{oqTaf9Dj[&5,oRQ:2Os*pFBRBqtwo#!t,)h-,#'4INʛP@BO:6}"|ltڹbz)%ʚNc]-[q,KuDlS`%Sr+Hض `:+.Q[ݲ y[ӄ&@IderQ*W`H{YX4_7izn0_,JZ2 øWB0ԃz՘9D2r av~F|:PTFE3[h!ϱF.t]l?Yd&Ѻ5Oy~-2:=8U$5gO~6 !1 ~[Mq= ONѢ€̻ݶx"JMĵ37!XTT9]_!cPƿN YemF^P ӒR(j!G?u^)pԐyc*8/H( $ZN07ڪ8BnX]"5ǁnp^ SyOU`z$=t㯍9+TZb_㗝w1߳ 7؟^^:_n*Mt,2T?E= \ χ:8@'&_哩Өӌ.N!5+(Clx Q*Y¿Gp]ZTW j,-c$a/<*#( J2\\[!: }8m996ʕSho!]cGOm]5O&Y 8d-,+X2_tw0@sXk.͙BwQ^Ywޫʩ#Ju0/1lE;kP>hj䱴ү oܑλ fYޓ*]T)_>ʓp~[Ϯ"I6 ӳ1{GC[ۘ3p||Sm)vŦ/~E[ޫOH` ٴXHO+E?*x:#hBv !Ҳ"eͣ0`iP;0=G^İ}`0#SX_aOtI/_$Q0ɝR6Df4OΡ`j$q<)^'9~As%uªd-87R&`9|D:6V((B(9:[1B,]s}7G tKP˷oWz Rm>?{PPuxtpLg"+j7le?nQdߪaNgX+w_]s鵒Vf{Ҳ7g+NPc\Q},X3/Y׾6ߗxHzGE h4ASv&necipX8F 5ˇ9@MLnRS0v`}̽'/RETWU0{Nm \I%4zKsJ}ĩ p3\kGeyuH,uaoqfDDyE7F9喏5:܃ldbzvBN?m-6usyj~QkDI =6F B[ Ŗp]/Pgy'1l?Gz,imEMM"z$}[XAbfYfv$4T' /+eb7wHtl_*3%9vcτ`44pF~H o*j Z5G5c}OgXKGĸ$NYTRd;,21(5@ZdରZ %j=2,(Kb%2,lf4R3}jF>'Q邛} fseT8}A3lzjSXS~z`262kZojFaJ:h("~3lju3pgrse_Y!LNlVf]5KX#HZsiu"ols ,K# |ƺ8>g.̕wN 6)j}F/6E̜fQdF3UpU.y'-xkIӸ4Xu3b֭ >aئ/.(WY吏ޤ"sTm.{,Nh$Rk 9P N\.` /(Q?kYqt6D6Pe_ ~V>"n1F&-+C*|b`-E%臗pqӴa587>#F!+z^VpճI8Agg"تT?$޸JA*F>-,iKy޽Y/ #EEqI/Uh"?!k=Uq ^3w,v)".ɫ*֘%u"q'(}$ab󶈻{}ըqBioYgdvņm"$pM"Fܗs Yw@لf?bOgJ{H7vf7;6yX.)H.Gx\7Xx$ rȺ ,s:0y}6%f}q|&A&{]׭nʏw@ȃڦУE-.e:~WT wf5m^$~"ߜr=b:CT͟a5^ k2BL>%S +hC"xvK&3fs_}c "{Ba6pG5l]4i\ytZxz%!r'g$^xSw[?X 'qDK[(1,j~ZK[SʬB.PPI /Pގx⒚h5AeUY?G|}&lXunu%iDŽp$_UeuKP!KoB!:Ԇ-|,Y|I3 ׮JWd 0Pm?eۇӵ]M-Z}s SmQϝCs` IG^Vj֡g'+x $[rȓ/GP9VOT6/n7DKȩ巤FeōyQ(Fnhr^(0g[;.[m%b>iaHġkP8xNAoԗg-Xqvw;edADx|C58?F3Jp킯F6\$cil0d8TS jɆHA)ByR]\b(Yw 6)USo;lgg:[Ut-8nQ9#vCǣ~f>׺(']Sqט wiRlj:k\SSYj`IPkg,g MXpRݕ嗘E>#| rn1%QSh] X0*upSrgm/$FdjђTE9jH'46oV//cKZ۰+Az4viI*T~?6D@ *%WLF-+.|bX̏=ގط.uдGnһs۾}!'vD+lm t}c.=pp6ݳjy\@<(~"xO+h\*J *NAelMqZ7`)9߾$0'kG Zb]'=bGe\ofU„=5, ,l܋cֹ~e`%,# v]ĦRo:xשp5jUYp`K 4B6-ݛ2 ؏Ămw@fkiZ,3zhzb&vT>ZdNlw-B Fyf+WL}}wYX^smkpuǤ끝IʀLDq<.]jK>G:|l1"x 穇apUǍ p^ qS.#{n7Ԕ13#,w(svgo*{fS3:;0~Qt-Ƙb@(v+m-9+`م'Dlȏh"6Ȕ݀p0ѩ[ݔXc1Gex$5Z0;~ YNBz.A#s$O2 Otv#B ughHvLb?D]9j7-Y pcH){4vSLC1m=ä*^G_C"o/ǸHd8$: n0'ս m8=1< ԍ)%T&[bk6q/lK.~QP>x8Qg⮐V $(e9n!cCsx)ІDSM= T&Id8 spEp`{HsuޅG拝#paZ6! u984RCZV/m(sf8,d@pb&/3bQ2Iܓ!נǀp#{"w T42ͦ'uYl>1R*ns˥+NKg%j0۬z9" 5G- Er͸٘aFd}V&aBI`PA, =huI3!.2]€ENڐb(q1H OO݄/W72JVu֓ʲgS KԗUyH~Y1UP`̈>AM&58#[΀L^۵X4[ܗC$TAgV>A@Pun"lPgDT8v( =X(Kh|wH](wnd9 KMdMvثK$Sl!O Ӭ"j9l+IOlIW̹i[.^JWGB~Juj6҂ %'aW!P9@ĝq 3Ti@tdLkqL]_q['[BeKitrի;mU+H9q|VDZDI}q5;7ȵ8Jq;1r89;"!AFicjLwZvj"0i&ѽ%ud "*d@sU:k\y4:}MkjME+VF7!tee t_ *8JlZbjp)ѝ̜U^J\An%HʢxڢB=ŏʥɐFGLӻM-c#Ւkk1#ҧ$mV3x窔: UHEd].U>y0|©((LE)[եl)Z +,Nc^pҤB==; פ1 \)sHG-,=ޥ>P0PcN *=ZxU@(==L3ƶTj; Iߧ^~׸2A~b`qQf%AU4pϯIT&Vn5LCԣipc\bV`y8yFXߔQlW7: nj?cQ?o~B撅[o&kDMN'ɞlm}%_?fnk2.L9WX9b5~ns"hbѷѺ;)}]*QuZ2^hA׈ ٨X$7՘9(> t ("uK@w@ؤ25k},, ;LÏGwc,&)tZ \pο-W23DTل%R}M^ݘ0kl؏!b4yW:'%jJ[]\9c6W~/JۑъgFfBbǴAVR}BKIKbKUP1NQV:6#ijJ4uԲ qmTgPoaL{lp64% B"MPa{P0 /C2Y|O? H6?=i.%iZx&돮Gklz8/n `N,g}/]0WYd F+*@Apɇe&IOOOq_޲MB/Z^,pn]=#+U2:F3?;&tԫJ11vw$ j,/5ďy1:rAMFM:$Zdoˮvk״S:DKǾJ5k_#/q}~&{L13wh8 R "y)D`p&\rEWD+Kx ގw[P~ -vhwixu/5}@XDdI2~ t],T?̘Y&k>A$|J5K!I%♃sٴcB~#{Q-eE4+侓vOVZdi5x>)8M94bS,_&B~maGD,acLI;MEPˤ$]EcąSMMPʈ5 i?]a4c"Ky"ZJt9B7/}-*J\wzF2jV@B ;xdgIDz:se"d{7{ @+㢡16W8/ l+*pF+# #i^?? bI-Wn>s^k Qr^=եC"xn|nT{ qtr6Á0BufŻi*ˆVsmFN^eijԪ$+_;{DΛ|4=RϾPƜa9JD{+hLRRWvd{˦S5 r{tH1?͖bzienHbLȈ+n8a׆Wao{$PDݙULߤhR%#ö$`iD0qZu+͑YNGԎ\4vcCI6AsF捑e 1)}NJ0{ꚮ2ӁJ|s"jNW z檲 D#K.ɪl0aQ?pEg*qKf&h䡸;2WA& '3d&$lr熬7 L 9;U#΋pu s+Ԧp5t$f?v<jI<<}?!M.uCB A֨DrN1$Kx?gE#xrsc~ ޑ},\:lV[3w4 C쥹^'Хi&Na`RޅZ%cf ~jr\HXTmzP4 ֛+MH$Bq1d 2r98}E)6X0M`U;Yٛ %nMr:I2M!9M.6x'TXOQ3̱s72j%)UHlPԔOƕYMvs4 w߀י zX1,`F;<JZ6 N O6 ߓLۜtZ&^O bր^XU=5'n?UD)q 䩊_@6J5K_+!qzx?&l%#MO9k8M|t{f/aSm!vo ]!'Ʌ,½OJtJ$eAك8bvέ t 3ÏP}c_"ZrY˼"YBEYU( aHqJߎA)I ʄk+`# 3! PkQJ(=4^0>zB ʄT~%{!$U(1@z?g$BzQ7!B ݍ}Itz DNA@asm%dj(IVp-Z dg `x6{jF5IR(`Eɺ3iG%͵ A[v_,%1\~xWc*TՎ:lD`kn=Ӵe cJW]oPߠ7yU'Qk/E 4ךMcE]Gx}6hWst$X޲l[d?_S FTs IuLσ?TEIL=f¿IhnvKr3,^ 'XLp koXd쉏 E L)ǥ7[nOSӈ6Ɏ]sjEYy?l㜍hKBۭ7,r>0a)磄[U3n  Xғm٥$;S:f} Ing=Y4Um1JW=_ AD :ܿ!dttha,Ēo|B/1m-~Kp ^栞3*dCj9~b" 3',lM+ءz5כ l(+P-.8wޠLo7 D,=^OԜ!MoQߐ{J%0qmCqiҧzU0RƮvcC$dxcyj:@)fUKf9XbB͊QU#,'bzh3guRĥFN?X:UHNyS޹'FE>^m:?t ~InK×Ř^X eZAF4+I.8%ZGx-fg)NCjU 4]!G`zovl=߾ތ53/Bᧈ*4jc!}եPEd^ WY%4a1v<-[jrf\+d4Bm}i/)m~$Zj1O).8tAA|‘3Z᷒Dl!yk0SQq+Rg/4!0.kñDU@8[$?][V뭑ċ]&55bu[f#ݓORQ ] UYizݪ&|lTV׬z&^7ns)"`yez'=|{\$s':ĖM~#J^˄FyEћx_{#!_Kgj _ 13w.c>Ԭ RA} HϱgVmxʵIwzkpCǵQ VN1L-';G_|.sUp0ET<񷶵N,bH7~e 8aaX tl3lIR0uC§Ioi'6B{Svƙo_iy5{9 񶸌k0v} Ѯ` ;|G#6&m"]h\DYD:xU]Ӑ2 }o8,QrH caROz+C]V $ U0oK4ogw~ξC`P%ik}]Ff 3p~C~$G/ދ6X$Z)K(^Xf~Νh[Erih4V;ܐ$ɝVook eyRc{ Vu`^iz$5U@Z-OH`a#5j:/̞$=j> *5pl@snf떚Q/Z|S0@kH<~G_VX.=!4 FVb9çZyZyhYCo濭 =3#$ 2T̀f {#/k_$ߟxx;&{F22KV]-$Gd?8ElƲUZWGܭ^_q~30l{ݢ`G'XCk8y#]2 #-jC3Wغmro, ET!a1' ^(b XӒpn i˗Ն0 %)ş[JF;VC/M:Jn$V짮]IL|9Y:xHκqQ-x@n_D<U?r|;xSo`-ih{Y~sZ[j F//P*ieWӤ 'E\ # bn8ͳv)Q_C57`%ffAC1"ǒfԤ8'lu&IP)^˨k,O4cnaj|#,MVocYAh9jGy[jB C1QQw% N:2<{;ѬO pA[B5eEܬIt j^9؈Ա3>\GdO]p3G ==${^%088})?M+ry!GA)\&bK@\ ~6YmM8$H}W%+r7;Ɯƙa5J* Z.XʓwKɀ1幬P~7@ SXmXUNw=`"166Dikd@K2nLY lѢwSLS?rӵ=jv|T֗tUPjOK￫Bc K-F'.L)$Z0]PRyz=|@g) vnDU-h/*vn]x:bY?C61^?Uٯ# Z=rQ]%5fm2ݍOT$U֣zBxz~9,%ev[,i9^oغ5{~^Bh=4nՅCo)lvQ==l&N1W##HfX|}{(_K4mmaԉ H2yule'AÐBZ9{$Lcs v%.!%1F`oYO\BWRim7}kLր`pՓb8Q QHTg^vqY~w[XcDuJ92CשR0[COր P$s)i(TbPHv GdA(R I8_Vogi[( Wh8s2 ~\1G&-*;t|%g"q,}RvkT&$#B\hW-/ 8Pt(L1_1 83kFLb2Я52\c-2[V2)\nX.`s Iq.\jN~R?#Too1P'o @PORM9%b 8#GQ[+F5.1 S//_RƕEec|wXHN"I&4ZSfW\XF|Rn%:bC۴4~,jԑ>7no%auzQx94zNogr;8aꭍşa<8ӯh:¡-wDíPjM_StI`k-ZvʼOl(u II8ۑ=&\`3'jnPKI3_r0>Ϧwex;83@qb6qFsryԼKAL_ rrHHq]׸/HP:pDbp C*f7&^wy֭EZ<5U'%_Ͷ\45/0k9,ퟒ>}qp5Fl6x z`wEjhsk%/~Q^)(L7W/i1=TC0׀rk%IaO[ؙ=g)I^TZe{HO ҘL0*NV.SI{w@m9""@OA\'#wLhY`DQvyc#Cw}MG[{{M|q v"e}yi$#wO7(BNHtOwiH{j.Д-JRmRxráȚ~$okk{Ak>\n^M{p|7JGE, #qh*S~Em,T!*k= C2 ȚjNX.mxnBܢe2J̯g^=qe)#Ijnq >Z2`nCZV[?rbqSܥ)[88g|NM,"|WeI£>ulrüqQL/eekҋ!F5<(b{:.,/ܘ;'q&?}}E c Rs]O3:BwwHE*[yvߨ LIdtF;aHBv(]b`=cp[jULB\hڭo%p hkO5t]|>Pu|lslt؆tX HZ'dCy-Z~:0[tBc\x堏11=Ű{Z_,DI17sL6!?&#^cwj% ^˨ux[l=G 7#7*aZu~!'հPP84uJҒw)iy|-6/`g.etS,G mHSDŽyӋV]uUYxz7ɋGa>,AuadF3rF#t݁0xZ;6TO-dlHLtPden=62^1{Tm*'%rֆb/fāB䱤fB@Q`v#ox,ܜi];l*œxrooe)ơNt. pUWjI/\=~ O)F1ƦI&EuDoUBȅ]-.roggy՘p/Zn9iVf)cKkN)v-yJ2tтqҚ0Z%Z-1 %vo7{љPC6(<ʡd°}4#V{m{oww,aDEUoL\?V 車:ro>=OoEVnk ڷ'5u2P˰=t̉aa@`fMyon!G?c.v ;A$o"X=AA.{%ꞃ&Iic 8TBLSj&& s`ZGv!u~.p澒x5j)_5?$z%[G036+PTuMGv MP?ka$)xLҢ 1w ՀL9qU,1v#[t7f)c K0qQSŪWS=8 ЦAIҩ޺] &arhlW-H؂Kt]G=_g`p\c sg#иaB+5ԏ72-aOa_'Wr.onjbSIޔh]7%h̷#"a/!B4?('R6;6NP+m(,֊x/0:, x'f8]#ܪ9FY&P;BoNb'TԤ5M[)R?I{ AQ(PmaNوw=MdF6&qFJKY›W6U9qC]d qzV£PM/xњ&s*^Nnsdvpzz% bj`fJ5AKFWwn@8b092ͺJSj_uE2-Q(AAq&^@c2afaeJHX(HBJ^M]"1bBgZG{}Q=q<(<#],:: V{(s_<(0:  '/gUQ>&h a -W;H4C-d?wcu?ʖ~&by˥V?CBN<,Yd+.#NnEȨf[} X%yw!'!3LؙX M?#c5ՃhXV'zn,lÈCbÑ.9Cq^V~jku`QBHY[} ;[id4h}eAAY4[H=&0k{kZ/IZKz<~,l؊\bp,tܯ]oKo[kPtF& {*6R9Ϫ7 pW|}N&Ւg~N~nR&-i鋦r[STUfM]dv it05O(oъee폠qh !fLԿg~(-#J0/cz՝ _$M&k7쮤h=m!hR7~pvHKv+{C}ՅOZ꾀kp7S&VXm؆1,S9s6^ EhC3[ЂE&&<3LZP`8#Sޗ' 7}+D,s+/Q$8%\kkzP TAăIZ :ԿYڈxAb~WO> l BPH7nOMY 2;/7$pJ2GKr#NtU{U_DtwE3h`9\QEM es>91v=W"q3غ sǴS%Jߘ"[Ƌ~[Ѐ$-~Hc?bT5sMg, TrԐ{ }IΧ="F\_ NҢx.Y?T77?_S2 'WջmUOXS2=8Q FyFN՗EU/,RTm-\5X_ GQ(7/!9Yǎ8vˎv^+3vnr.Jn,CFڝ6\{qdXokIpQ 0y}r̨Aإ_`Zu!Ǵ֧F?J~I]v԰OcX-f&ݜ@ttg)u͛F?ًh*{{sf"%1lRdCZoDOīRH׋E!KNiaa9MXʧWh<꘭ITFm-%kԚNn B5QyUV>Wn t |̏yk{%  @0ER:!V+6z TW\jԂ0l$=j +R)C52GVjW|yYmE ۃ,z)-$+`}\!&KlI愇݆ȡ* f 6@l.4ZmUzq%cmmMhmXWql3 G1  ϭ- ̒[1{ E$ {-XJhjY9meo-W8$$;; %n&o^y,2iX?}H䄩k6T! N?)߿x' D Lv9v-hrSEn%8zYd(ȣnLlb7S)GG;l G !"JA0fg)$)Dqg4HRfH3=7ӨGr6֧̓tcD2M^_F]1vVE+>16f,4feE:ftW|'uV]= thU?BP[s/<'ځ]b4'u}h kqJ@VM4"b 1]ڎvpvմL!JB6j+aXߪ[YLmOoIrn!w/ь[EVTER8Eb>J~moUL%00B)>Ty_`6_ryf:=ݗйUyZ)ӣt)j )8#p u0 %*mj4 J2f쑜&4X/}235?17ˀ#@0~amZ\-6 ɐѻ2gPr] ra,WǸ04~;ܞ[y3S1ŻY]m}4+gUeAdHW|qȡb^QT|~HG*sEG|l4ao[! @(<̑?_n+HPG8'?:}мF!6RѨ ܒO[P0#59"@rn5<3WEML9gXAbѮu{Yݢ5b7J q~4!/O3U"?w$%0cJ5; U1tAEęЕMQڙ>S_FkSCUݐ^VIC~!S,ڊC\ ?&4L~*BAp񲚥Tu+l%Q魷|7=qN 9 'GFiSX̞ +ܿWI>#ikrm:pvIXR(Aݱ_b3[;}mFM:X+Ƭ>Hڟ6r51HNiIG H#ܠ$DKOWYQEU̇Hm{g_k2=HEU%4_a0]dor s :[jlՙ?lSZT}ͦ_268.ɽ0ƹз8H%sc5([퀠ď[j7{!^UoVv0fq{\>CfN߇R'ZY接A=3Q뱺ޘoo=zf\z\wH?Ed\勋PeLF/?#&wޙA^N&ׄK\V AHC(tdfbĺ8ӧK}cf26v:>#*BY| Qh2*$7cc3/>^Ocϖ;H$ÆDF\?߉*/6.f=͵bIw8+5:©P2̺hc*|hv<ݺcTP'n 4DZYC/Hy,3&P pf4)Sa&M-9i{AKlf2priASy@զr.&|/.-!lg)OQw(@heO3z86`ӝAٹ1 q/":Hp'gؽ^ق߸n*Z]zݸXMITn`#ZlO<ˌJp.6KڰF6CBU?~\sԗ@R nnh~^YA6%3WBS87pZs$~8gk.q]( ~Lu%evNux_ xyf/H8GS,5keETGOF.8uY j;|~ZՆH>Sx6³+xCϩ<Wz6 ѯhh7Tk5^uw5&I(Ɉ[AW}b[OH"_Y4U n_whLjyњP:A |+^( 1yX܇f|߂ ",ѱ\,=M Ҝ |)ުg+4M_;ӕۍ10xOкٿ08~N@ ^ ۛ{猙x!ugS[sUdh/B0Z2/)0i#jζB,I 6Ȣ䢾#@A {X xjlJNJDOͧm%UnQXcE̫1Inu9ej^e, N%i7?CVHA@Z^7^{| CyQx.*WK޸yvIWl,G2yoa0U6| w`YKfuwy5`׬p;b' i=+8e3.p<AT7NPs[&/({8c'9h,j&ԇ(;qbxEcl\QUzˉ-$W!j4RXWlGd泺l&`͊?XBu·U q7d.u_5\½)XЏ"H4ΩE5䬹?-sT&[]VQK{@(!K_7mّ48KCx\4·[$((#F(6m7>auD;1*l75vi>ϐ@Q2NW]0*yŐCf!}pXr"3PcKMhlBf7 *`%@'V+6=[~n$w9a۾csOݛⲆ%f`8q ޜJ'?-=D͊,08su]cMlB: A;?P#TB1Z o".`& ^e s {=yDTvG]Vz-6~KSAM:9IU"s;<&9dItЯ^=w4YrgVPc;4yvȟvr'*':.)8,E !ݯIF>Ip&SB 70G-1P ;[~ư̍zZib@*88uV20Rrvl<'@B,=F-8o}jŪuLrRCˊ7{i[p 7WA:rѽ16*jq5%j ݋lLدAiI$ # [^k;Fo}4s{*UK .yx<'?%b2@3?(\hsK/y`dZ$$Wap*4nԄ,=bitbZ}7"L3z1a&^Jx"Aš\ꄝ]nz馎6!^s {F\OkqSRR`kw'O:=*2>a UvǸļAw)s鰍ɀGiʰ Ԯ}qmO4T$gDdΓG?2 _iB2 NXIfRd " >x&(#x8|V\ b .`^6ׂRL\`aQdrzd.0&h@AP<)a#AS/Gz`MannLlxhf@D.FӃ^^9dvBo]dʯzƟ Pu'LE xlv7$?]YƀN{h|ˡ16i@13B= ʁ"W_8:v]dqHDa"g{e dۛ jsp)[QtD ,n*,kSX)0F2zsULHNl4UX,+v^*#B`!O{T>3gx@6m}nYqpq,kµI$r@/ ,I[PPK~S7ÀTC;])VEHZP8m~HEBm3˶Aԯ00+.xYJYDA UWDMVVG\S䯆Sz])ډHb{:HZC 5X1A]p^ȁܹE;y\1\ s$В@1׺/X攴Ja< jI)~V~g *uAW&zsFw,#quNLkK9x$9^EU>#//xPl M\M jc6>x@bP-^Wr6IFHd-)Ex.mf:P8/%4" _mb[=$*{P? y#Ӯ"i⨪LlK[5PrKg>YL}bQ>샊{BAS0?}_ѤnG]v"<@uYq@m}bg;}G4XV3 d{ жZoSoH֚ϩzZfa3tU֨ēz{)֛,);$JBܶ!mv7vPrbBJx9"}bx$J*-o'c*Zfᐝ u4AUV6HUYCiEɓh8H7gVXbULjl]nU]g8Qz^jvE8a3,  Q;hpBs/LYs!57CAyjo@*vZaV -wGX|4`:mk!x1 4s$y3[qPMsgXH Uy!zO-8/ǡ4 6?+&]!EX<7qL2x^ڳ) 8(jt]_H\lQݞ10v&Md u{!칛JTn~ǟ^;]gk/CifZN^fD>WRTBP[]a2h 75=cw~K9[dAa_ eyrHxKm-Ͽ]Sj%Ǎ#M; E%{)8A\$A>p mҫ2:= \yR^&~7Էᒹ[Px).Y#o]E&\b+uc\} *SVGI?DXaզd5~#_+ŧxt*B$i|(a쀄4oVldSB|'wHpkmpTCyc^DS)̔cVM RliAYMFWzDU y=vc#[8qZxS2j:H2WrCȢx;.q&@XEW={[lMr &`[49p 8ybیpQT$sGMKU }p:,^j1A *q.\O5XvZ!k cl Ojo*'XR}$J")gm w-Mل;x 8ܦ}/cWQs,) `JŦЇ}yÎ*!c9:8?@"MS`Sow`$y]0Zݽ`iko@T؊ S '%a6˄Mlw(s>c.[^fjcAƦ0?VE#GΈmUipVYob2\ˮ0^K=%4VPqzt#} U#Ғ]MrTI=:ZbI3ϱaFjy ZD48D8@D/ZAq~dɅ/>C[j̷P?l]IF#u;<nʮˊ񯠚,yQ'b 97NT]"xT=i>I=yXSlbk7 мa :&o(4̂Ţ0XO*3X8IوnmvsSXKY9QU Y(\T`y.,8؏C+%VǞ'tͻToAs'chH=eaGXUum=O48ᕾ-Y?dYWriN%z bmk Ф^?S/j}MZxmKEeAi]Q8fCRR} i L5洈#[!W=1ھh~}G9 x{a#:9w@dRΜ̫2Y5SYUߡHH*gĻs8};C>y;^l6«#cکR(/Q64wڂD[ } GJ14~kϊl2|[/w9'~d6oNF-IWTƟpʂnoy>ø_uLP -aE`q][GL"@/oYkԡv/R2`o( ~s&ZC($R=Nr%.KPeڳˮGO;0eHt'޳"XJ 5fUOf2UwƔ{z;Ч{CIf,ZT%Ja:#v%iI%kgP[dS#߻j=bu@GiiB1v)Ze)lǕblnjkO|~6+uPr Jo` QW6@+uX/k@L9y3V.Q\HБsQg n&;VI&J}-"]9+&},W>{8 ,K|7Z|ij@QcUTO"ȁTa̒xt%T9J/XLVWY.)pj i慣$r!Bawkdn  c0rU5t62Xa n(ֈDJ`z<:YL|ޤ0;v?’;89ݢW]CNN(I[p&sIsu@ˏF6RP'gcn9{3K%8ZuIQh7LH?X˖6Bݑ^I.^}-`6vDZsfFH M;]L0@Wm4@Kl VI/,3>r'ۑ99fA\)1h6?C{+L/}nyh3Pii.lsN; z&ylSYNi rM=ÙMEl{z.-A`esF}}:%\ir > 1t~Fvr) g,K[Kact8cSYsf &*]RLe)M7 `PnɁKw5xyw(2.xꕤw}+5X;|JXks,BښFJDS= Ω +헐bA-Qn{$+H=JM*&jI5k#[#ZV.7nye&<SDo7u *-?d$g5YJkaq:7cb&%\IѪUlGuIm\RT1{!?zB=uG9FZSnvH OFx명6H=GV~cP!cX1Jm`dF[ qQ1C^{WDp{%+;$tnR۵PQ3@ɦIx o3"f;ES}dF{8`dxCDvϟ@0q YsUT:U2 hJi4rοLcFW)ͤxǙy*\. /jZ|^!HG!I?/)cu S> !>V_ikYؑV&t^=[ fDs} Sރ<_x|,y>R"?gVwQ"38|ڀ[A}j̙WW&w["LK  rC]>Sn!{NM5橍-o9ʖh沜w-sQij 9dc݀&NtJV}<$Az0D-bW{ܝ9fagmKM0h;Fwbjtw@Eѿ .Y cMX>w*IXESQ젎ǻqĜu=MAU0fCbǭ)^?hU5kvDI'%F1>y7*6h܂ѼH ~-U=b[{sIlx JDKKf>HV/%o02ykfnrjMa6X (Qn]Un_ٔ K"ۢA˥S,J$p9z@DQz9ārvu`LR2/}: ,bF(ǔ}Ϸ: > KY{ʡsjٷ}@+LSԇtuw>~LfiU !<+cqS#GA$)I&Ơț/W KH7~<2ϫLL=X B63o,jhV'hQF"e[O2 ,)ڣa6/E~& C M )fK 1@ٕMK< 0Ҩ܉̖-D?Nvt,W0 {n.Q™P1~ @V|RǞ4(31o U˥䤯 \,Sn}-Scrrb2I[PtrjٮU਎cH?& n?S1SlEZHNf2MRe%IȌDf3p1m@Uhy #Z15x졍칕7"rtf=6B$K'qz3ZiP%-{Eo^N2$p9'i^˽铟TwWtiFwlV.%KH|ٷ1nndC8=~?;HA L:c]P_u,8uP8"/#&˙z3>AhV;K,5F#fx7*ztZimXW05Xf,7~әxRgAI]X7.H@/pW#='G;%U.ié}&/CfЈd\3npD[y`ɢ:aFv".4|gB_3iE*UgOyi$Q\1-,=%g*L\GMKI"zhL=GASzn} w~svzz.SGޅۏg*22W% I[# |!@% $0Ϥ*Z#f/}/:Ӣ\һ^{8UA5peB"5.,@ul E6 !Ahr&g[Dɗ+]8w6oU綝vI.@!Ҥ,C",e6G2sfWFwԛ)if]Oc=zdk&Yռ;}Wg^Ui MMq`+ϪT.C:]rer7ZV/VynSh~՘R ?VksR"_9FV] TӀjJ3C!ӹ=>ݡ=k}~ u3shFBl[VT'7g7PU_kwYsԞfDfj.6 "Uo1 Ud}a!,|M@|UG'1ZuPXȩ㼲yF;߫y s# ST0lCeRzBs~sc̅"^ >yWجEN֍P:ô뫎M9cvprI?V:tfOaAyJ?n+KV+ Ŭ)Jn?YM%lCBBկxV, jIj.nk2z ۘ EL fcүrD^B. Ei-Y> ̵}Htu5_1l Ec %ȱhF#rqy^x6&@恦}S \ ~/+wǑnGKYcт[ЭP+K9:eK["T](H=јI'2)'[K>HE݂h(vCaG߼{8#P: 6FXߡ[K5FBKApyyד*ZD옞2 U߁l T:ւtcwbMC_vx q@Ñį@P9r1hf!b[9oyأɒSVr{ Q؄j$ 'pm9a4_Nb@Ģ&8Lp1hJ, 0!t'J{4KWS<r9OټbA`pͬ9n:JU66aód[(ڶ5hCפTУ`;0!!,pp8˦   O%hihkQiR3?Hx왠HJ/'[iA,'ʰ.N3J@H 赪54F#~ /'Qg*#N 8!̖GF[r$L:TU:xbWrRձcpOEsi);4ۅuυ#󘪅7AT6`{J7e1F2^mI5WەϞ2y:nһY`\ɕcXJNYexb jc ؁h4Y]q>PߔC6ń kcre dIBF(:7}W|J6 :kV끶B[TF&[lw +{ef1c"5>#njdK10MzziXZl+se íLVg^EZW`Zli]f\R$c/scG| U3W*Bt)=0c=[ srR)+vջ0/~QPY\Ḡ4xuK *z?Ya|e3N=9:.{Rԕ:xS[ EvOu!Y ?5HW)R" foA =VW2{9_Z6Uw&iߜ7?(?rq9Zћ1-Ku(kz>"XrJ>JΧ_ k?rUD \ '5:URu;Uq ٩p?s{pq$ו{ !ND J{:8LZu.Fj$~ɦ{b(1xW8~Xb3WM5U9Qؿt,Z#CSydY܊޽zv!hgW26_"8"/Nd1Hb>89ׄӧƫ׼2 I[550 ;`$_a<@Y1eh8 2Gv F845S2.gGV_J_[[1XQ㒑mb ]P 3/tUE{=uXqڄP46ݦ P4B2$(@@mUZܩh].2J$X 9[~Nۄ=MH?3z¿w00R}D'hnSMd4gGUczPAVG MK dMX4!_.WŗEEXٯ2@VԎΝz2cy!G$}(nYHgC钘p,t)9ѢFa5ċ(p32so挅@f)_Wy}8?[B .VC[i+$ uWtRS-Lå}4@4QEqA- (k<&܇2|ڙaGOz d=Kf8k) #|mؓy9¥sYIK:t":IRyz'pXLZ8TD56׿ %Pʼnae8b;}/FK6Aj/7*N ѩutyXK.[]jo`ҙ?xҺٟp GSf1lru4DxI'Z;1K}^z /~L5֟7vsV9d .z HU߿*""=B8${7`'ɞifK>1Ɇ NwE l JQQO?6u5YDm#`}|TEP ^:m_Ԕ̦Ì) I7|禽CNZho%h\7l"mEo~T4õE]ܠ A^jOAzDMxŌhTsn$y>Ž@5կ.pă.*_HU1dP:ܼ7y0K^ā-_9SAh$* ׹jڏS!TwL.SJAH1)U֣!:>*̵qTL[(Gxo)7̰ $ЄZ^t(؞8hTt'O7ǸӍR!&."#fEQ6c"6=,kNBzɱlZA++Mql:\6F6VCZ39Sx X<_7>yaD`(&d1.ؑf}pJB۵Z 77*ٓL/g\(;usxxC(L貢跕מe.p P(f axZZtŠWT6FH֖60P2h.꒭lJB$F9 >-B ]wDZ~ms#WBXZ7 :B.)/7;CxI% $ؠXzM'K HB/xֺ]r8mIKdH x_t@u^ Y^gN3B5DڍP,vcP.g`. n3']q2MSGCaqk+eh-}Z9o+vLф8N&7+j.f+ReOWIkB~T㯇&zз'cp፲ZLՅډ桑z|Z#lŸ>l i%0]C󎑶_ HS>1Bɵ *cIbZ3GlMK:^idŐ_/7G!^ kȥm\2ܬ~)0waKn^~twu=W8 &\h -(]"̩@7@-NW2"tIb{|q;Ld\RZl(8$\ؠqMPcD+ZYҦlB W:蕞=^7Bd %RM 3>18sR{Af ׏q*RҬ(q ʌu%<*1%7,s嬼4DnYQ[JFӒk@utS F>jMzVz:Vum7B%bÍX*q^R2dҜX~w[{g#CB6+,7!M e:ĠiiahVp1H=r_610@Xvǹi) PrN"Uh*mlPu5|X[8>N`mJ~Qv ƥ#턶7m vv((!Za69%m|<5%JgVRRn@(JJё\m20({N`lEO-~JhZtgXk[:^ W`1xmm^2`3g#)Ga@MA!%}E=Yw AZk#l ԍ:6-QF߇ݳU7vZgEĚV]ᅀO5HMZ+̔U ﷐/j}Y@+d c\utg}㧓$2T-ZvpR LV}ZSEx(AEQsCuщxp\I j-M(MEavtc@ϳW݂4BU!߶<HpZ'l 8.]*W~ɥKS :imWlExZPfdQEn;/\2ITZQr$A;/V)EK5r}H:ppA۵΀ ɨlA?iyߕQM\!mR2gAz՞KEM]h۾u)tco$u&(0]VŧBpNloha +<(bM=rc%AN 5I$ 1e9yql`'a5(chOTU<'j"eS_/y.3X)A㗰/f}%cA`ZM})u[ Y2RߴiW*X;4nOOdj֊H!u{w?F!2ͭ^֗j߱"H w݇)jعtK}_oF|v %QU/ N]6L2%Q||?د2<8 s ř$-EG  BZ(05{I^mFlCEi ?lbʼ ]oD0;),+e*&Z'iDA@:g~b{)hʹO%%aU.3G.a9xL'*" r:kz7lsYoaFH MfJUif0Xm)v_$èL82(p:ݧn2=Cm"bY;lG+w'9\6Ou߉q'Ҫdo/\1۸~NY*:ŐSn #޴ئ- A+πڍ+fn5fDaG$MKT&VN꼣I,O^0J,;104Ҷo[~*9Uh`,\i~0n($lv"B UȐ}+oK 2RM+nҙ[ '`1(.W? =k!i p=(]rOT/NHLS@Ց`:[5#37Қ Ų/UfÂJj} PVǠv|y2$~1-rE!?뛪 eqaœCuSV]AОYZ wz"ح_t JiYOpefۢ \!+Mpȟ)?ğx q@tGv@,0tbIjpdN(tѹ̲ըZr"#{XaD_ 's|mTR _BŖڃK[c2s5&e9ڤ7 \{v}eWw~\ra9mt#p-} 0=AuV/q}# i_5$5wf T~Vz1EU+_X{ukrIƁAԺ B#=_d@nL(`[Eƫ7cA~yz$|.^v~kAR@ezN(j^"~Š1I#ɏ=ǔ$H b{MLJ`qtAQ>-8Ɲr 9|T줲AH & I~Fi'qʪruŊY;:#a? ˴s.^g}ΐ(qu'&4~#v$^ ˔6K{zĠtrK| 젧oNw#X|3=C_*̸_7vζn_yRxU砘UQQiEkOx=`تþU+C~~ydZk3ܰjnbm2WJR:͚U`pH7VemIETB'\qTZ3Hc* )ZlAٙ㸡޶ót5r(jPEe] {zj9)Mx_p"6 O:)D+\y0V:B{v騖(4av8N λ *^u\+>CuUFF#n5iˉ41QlJb*۠"CĚ#Iif.-OeP.yrY%DS@K8 TƞD>lW*d)SI ֡P7b Q vU[2b'B^Шb$T-t,0q NJ^1 nh8Ţhyt?;1(BGv^Uۋe8 Z MX(˚is]E ~7>Պ֣8fV(Fz9q(5V8'4aXb66:""x=Dq*@?-PP,d:5 HeRff!z׬`ךa9|쀭4hVܶfq lvN曂gQ>"-i-KHZ7In;/Lp)m\zEz3^ĉ YWoW{[[ȰoL( }AUz~,!rLnͥ9Qٻ$ڏ̞-ǃGDY`jE:`I/K:7#!ODmEm TU9ӣL& H疱Jc':=`1zdf4Uvf.X!@w+hH vl,1z`;:sJkZ3v;A?›m ѕʠm29jRq"Q[224 G)g|^1F:0Tbp}[zq\`%;\&Eێ)RsYe`bO&R2;,tk83G A<~ [_`?YbݜM#_^/Zn e`QUi&vfZ֔8<܁.Kzj#dk$DY3фZ74~!k?.Fu.+u [;9cDбŶS08cߠdܲU,/۶{*xQH I:ȉ`rSj/1r6ee%J>,"㛬e¦T\]\*)A-caƞHڊ4X< +1-VpMs.CL9j*jQr D_:nP3e&‹|/4`g8V!,@a1l ~B8fbwXaoOOqPjcf凾'g9/vGL `#}ՌW͉¥j 9!mvĬ3nQ"~-~ViID7r!F[ Aܥ@1P|n8lr3rAE>H|ӈy#tx&nF)m= giϕ iW6i2"DSSp9}躥/(ܯㅸN)XǷ!C­`{| AV[tnܝzXYFWzH׋EeQRhT6||3|fG\o } qCF-^v%EHNͶFJ?F[9\=jx17B[~Ek 'F[Fd-u;V$ladlk-J3ɰL}?GIewFeNLљr٨V25khƔ< RRl[Bnҽ$ jrE^t*rr J5\Yߡ` k35nVmuJve?&UI:XQ=FL:UrZ7 6+E/X?[S7GUxP fΧUvW',7$萨Yv$ w*&=zs$VP^IHF[1 -0ŮK?hIqPb+EuaPyِ N<̃!۱ vO)(y#j㉖XH

>._HElfk,CSŪ @} C'(1t/Ԅ!fVi`/.%f ?Q~>h8۸m58nU M;FJ'Y[r:ZxH^+[Q(KL$>6ᅬTݫUx*-&6?/F|o{e5;%>*ҳ) _KtsSŽ5h b[VT>.F<ГnN tד|j8EԔb;tј-}`mz)*fZyî-4Ims)/yO ʆ~$IB4cYpӎ-\57o%vYEt!f&P\ ?KU}2 i,*Z1ߧw ` r {ND A Yih"`(cQ!pgD|)2Hjlǝ>QPM,|Nn03u*⌧nEC=֜xⱫ۹_FXB,X9G应\> HΑExG!yPuBgN%rez'AeJK*J5MO&6 n!>8 D3:&8( K?F.ƶb( S"!NK[Hu-"BM#1m]a(!E^C'T[ *;r fVԙHDRp` lӾ7\[f2$XDxuI{%>4eDYq-hhp_wM2\3+D`C˾ʺ `EQͲz,Jm+.x`s 犦[G:з ;^.^D{QF>a:rt_~Ooɦ8wD<)A\ z* Co{!hF#hٿ"t x༳*|}h)ulsCl5H TS}ݹ)A-gJg\4Lȩ%=3)mmy@Y.~K\-[ׂzserxVR^xw-(2EchZ«8yhHUR[ T~]p~n s"e@yhYR>_tp< "[)j'G"]`Q tΎsZQ߃~kJgP#XiʞG_.$3az>b1jZF]2vJ V^tB]P%lvjR)W?8Yubu5d6}g~rX2 sZ< `*+*[sfNF&fP-ADC8z[ۡ' 2F]KtKsaٝEPS> w0ISg * ΌB7juJw;sd-բq tfdK0lRWwh"0jnirv|.>ub`x^T^Mx S~B["7V}4"dbnON别4, %0]`,-P]bAj\6As[l9W!,xKKrj{atn}Q8\( z6ؖpd6 o]VMS M6Hwa!@JMς<7kHrS 'j&kpgGTƨ+,ud ~ J'VOq=JVyVuSj5)ۨM/LFjqE41 yWPQ"%L u/"z@˄Sł-j7<= -ͺ GH6! ( >84K36Jjٿz\o$ +rY)Qyw잽jod[.0S2t&+- vXx|D hǭ\M(6_vӝi`y|xO,V0e1,@ʃ\nYw-P)]啬y64IY TÄGԫ) |d5I\vcvB.#J.-tğטnT\?~ HD!e_VF%ͫٸTXjClH=u If-dO\_/B*P9vJj!=:Sz5 L>~]v{59]7 t0=*ʘMT߽ "b"VLn>~G`I <:7EROOtW;AҢ{a4GI/2\5fyˢ$UDMc yz& &Q[h Kx.@[VUT_Pu<%|QD,񛧑{m"gPT: .Bow4tcvROJ?:Z}* <:u\1< ^#P9e\}ѐJв DԞ8~>nĀSG3 Ͻ.AK|Ӣӷ5LV eEalۊwja4Y/5 17BhvAjFdXX+t#T "iCD<8K(v+H|Sь!k x#B Sن&v7I4o$q*$.Q7䪖]4%R1 nG=ŞLayTz:%9DIYGıG6׾(sB6Ta1w|J̉JFrfq7y pb+ɑd\Bu:?Te W'% @KX!A^~萡l,f򥬊t6Cyٍ8SWwƩkE|-' og/P3.GA;OiHll儋z^;.)Idt s%A' cHW<SPHfNyJ+^aM9\T+Aذn=L%bJjn\QR-F+ݦ:-xD"0Z_9͠7R.,,KL?75e7B.l4`r{e~6x\{I:VuG,Fidw+(<<Šm7ީXajJO!;XI ݤ\+9]x+6&+Luȿ70OYTTC ݰƍ). F^.ńB5 YqfmcU-\Σrmox6cϾ\mW#hf:o&RP dKQw 5yA/a~[?iZvyk$~,wrY%QyIt-O9:{y1b&>K 4g\Lni&Bl=WACt|@>Op3;8•\ƥeH'` `gIh>I$SC!UbRO"ILJalI 6 8R.LzN9i'_'j+ڟlDxHgQ&|l9J{ Zc$lwb3,|°Icwom(m)0C%PEŅDJ4޶+aϋEVd_IҗZܸQGyK3d^ihXDtHIeDyt?ïձ;0^/GED L 8ds,4R$\tNG4 Fw YSw[v(%\ #/Aj;?$ð7*D֝ާ +<ʩ % { 5 gMDQg_fɼ' r4a6Z㔨3x:X [L&,=}a_2k<GDYiƮ;a|&nG7{>g# r'&hNޟls,R[yoLUy6Y<$1U|:{'u8Fߏȯ'z3A.M3%X:!e6Ti*6{Rza"MQU<7IV璛9}P2\ ̐4h!XL!?]c%jpPll.v$ڵ$rڥ݆ݏJ9Dhdbnmp{)#PZhlswjTPc]]kX U.LCԳ~\0SFCr G.C=$UT^su.1: km)NO;^g#W%RACٷD*󃝼q]E@)wEρ/RbF;4)F KDZTpAdA)`K9n_֔"МsYV\LXeKIbT\cU M8]<6IvyDm{TFpqowG`Я5 ]@Usk8/M4X ^^ůu::#r7[K,K8E;]! Dt-/: xXSޫZ"V;YQ~5ZYlԞs94"à'lXjSxp0MN gI|τ4 bL xE=|@>v|.S #JK~)ONT-FJhir@e+UWY f7.rb%8.^}ߪd,t'հ !gpaL;7)+zhE+&{r_@/47q)!Kn2-鷛G^E K.p;Q)Nq4I:չ{R,o)7ͫ~Fv:*&@{dҌk@u2.TsU@OxB[Yިe6?N5yk]}v2z" R뱍ێkuKxR :z.a Ej:x^}#ZuӢ\ E1=$1t\g_s\hJ+O??XǀϑA$&B?x{AM dt2福9Q)\eYMU^q}!)+B*+oN ?LK~ 헐?=^ʲ\2}FSPq4s[SGGXs`Pύs95ag1 Nz9Ǣja r]]_|LvJ[&4?2VS2=S N%SdORAQڜGIE[ mVi>0ϰ(u6M8e.3r7̇;sDqxnX;" ^L%H0Ng#Էj3(9G{}R|qwX76MkGҭ% ; 53bDxQA?,5hAԒWx 2#ſn~GiVORJbT`Cc]$*CH E{k?+a*6E"ԑD0,t>ZU* Cag*E EZ[2SwyGzd007#p v{^`wb7=D[Sj7nb r]$[PvVxwE\sV A9t5-E:MLa}mLcP%ש0M\umr. ~f-+^>y j|W 1e1{̗-;DsFvuԄd.QfZĐuݥ7F者 ?!t^X (֠}3&;qL ;ùZs :N퀭#UNlv9Z-15!5X|L+c! %.' |DrYe#c^>wM7Ozf|h+Ch R"a8Y\w`+~)Ī6/2.Es8BQ\!g_jľ@\n)[%G[X b }n;]Dag6 s brT\X T.ҼL+i5eƈ%}2؟'  VSwQv{B/',^D fI)ؓp/oqrdȍ 4@د<3Má0 TN'U8^ɛ>w]@TO j`FJ^fgac3kS3rKQ^3Mr[jᑗ̮AMGڷoQg0u1Ť1o/d vS#Bx<;;NM_. W]ʓkI [*%wW!>\|,XgV =|Ƿ)#I.<" Y*߆ڹo❂P $Ԓ]3cU|æ꓄E1eA)J%j"fR2M)/r㖓zMqZ>W)o %NQy RE|U,P s*1f:NEݏ{h ͈w5.;hq1F"taX(VqraVEv.#MW#nz@1Ы}NP2qfn\t)N֒SH ~tI߆*$/%Xh,' cۘ%$2(0qNQիP=)d+ss^j>fTt/ԮA0;GOrj#69znI ~.YK8J="͜$Acfl:/'k]8,7B,f-s٠;*t>:)' -9񉩅7l "q zrBu8\[^s t-6TcSX")o5ږT{&Ԯt5Bـ@cqω'8҉Q'JE,О?\x*79,LnIȴ`d;>&-KCs apa/Z` \G vϦAǎZPly.yACp gcmq>Pp ; vAd; ;=5:ɉpbkܣlFȁ;x==C3,)ŋ'V{SqW3ǃW׼iV 91 lesl:n"kfxNu6U@qY 1sR81ܡ~~ȀWґ-bԋ!/[M̯.RHZ2L0±6YTvw "'#-|PPC"^o`ddx:ov"91|qc%uE?$|)v74;oy:vͽBqI^{! 1&ar~As^ΪQT< +ͫvE>]wq=/3Δqixq֡Plཫ1 îvI( ̓cE7qM gR\-V>`ٵe|d=0Н\jvF9-yKistj=^ku6Օg^~_hکD=yb cvsP܋=OdD#2p?)`U9DUx*&<|FC3$({1VѦZpL$%y zys:Ȭ7yH쉹gSkᳪk#6ЅxG$"?٘C`Ѷg$YwCu5jxĮ݂²qW.h,tϏFzXP> V>P&ji>tfD 1X_*d!]_F} v`}.;,H5ۑk}i sBlDZm>F4>75~Åj\60Oen){> t `kr6\+*D_ްgRUz5NK}_޼[eOnMJU>r2 Wu]k*5=ԜN;]r&X"P3l +C8OX.ctzh1O)1$nOY*9PbxrH=Ri_,'jϙj&:٪hKHT μ۴n_{<#4Aɳi :7%mqe:é2p;g@˓- pً]92]het I mHU_}Bͷ1Z=3p+6@zgqEYViOI/ƭc*5jk%T5iE/+8K(<!jp 3=i\h~>'}淯Z0%ّ^n{$ճl+G6f(85{d@/m,PX%Q'L{%`wTJ|/gfD^:؍.goL㇓8LY>e)e|/a ZeOTJrwS$yIuLlfԊ1^(%l`2_b eW!jsO1##_U)ZM^B-)j$1d4/i)}T~(cE`&ZV6|F""q1aSZjIKMVŅ#Ǩ(QcR<  ?'6 ,.&|9M>+"ΠXVo6O_/YŌf?R8c$n"d5+Nds킮 $I hC7t=" WٔLkcCL' Tggi ѾuR1}4o')b[˦W)` dzfb;&iwӘrB.TX!|7nsn{{6+ŵT&+?LވsܱBp@81UL<_PH)4|~ʅh1XNz߯P;3N.4 XS$t򇛖 lVG6\*<) |y$ m #3= OWo ë>wx+__|]]h˶2+DRA89-|\Us>\xtCwk;T.l Iwf`wmEY~wYCa\6V>'ƽDw"UJw0q$M5>!- X>[Ku;h /-'ؑF=(@R0b5C'JtouIoEBR&Ao"&ܑvI˴rrK!L'L/q~jbLTV|ĩD ۆT9əU _PeO $]8*p_7 mΤwИLW8Jb-))Xa654;ۧN)BLA]kDzd{PbKZT\ |˸VtblsuڳvY `E`G/I@3(YbWyY nHJ/?XBE]XOA d:fv$/))Q͒[a*? \rEeWp(3d-m1Vi~s2SbŘc FL;0iX M(s6 ޯeHab)̦+MN d[<6tkUd_u0{NL\z>P+)ь$MGh8Ia7qZkMhU `x4cqoZ4X:ӜP},fV*$ro>].a N(ϔlApEsjχny]$8#V·9R~d2;8q~zoyyU,afns=l/ߒ-[yD7&!# c{S +?j]6ɡcI/Hpc/⹇XjB*ILDMEbؕBg4 &f=miO6;vTv8S^)%|AG6iz4'䉃j9ΌjƎ(AaWkP[ӛ۟jS>>^A=`wL!7"QƆ^﫼+8,2 -\C(LΕ 8"C]ЫaR^"߫"k# 6L V Uy {ʮ`z!֎zIKT Υ t wLSX?<36!py1u:"} ?Z瀱:i0k1_?jyn+|QGe!k20`@cWm)Σ85iKx >}A Iy9Od*ge~CfTHmPn2;3+c8Y/⃮4 %AZm  hKMԱ&C̟%C$ @5wwQ~m8'^}nEK1#_~Ԁ059 KEv3^wBho<~ˌ%߀^6\{DW_@%>ļqX&x]r bx)e co2]]4Φ@~*G3 Py ï.B3%hlf.è,<%B`.8n="b^b!'PLl 1FyۉsY;jN)8w;HZ"k*LRs\8/I+؜V9L=q/N-ZИ s ,E*ͨ{ڑ qI, 0Y*/ ÒG^%={ {H[#o970@s׺ -ʗsD4j2.Qpؿv40ѕNԧ.JC2SOXzY*K /WxUw{n3l$C✦"|0C_iN h;i0Jd;D uW1YchvJ+s%zNNVљ;*WgJ -v]]F*~ʖeWV auj^鏓S92gYny|pW%Ws?ORNR o<[ݵJpQXbWwc#IE.~Lэ4b8k|Bc 20)/d@.t ?-Z0<%D kL7gpj߽'T)pR赉^:\2g+ =9q7`^.X\[JE3*akȯK)^LjtRcv̰7{do ܨD}/yw 4$8l~Ѩln.dL`kN}*5U-%Z7rɱ*ؓ)^o>A ٶr? R 9ad[{עZUX u@KVpLYs?.&{7۾y F9䟗NR[HKҳQViZy1ih!5++LOY Z[˛9Ècu41; Bc mHn.;# To?HXK"Up"G{mJ=B6g 9N@%}E'fVrTɬ_CU$[Y$Cݖ{ȕ mG`ʤIE:݄bX;GB; 1A4u%9G\ݡ;=ZtbRՊ@%_Y{=-02 1J8 %"XDz34*i$Idy1ىѪIT-?%zP4Eb6'1bes 1ϒ%G~xxa|3AY<@rњy*F$wnZJr֎+S#ڠ07E .X ҕ5s_J)3\̈l vg-& /Vp%ؤ3%{F'yXR؁mm`x\zV[ TQSSIzt-DAkAbtCK>5->dG~IEtaF۳I M*}a 0$^5H܇z-ߌ{ bqT r}`ob0^Ps=| W ?DQTR]Mc4*XIϭ 3BiGujx!d˕ޏfv Syl_!-9$=0|3D {h&=;_E;wgB'1 N' Fӧq S+H Rf(pޣH{fZNj.9^bCuaH+X}&뒱>Yt0̩둔--چwH_u-| B(jMpXwe7)1wp`z+erFT0i~ڢ| g[FD5GK'k Is5Q4NrL= aaEr^\OM)j9kA@3MHfⱬ9GZiNv&2e*g1}ыedФ'j\`e(h`[<-mٵ 1ۺ8uHRg>;,6^YUt9]Z1m_Oӳ:aZB@ꡑl’gG\F.k~ULA̋/&YH0NS0¢ulϩrsUm[Yұk]n4]3ָP]Y"\ &/݋͒G.qdeާ<4{eZ.fMDV*V'b{~ՙxC/{34 o;8CGnUB}rfMQd0QV !ջ#3:~( Ut)PZYQ/-cYP0VFE:-YG[ljh[J6H1:(%/@.MP=7>Ô̓켔Þ)cIh9(gUBJ)5ۦBVx'0Djn>4*"P31yڤF6&5qmuyΪFƻ:FQuW`H@AMQdZr^,D{1=-0J}!ҐHWAΐ!Ŀj6F<-ɼ$hg,)p,:ifU;'i?  o336㍳U`a^O؃*9lxM(3jlE;=&SU3ֱ-BPCOI> _ļAvpI5SՖa_{R1Z.ӿfxs(\"i禵.<آ!|NN  #RO*Z~ҙO7#&CpB\RVY &PZag.Y.:ǐ7ty: xMN] s$$ u7pwLˠpܛeu/PqDt8[\]hGN㮨OAK |^Ǽ klZCDĎ*{)Qxzzs N7^B~a*OSQ^ɤQF,X( F BBv J)T±1)"\/wxkd؈@Uz:n}mtW[":gU3(o * )8YFQ _YㅒެB}MX|8Kޟ1;d+#6 @ȴ~\''<fN^{@W[ƥ*gDqvtB P hj뫸`X1@d)0) ]z'Z4AܟKb dtjfS x)ݹcq{sGgHc T<ѝܙFP701+~ʢ^2kSW{|I1 NI:SLU a=QØb A nK'EXonp}?CQSwium nHh[QPdcxo`Fl+chWE] $-w%Bx|C5LQ 4iRw4 ZMj`^WX=9"w"U%*ym.A.| ltacȭ;/覘~c 6Y$okASNz+(㪙"CkN܃LSGQdה|YDϥ}@z1c#NZ6u&q,17't"m5 '%4 h{MtOOFHcMc{^"s|1,  5\֔vˎy!Cn,ˏȽ :H %{SuF0ZNхǥAh~J՗dY%^%+8\)G֤*x ym>'dka/ p0A6eܽ ΉB(ѾLsRx?mW"Fz!`FD-7;w[r7X: 8V:R{ q֏az|BaWhCYMGr[ ;nd{8!wkВwid\S˕Ў1Fc! tŐ\vyHQ% : )ڮcn֪|%;Wy؊sFn0WO5j~WY ^6t8[?k@9:{ .!yF郖pAݕ "{rNVI|vnX;Hikn$K'|ȁ((8pFD1Aj#Ŷ)y 8mJ0XFmhC1Oh<9P/L*?sb>H0Qa?bm)T%7zכ _߆%>tڦ/EdH5FV=O,kPs@YoiH]^!zC-Z5\>cJk۽H]뿟J7m0ahJH0o#,'y}p^-PvdDD]xLBPt]!o=$;ܡjoȪ?䜛{3_w8`i*Iu2A5zH}?;22EVH.v5 =vC{WB sj bi Rn^’.l_OHY=*4o\9C-bo?bTy(yk$۶seqq'u*nV#$)C䰭j^/3k?J 8F6h\x< |nXgοcCxBm Pƃc'S v%;F e:O>!iCsb TYϽ> )XRP95A=|Wojs5K+!R}lcf4@b@=3X~ ƼkCapxr ^gr܏I"SbI~mpeϯhtA%1 /;3wT&AG7OT=B0EF _Rģ\jlUH'hLep6O]UɛKQv ]fsČd( 5OE Bꛗ7TXa">X Hי?ưap-K8rت%6+E(,QV#nǠRc|"VSgz[ռ|+*I~`_V- ..[%OCBS1BwuO;? 9Ђ"6G/DK~YWvArLnj~EbAj$OݣT .-"}}P<҃oJY}A M&x :%NNŃy>'EZYTRR?$ΌLpݠފKpQ ez̙_6\.ih1E zeͪq s&,u usF<%5>QlW/gEj֝ Sl3- ޝ#P?3>%GG^\P0򐝂SimQE^w1 뗉@JWe797ܯgqwԽUD!kqfم}P sʵК%WY`$&hPkwmp_u+7)5 zfptV gDn>&^Q)D)j<)=[h|8u?yNVL/Í63{Cj"z9b)S'Ʒjգ֢[ Eą LmA\C=7@sɥ/*5=%^ztR@\S0t.ǸP_,tVٗy,KL+5msMxs}0Gh|tO TKq,ėhfEv,6NѮaG\ʃcG<vmwx]]%%:֤a;`{t $4%H~B3h  8>8}a(l3Gf+?O1 =k߇TZd7f]\EVJ4)L!XŽD5wu"_",=f&^m W=BN` ݘK=d:?2RΧaFvXf@G(k͔FDX3xs"k:T ΆLŸ&->Z \ȓ?ঙnpv3cC D87 Xѥ=߸#+oܥ0i܂f؆\G *,sLB+ǫv`۫ rSw:"Xd*i:uWQ},~ 4|{u[Q7D]?/:N|`Oh4~FYjG]"oViFH.CbfX 9PBJo4#u%%Dk/!}m_&{ӫ^X')Ujt?D0+ 5ֿ@$HvW&˘:LgDߵ%6u5X8DO{bD^=^ǻѵ /=R9v75yW$L41dZ̥Z~jF>aD1tX\MvWs9i,&GEˮO}m||ŬZtDFYx;`?NhlȑO$G[Ԙ|M^nBMU2!s>3cF+)in5~se@eỳr|QCdv٩),E.Pbh c#ذ{[ rlv}[[IRzf?6$1CBD8KGE̓q*'K_6_.zЅeWaOCBFTK@͉̈́z"h#%)XMk9rlA@RS)A]CkI-?kT{y/s3/Hrl#F*t6$22G)!`{(\N(v돣Hg4෦x;d* q,do]#F]>IZӰ{E9{m Lhr4e;OPM^';V _PIiRmإr߯ z.GgL'E8@lC>2Ḱ]J lX?-XYN\^'r_ $mMu;KU(F3<,Gm4>Uхv8Shף 5v`Lʖf[vpEx܈s$ga(f9B ys2N`OՄz _^+理 $3ҏXWj+ϽϚl=P ^OBSlf 6\J|7]]}g%fi' hpĻqX%\E2$ >D{}c"OeFb5 ur[nߠ 6V0s㽣rtSP: _̜ew)OH6XG/ n!O%:$8vbJ1b9a4.y-xݠ$6ƻKc e1EYS6(q4l6;!9RT\(;X-SA ŞqHr/~Y `E.#p <.{xwI21DC5֑J,~ 0HzuʏdY;?@sHGx0W(Y)5i t> S$Du4,~h% 5].lH5$Zk~K\⛏2pJ{CM=`~=1.n1AI >xDhRuwϓlir<[ٚnX &DbsN=\Xqv W[Kf^p[^զv_z$질cz7A(zkF{s7kib" Ԝ*vRPG-M$jAץQ]/J,^ oxA{+n%DCRSGsp6-3O?S<%eb(j %:pty?:SA@BXq2)tjlqh~0]V1!Z4K^+AUm[>I<Z,uUO~ZqO={ŋ+eKüyQ^w Z,Aɍ^=5JPSkcgU酪XHl~"_Q`˙4+2c -,2AsJsxxꝵgF>toI+:U6m3GBn_Y Vf@=0?2f2Re$[ϡU< $XR^m-Iq(}G2S7Xŷ]Wy֕PU\{T̚[ f º\Y|3)k2l@68W0挲 2 oaI*CT&Ԓ ]03B-ZX48W7xۊi5鹐^dR@ə~pg,?LsDZ2"HA3RNp`)( 8CncSƔ.PO-wn-EPcƆQUʋ'ߔNE&Q?K~A5ҦD`Z5f󝭟_s|(2%NvTD1_W|=>myW|lV]*׽t)>#icgmeJXNхxx#Z c^=j%tU+h<^Q|w" 3ΛNHPyk$4)R&l^$-wPcF.h**(/UG|s۪m\r&^i*ΩjxUD$WGsgoH7#Yp~I&{9Y$:ny6 )ˠ9 gd+/c#V`&AA!Y;qC ̣Ah "۬s:~\XQ] 4 wVބרrXxQfw6a,LCe ŮO!ڈ+B6aiVxmfhqn1kEyd䷛/ݹ/-L24lm (|SN3""ĸa(l[M[ <:%D*ng~`iEޯF!y46zAA*!G֓r=mg vKS'wt 4:$)r}ay4%2w,+8NMM(uaVgT5+\=O⦆Ac:Ia. KN2e,ODRǂrȖ1)aSk%~Uhw.ng}S% `qxR`k߸9*}=U޴+4"arN<'ECK׎KF܈%y-oq#,kV'`gT7)]aǾ?M@yQ$MsmT$] h+\9ʡZBŒ,Ʀ br,1T@Gا%^qCZqWI#fAFCE+TqМy&1u=Qq7P ī|ySFYFJ,I:oZRKZr71H5'Y'Ա :;UVNNE(XvKft^ٛ1MH jwrDsVdLJ)0 BjjW c'bBlA/qpCTѩG+7]+}%D)$mݡ8k J;xw21֯Wi%Qm\qh//՚.utG\.%>dxٟo =İy.n(aOw|ĢkJQۘ~^CWq{0hlf<]ߋ}ae¤sA‹ -e^Ej&+Z*)5>\ʫ{Iz *i>Ou8S1B: &f,@Ou$A(=.䐪ߋ;cPVCF.L?DpHHv;γ+gG8}+/RE,4t8b,9PwD^r?|s;`Rl):w}ށQyV#F.Nة1_5dվ魯fRCҀn+-\xUj[TQ33-LL?VYpOo&lI&>=Λ>$_=%;d${Dz w*5#/& k$e4M47TZua97a?TĢ)R42h ]hf`Ns9`N ޜ' 4]\)6⷟\5KB"8S3YGZ m0n;&QǠEn@^rP}q&kWruF߮G%Ko0MXcVۯW~=y+I[pb9<}^ p=g]x Kz\qP18ŁUkقl%Mf7Mr If{x|2ّ $i Z/cp2|hhBj*070p +l_Vv׻G?m{6 _(Ɓ^]V&%xma%Z3+0=},TSWr;O0%mdunOyԴ$6}Iq;`" 죀řk`(ަdm6l0+[l nj.iKR[@?ۂU3P\0u,OwQ%<@ 88[5ު'j< ]_d>)Zdx?[a% 7k*NlabЦ.-N@{ڥCFu*t2\ia2hڔ7Eu}i^qy|A*dG}IL10ҟr 5X<}J;x #(uqWmw16w~ FϣN&W h^%Y_"FItBQ3qPڗ:]TQ+m5Mk ?O3˨ ߞDc)Ռ p m&sEai'^pbO5ϭ/ݭ aFr#o9&5~$o[P:1i9ZSc t{ RV؎v\:tdv&=pX_}]^1MϓV}S)ry9UvKb?SP0z5z՝p`G샸Fi\c97=2|ؗX"[01!J=?QJbÎ9`$)ÆvƢ,c VxUby7f 说xJsUٶ LjtlU]3WPלT OF=՝QLJcNQfKzM҆t;Fh-V NNCiU*0Ch Tᚲm0.JҰm+fV2nS~yNYeGHضرBMB8{<9傺E_3q ,Jn-]90Z>[WG ( 3Qr)m1z[m#B(?Mn#: msdne Am)C/a$la`^2gygUS}?::e"5<}Mg"͠L?t/:=ǔ ][+01wC-{@v.5;V)F$K>BmP= .QƉ;zט,PUcft4t _?BjSf|'o{^c6?0}5m{ '%;G|ܒr$шs5YxGfF<_$;hB H# *NBAt+?í8jH&i(z ~7`JUk;*'E'X{T_|c}F0eAWSVnΘL|<҇{cxKޫ I j;[CU:zW%{j&=Vkc^b|mFHV\I+!AbYjF5X@Qw' { k  &VvA0$EAR+!/~9ޤg8ULDhdm hw3uw4L7_fI+EHL.3.#81d!n%`^-DٰT-Snf Mߐ|@G[>\U)!n!*Ǽal?B hRTcTj;Q#Q\a}, 8WDCIsP4mA=J7O̢/T#nwqd$`w.nw{{^팮LI,ܱ43Ov`Ee&Fu~]aB+~D>.X;Qf$;9l=钚fe:HZsJʫ ϱnC`IL"EOީʉPδzFy_kX Kr FE#J{OLruPJqV<*e!fcglm0 P+'ҽʪ{J  ,&?90EO1֕}62ȉ_]}td I uIGͰ|Ulm}jv%#DZU4f h'm?k>Hå(+7F0Q\-S?KUe 4Ѣl{PafA@n+ϴnߙ\f|y넖 ? y0 Z !SRV{ObBAUo#PX Hz1J) )=u;O0L3_(iw "=#AmUcN{sP|[\nyU`aӃJXϤXVKenD] mVoX#B5,CN--鋎F r gyN |~/r˩'&m4hi}cgz% zrm-kEF<ڸ9Q`40Ou~lk/% Sy͋ %LM[s.ȄkX¯i+E\A~;j(a*9hŔytY"Y7y2?b,hj%xw|өYA=՚FCZ7tsfnVQxG%-9&N``, ~;$RGeCg# l2 ll܎6>\b) i.^ EHU Am5dCJr{)RMW6?#K=Jٕf{buGb;=/](}0rOtT9Ѭm"Ƴ# aPK?Yٝ/a_`N[e0]=<ݻkݜY,G]V ,UHfOufJRnBH "FI|'vԽ-P֮@ dӵBmgM8rp@MZ #\{zOM,uC~93C3D/6B\:r|^ W>/Lo@vQ5&dXg?6 b,vv|*̠~VۭW0h\7Tx~F Glp̐$ ]yn %a7kK[f !,bಫ\m$#] mOv4>ʧA)Ģq A}d7v wLiy{Ѓk kp}~9sg gN*]#1O Ǚ6k*36/һ/ֹSR}e/G>'l{YGتf_CX>ut(ˆ177hP `IO6:!m\.nI`[,Y> Ҋ/}5yб.@,^Q@נw@3sz^Ǡa{4 >iYU-O>mWxnɩq}Z<9dr P 'c*W)?'Oϵ ":<7-ɻ/kY֭| |<>۞YՃ=^;KeeFenn0q0&cjE3uѡw.\vgkaA(~qہ7ed1xXnb$  D}$9w5zzA~0Q2Vid(L⏨/~׀}<$&q}%h?أJɥNP5]+@Qigv3 0n2ud/b\KB],xn|g3&𺐨C49/8Q,Pt0sa|bY\6@AS܇EgPe@FUrzi*;0慤Y)@0+1ĻUEd=Tq.Kvpbȼ8EC] u`KRydYap0ᏲHkF-*$}IߧY1[<є{H>y؏W]t73 7"^I~֊uj1W(^ڳYtZ,zE s;p~@Q2kE4ȽEyϥwnG:쪋`r }+adـ2uXAߨ@ [=5 w!+PA1@%6˹^UE(q-%# kaaB'dk^$X]k߻z ?: 4gŤ55j03p]Mi^ߴ=R;jpyNɦ/N !/'DI"_T,]l&wW[/;D}4ݜxԩzErGaL6n(=2\ڏ2f&gHhICTQL߿I'@X|- |2:lᘻ*OŲWqSpJ*'4l}nguhN9%t=z5.zqf R)eȯ Vo0aM]|WX و%s.߭+Sw/UQq5laْ1uI{IPKyTt#(уZ2VT8SI '. Nѓ3n5? EBzwBr%]76ꋀ gy*#86=`79l[( h||а~≗-Vq*-VϖYw'ژ># ǩ~bGZMi]FX vуUn.g1 :`#LjVSk\pxJ٦I޸}vuhdˁ);E-%SаP ^k맰ׄkWhJNRsƘ,ZA;p̘p)j.5̏Qw%慫upCv[sr|A?R4H!M%GN?Idhg>ن‘p֫ti/iV)F'QM{;0z)K|pqfliԅ3 nC}}Aؚ:}Twz}U&_SّEVi>©/.LDusyR7#ٕN2*nG.6W[Z<'l&!lpRNJ393(OlXC=5;^I]?<#u1/A'ݳB ?Kh}IR5}QǎO3>6198G?a"8Vcs2W8|dhu[2A~ 4N9lV'.lqJyŏ&[s.-\< AΏؙ8`7&C@.__-g&)Уa`Zs,kڹɆ?V ]+}ԣQOb [G;]φY[(,=e8-j%X>o3,]F%@=݃J"r.KTZhߛ_;wHRlrgyoRtQFOؽ-N O` V`*tb0} Ib`e4mcN =ɔg1vA<' ;I5ɮj^e0j*uBZYСuh˜O]{+n»>[ffq=EUTV-)X$5DfQٟ^BV>`[q-S+8ۨf[&%}c&Lh}tiv ޳} Σ1L&kj}fۅqqo0 6ECw~p9C|9T;n.aLM||ۺ75T}\Ada>x@wYfJ#ՔDaB\&_r{;ҼbjXy8{kpa0-s|h tL`pYZ`5Ŝup>C7,m^$AE2zmM^M@HL@y&;y&]@RH+HuDcևh_ۡU0c6%n oX @HZq4se둽-WO,[Y(w>J=6 YP[ovp=pIRN0d';xA,Qx'2K}T@ӲbLpnTa9LBĒj,:pHe#{$.Ɩ#%8_8ѷSe'H̙!4o,@8"z[7+JӚmZ#5uRDq~Ɛ.x)P0/t$0^Y WGh-qeJxu4ֽ,oMֹ3faa6Y}|cT9 0_9%*:+F~{e"TFI>ΒŝSyY/8`+|sU6ɷZ3W({d.OC R MxVaA|we 3i-<̳ kR)(=2U>&ex-]|5(ckv\Ok:{/%%@D2x;/O糖8 h4 # iN7a*7ȣN{?}D Qp[zGf^Ү[&Ua,ߋ{U^CamX2{ oǿSxAp'R܈@ܐwv* z6H`[R/l/ *^XB/ T1f ( 2w3"+Y8K0A[y\-jfBN,V=OyY_B֏2rQƙ(2!` #U&|檸AYw4JU0M~ kJԑsESЖB2Y&hໃt ӿǯ"Դ]*'>TŸ@rJ3+eSs: Rlwm3ʧ {ƅf&%iح7UVsw\GKF6?iX8ny6+52A|(3HZh} ,G[w'U& It 'j:2h覴Ҡ "&N1,g6MN;<׏YJ\QXx T^v#lBQhh!|dr@M72'RXǓߢmT2<’,ѨQƈ `)q[VB>[>aJ2AGaJ.ǩfwfɢA{1}w򱩴>HP%_TB#[#B4*J$kF꽳xpEFG'nyIC" -,A܄e84ԕ@ܐ_ߍ|cޛATΣ>c1 ݶ7F9A_kx0~03(5/'d WowZԤ^Z_bGlr1kl2}*Ƈ) noNc?dG"l0Ž7OUi2`Z@$bG,6]) /;ؾ$@ "w<wl(hU0j€po`AQ"Dٺ$_h[ẇ΃vq~Y~eڥyzs6-A԰mPP- q5|)aN?4)΍($$4쟛|w3dORAj}ڌs# >ש{`#d-n[&C kW N}[H H2dYc,) ?9| VfVbU#3.f6)f8MTɛÃzjo 88W ?t.H̚f!if㎰gǿ0 +fj,?ȣ6G4exVDZ, t= ^z%!Khj"`BjA})k0=Gi̵W!*`!RCr"b96,_DG,8#H[0ObZ z&NpNYX(LW,br]":hs5qu*:USlFmQҨBhu7j),ŀ命Ņ 3~Ժ5\]u&+'"D!T:S /5oBlt % Uqq JLG! zz'_KmI\E;KL;/˜#Y PBӟŸ%e0TxnFF:@3mpVih ?ʐgHj#x29,&j c vΰD$!#۝իzQ@#pѪڗ:HM=c\9]-2fI  CËr4\ 33:(7`G 5DtIꃃ['S&P/~6r県L| ֙ 3NX 8ܷ9yLڵsڻxrL bl{r@pFr7wQɑ^XѾV>iinkI{ڟ#9u@ INᓚ%S`mZ$ w AwB-dZIAhk%MWy'l17jqNj X˜>m!n_%?pHQLo[JI \sl6iG/ki2<|qSF,P%e c\)E 톳ښIGw_ˊMdױJ7L5@7{>jr\tfNذĬAHTidf=&7vYzϢ@ն" q#ڌ- a7>(.~a;ύ:H+nNPRBD ڡEM&P' ËֻH0[Үd-aXak]'N,Zg# :3ag,ʠ8\l-Jκ]Qp} 蘙 j6``s Q?p9lڜ"S0 j5瞐SN>I LPhCʵ[Ɖ8mצs #}gGDҎne ޘC>ݮ!!xZ"l;Dpx/Og%ma=Sed!J}M0J"~X"pY pzc_2r\2] 4ˬ^@ZKAG>yɵa4kO$kf\3)BSB41g|nHB ı#E<N/lVCos.~P_*e%TpKAΟ*u%Hge[85'.f)M:ޝr0\Ɗ{3թG&Z@N-XoT`k6#@jSpsV^@C7f!c߬訮w snRپ0iaE nĊ,rH,} 1tKٖ{cvYyk08 V 6~?4.$Vm2P4Cj;iTl$=)}iWmbxMJ[˫A_[M+ >MDɒR)WŇ4v *UVfW<3L[;Z@eQ_Ux]1CI3j2"R;ZQW1!'X?I[HW97ndXXsO<$`R_i@(k֋9%FVx3W.I=*WBC# m{8*%,Gƛ&Ebً̺R0orٳ}U|o94'k"U@;S.lIMyQ* l eߑJZ1Z=/-w݃װیf*s8o5ID*=eWts.Øri;]B x Ǿ`7#oOne'jKowz f9^Z l)jـ~xc:j1WuTUFBnKvlqi,'ȭ+pcoglIySW)R[F䤶8Iԇzylc0uG|q?1okq[qtcX5~u6Pm9qAMvzQ cg SvgGnm'^dœRR"Tg4GQxs¬W$_zG/ߐr:̜,vD]br֐3J Arꇈ^8V}o}'o/:ƔkNd`À=zDQnǥ(t~u^t݄4^h7s=^D!N̋N,['RI!$ {Vaq߭l}q␞]Fd`4'"Tg/?m= U+bY>eQp qvN ݄`S2C I=`ZC!.FpA|sC%+{V ۤΣlI &W5m9(0}-A 1pJLr\ug5dc'̣?B5n rp9?{wx+qS̙;x, %u^h Z,,TH˰~AȴXqݨ{譇HۉZT`x `KIg}e,Eң]22]o=uTն{.acQظ<>UYPC\ÀeoUriI,㿃my bӔ (?5Ig\d&0 [G; ݩUaHL 1%aCզBwdZWe(ԑXɍiv#2~;5`DA j ӎY? JraDþIWd Z̳obGlAD5ss_qpQi/r'M N5A E;̻ t ב~}H̅&~fMؿ=2|&Å\zFOŏT`2Wm`)o@`5C{( :9!g6,. " YD!WN3@JM? w\Nw2 eX(Ϡ)dr; CVNbC0")~E$;[(Ƚ1}ATYp2 r*mV^kӢ"Vr#٧ '< xN݉Цeto\lMFy 8hLk3XIv7q[|\s"?N8egCUa&7{gEpjfEuMKcQ-y-:XXg5<Ǽ:jDPHвR}Qd0\璾F֔- t{D`rkK5*"s'|@x+Ef^&P,Tr/1A>[@O&|bScDM=OVE4uZ*,_P pm 8xb E]~FPA%j6 9ٔ,Cf#n-&_1ހS-gD& TY*(&)1Iox9[ c;5g[Dr@ݟH bHnk!Cp /L?YA Pb_AS\JX\侳QHZ}&yjfEI>Ary ߍE,=hhOO^< G9g*0~]a_[1.(po=fyX Kj\/Ǯ%vUN\!J9.i9dz[XuB^-0wpdR6]r_Fݾ3'/)cx+m$@@.hnX3OCFWR){HKMGBiM؈ZdVY7&+e\ovGG#Zbrf9^3^tICL8I? 3I,(Hq v\\乖 3VFg×3J `H?wův ]qywSf3_pt֍O.畸j:XMp]XQC) ^:P:|AߡIѢ]ַo\~r{F#i #p*%v걩3y cʺ T 24iI^8] QO<TгoA5ܗhؿ[#?}]0}(Yk¦}4I8/augEP6WJc'qi^LZøZ(x,ge/Al 'M5٧,zx{O!Hix*jY0:=M uyvi_̜_SlRXػS@oa\ѧЯ&k_m1>\ ]Sm{4^Br@WaHyPfBbn>Nks7<5'k*O[&;*bfnX퓀1Ov%5㐅R⤮ȉdk2Q_mi9\vȶޒD$[ՔqPT = kD ؊}*jp|V1*8@~L(YiSmQ:;TZl +i=FmmY-u`X'N!_NAÁ$ Nk:A3wQس=\n玀w sa~lnED<}rK7x:/ rOEvX0(W+35hZG0,G3=)_e-K_i M%p5q+s.jP`W\&'mEc'l7;sҗ 4H2譤K >/ס 1 Hy{ҞMH3|q@F9As<7@qtJsCΧ,ӎAHI& IL$,#]jvX}`;L\3=+I(RtJH*zu!~xYKh]DJV^y@jg(!> ػ)@7I쑏abO(Ipi(Ka1 9پUn#/͛lм_]O&<`^ӋtQdfA#ľtz3OX&]h;BpRW( }R—iR5wo8&kj, 1apW<uBL?kt@euKU 6O~4I-PBŒ"@}F&Tt!F`RiykJ#QJhB1+%wH%=X>JloNz>4_ɖj+U%OBS^4$zSDHXk]1w) I9"xD7N<`XApB8dZKT<26{C{{d#nnˍ"m<wC~[N1JҋJxRonT[, ޞYcӮÈv&Y["yTuH3B4,U>~؂ëPi;)_⿾wCEzU$j b\pbA5B<"e|Jq8TCo؋Dƽ:/I._gOL x杏@nOqeVX왬EfV;PY4Zt'L@hwc4e1Uߙg,V_@c#=qT\OTzb1 ET2 ^ xݽq ʢR|4Q; x?`,IU,-<[>k9 㘫*-Xbk_~I:{e+w=-䉾3Fsͩ?i f3y ,5* NC1s{ȰҩsX8q@ؔ@$9BS0m-^A+=dBwN&U:Ⱥ|w0r.d RqE~!*rnY fڷcEyI6ʬYQ}/K ]wy6l3({xJ9)T15TOν&}!ZWCP6Low}+uT~Z/8GV.Es{'?Tk5 5 ~9 u0|7Q"NoYf'<zW%$%<>*A/2Ww,%84QJ\2Xh8`) oJ -Vej^%C%$qK2I}qva6k4;0ܲ~rQitc2h%\at|rC.nωk*Jy(:aAmqwǴWIdz+n\|,@ qO/pa>3rgQ߷:.bgR6Yl wB6J>X*QxKvGd:E(. O;I%BxngGԈIO_i#KƠm-/ZFܟ;,EɾLbRxȳpkO" ykjV,/񱔁7~ҕޱʧ$u :XSnvY\8*+խ޹\tpWa$/rne'P 4x Zcu/x#)>Q+[q5 éoQ.;Ua2o}O? %)_ S{aat:恰uwVoz_TP.q{*sSCUTwW)EqƁt,>ş̣Gm~3(/f]64lĐyw,̱71b"X h9.bS0.pj dIY~( HR*tfiFl8娨}:lé3?_ґIQ 60oؘErAO[>0TZ' a}BA\P)Kژ?S1)$̥ҲiF'A NFd2xIxdGW&s|ݟpi$$[M{ZpBLҫM@-D9_=h COaeBL̤3b̛"P l.q&/-NeRqluqxKn:MlTO`J"q[O|Wy9D\=*^HL&FU"F,#l#t ְ(\o,+Wi!s632_uL guVls!M/rJҬND̆2#]ϪZ;!D),Jkȵ * Oznʡik**F=ˀ`, A%z^Cӧ*Ƣ΂<Ƭ87S4s;;)ph d7D2lذh-i0u* 4ZWбU |.xZOi*Q!=)GGZl:_PO} ]w\k;8|/H@:(AH@* Y Rk,B~VvY4419ږRhnkUĄsw\dBxq`L^{SXyȴ؄_v^:VSf˖1c.٬zͥ}1yxD́PT6TMN+뚎kUļ B֊RQjqhٱa&M !*~eZdOؠ*]G\ QE.^ w6 ,xCO.xV#D_>uY\aFjieP_/o"բ~^zr$ &O ,ө=R. 2 o6%EuRvkZN Hc gv ΎVh_>/cD.{M#?Wf#<[o 3(0xY,b[qR\1NRD9s2R9Ͳa!L҈]O x6 = . cjtoPsl +iKM7$Ya D} w.+|nIrYN\WrVQZقL@F̦G!}"pDBm `H|]:9΄N > H [dSHs} )u= ̀Bn( Lzmz2д bFZڿcY - F1ߞ$ow,|A˷%2JKmA&͗[I ؐ8e^75ԖXeY= op\O\KUxp`]\x*_v"<ƽz| K0 -kk,G亪$җ|@+%ҵ$PeKwCV53"0X8iy6p`y|mժW68O~gܓbf[,;SZݔR9 NU9ӹj@׹"SY&|e^e"rʓaV#hb ]I4PFdj2+l_u>fFjiT,-\a%gKyWeP6bx/CͿھϴ;IZy|Ԕt l{"R˛Kմ`6$uLF-Tǁ2.o<.8zwѾй|y26Wh-֍AKji7#_@#9p%2zEcIgqj(xQxΗb; v%"ʽ"KD&{ٸ3T_aY aM_ࢰ_Z1ggnֲw zʛK*[DQC㗅??1: 2IQQůOA+}B=g^d*j+#ɹu\6h,!P_3H>НQ:n;1:<$Yk't<^(-/X׶B'Lޓ% Ƣ2/=dH¥6aDBGXr?>dqLsύCx~}#ʨؤɇVr7ReSN',xQՇkDƞ!Dow1~SєUsŮ` M뚱Ui)XܻIe7?W+%:dZ]!G$)Bl5h$=^ydmkmgw lENHD̊p4= 'w2 p.3 :E! W<"Oe[66QuTBBA˭-?K9X<t ]§f_ sʺb 6}p%'"bB<."`a7?p~\H&:fN@ye;i +.|9RѳC66\P_'t>kp0HRsr&RPY$!l5Zt &j몎/ XvB+',A2r6סѶ83 crP;C*0ŌHCOp924z:.p"ȺZ>BfJҬ}q١BJ-Oً-N9tJ.d$&V 9*Df-geͳuCi ^l/%UYt}ltr[$1앑9,Xk <6zi9wBO%SڡK+aK8f_$[R 2 g7aymjOU= !Nbjgug^}r=^ܛ 4?AUE ΧGRd7HL' a;xN}nZIu{:df?XsB7Mhf[ q|w4=猷͙׸[=jz/ȉ=,x8|J(W+aaT%2|ywm8d,䀬&9Z_%+d[nj]c"/^h7Bd7edZJRM3C4INƯRr^+O}xz\(G?}lGT>톙 %,˜Aø'#GttypdhMhUKη4\R2x``{qсN6#źdN;H;.eD hHU7٢Ny(v2FԚZ  v |Ee8<^lr r :>H\}i*w -?P-R7 ~?c6$M6#/R904p~d:seca!#iOKp|JMc{k>C{TTݳȤi-EjA`@d v5O&m휆CJAc!m5/f-X-XFۣ^/lƩz&iM MG=iT#oQSPF~&OƶY9UԈq류q}EOȠ*( h\b EjՁ0q }ÅpT H,nd<;H%/#.呇ַH)pGN}}8pF`8}>mycb hE [Fj5ۺ8x w{e_OZ9^Z˜CAi_b]A sw('k0>1{;, 8M _==2mUKw(qk3q;кvA]]LǣSŋ5|!(L:;$ۛG=%iO@y6vT}UN%7׼ ۸{ckB0BYV5U^h7f̡!K{UgDpB둁z탄AaINV74JfÈ#J]1C[xg. d [5Pk칌yXrl\w`怳M&֣.~1[H/P>^}KIl4*==҆dFs.L ._S(݄ *X)gL2tlBh9rM^G֞w; ~l8ƈ%NAT+w]0# ]Fc!1vx(ӰuXS"0մ<vDsb~Ϫ]p[/׷7( ݒv/9i8 #md)XFþʳ+U*܆Heu٬FokS>(qz]EPp4tXCZdS_r"Z 7Sa #0;=T2ɂ IMKE<rH/kxUH,LSD̕h#twj4tcf@3=F80!uSd?$,138rCAR etSVYuWՙ,J:Ja -6`GM65\JN5]0_<PE};{AIvrmh}؉#H% q+BY5PCg8V"1]ZjwZ+W(V-gLM_Ŵ?(imz~ku~,P/ÙV h5lc@$![wWLB }S^LƏoAr  6Uyz0u+l3?&fakcg:kҳBf9sQ+1{@|ԣ +--oJW8KȲvjp:Xs۬9pYg l s^U*9߸1̧"26,iUREN+d{((Bbd=`Nq>c UWP_Q~l@2HĴR#iwe멁G߄یyvh\E cP&ُ!~"J͜+yz4pg%ufS<>) >ѿ7@>rZQ1H!.g5![*ڜEO'V41RGnD(P* A[F١)Fr4o9jiqm,vƳWo:W+ -TZv6L[\͙=%E[7݌P(ԆH"*SCK\ݏCq3W8|-BC>i󲵑Ee7B`@MK5kt ӹ%Td8Fڝ߄;H[ l]SK J$.hYwX*%iBFgf=ݘ.gJf^4}/"7tcV6B`Wgqi<7۱Dµ`6D8YibCQ+谾Y"g^ԓ W =\Wc9๷'k fd0 izCvU}۝`J[z8A =0:ڮq ÓPEaOA$XdWJUmdۖmm?120",WHGV K{Jŋ$y8E L} HI_ }4w8 dvK;57$*MDuyC @HWgFt8ܔ,s)|lv7S`KHAb'!̆Eoثk%y;]^%WPJV_="rowǒ/nzڧd2>?AXIíG>$&n[jFIw\ f;S P' 1cnx9/iV|yz`U Wd"HzgZ U'U`~.,a٪e>YVZrEt"eO.F*J2l9?kyՎ0JԬH,9tƾ$yq5C3ЈMJ4]uƝl1ldoAeɊP?Uwe60qƨM*+sX=@ea=N0h;V$jFQZPvo\d"7`a^5iO^` *"MZP^^l:7Z4 I3L;3^F 9@L jWrq"5,|UfLM*M=JW]# {;(F y6z-8%Iw"_Ee+.λ_~*+i5bU=Ċ7 QG_:zJH!.)ɽC_]+V;/nj΁s-?Wd*%uT[eK^G|`ij1Xeuc] !rp:#McmMC*^b-Q[(󪖞:е3BOSo8#x;Џ,Ln£T0 G[0v L驡HQp[_\F^߉nrP|6F.գ՜?u1Ʃ`6+] J?ʽ6(!"SvƵ˓ JYH0#;mpSQ,8ZmUËǬ]icY7o)wbp'U^P.6Pn>0թtރD 9ż*CE\%?&cҵU6DBϋ=12$MZj\ĢjU3s|&*$rn^XWUQjk fc>Nَ4\/Tk_m g7 :(%hϮT U).d oܷpNߔ.(;\VFnzHLtɺ!VZZ2 };#1mOUg^E'9]"=.ۺySlX (_7u)}d7@E?dmqLJ/٣(zXݔlNi`manjLZn<ۅƘk؁:g3G=~D-ETy @x*SXҪ?ze-l4W4 c$t5I;^o_g3!3\_FbuREøg9bHe1+YT =lbR]<\:N%[vdU#tCΞF}).B!,H>U d5I:zVYjbȷʔIcCDfW PS.m/E>ްv$g  L4EwWտh9Ѷ9 GXٰ U ~03C.@|*}Yb^KymYz՗͒H| %{4 I{_U寖*W[;hJ 1< @y$Av-c٤zZhQcFYD-\DJQ+Or#Pt#YnxA:DS*_')=.S ɳCE 0gU ZV- O{R`)Ɩ$jnEejiPI𹣪 ci\Sw it l邲4/RG0W<p(=b#Itr@F4WUfiP??$ hZ'=vʱҟGߏovwoa^^R4qEՄsi[ j~2զZ&뿑Y05xw# 'ĪXD+.㬎H̜ӨaE7J5-njxTtEC)j0<9 \ R#zVP)uܳFоI^nIB!Q`FF6oyQz&ni ).ݱ)+ĩТCCjUtoq1;-Ggt^d"aiXB76[5/n(fXM])Vj2; 9Lٳ(nn9gk&[VcV}%ވ.;Ė&76\+_hZAɊ UL£y~g#z"?q„Բޠ-,P\RvjJ82MZ-"wVNQ^̒ũů$5_'6@ Shn{'U+W iھE C)ߩ<jG%Z5,UG6`[XU ]9@@oq+G+n{ Ibm\X)3וY 0:ob6KVSC] ՀLȰRd(Ohal5&+WFڌ-7.|4PoX_mZ&lW"ic"t6Tn^PWPYG+{oX;DdcsL4(RIĻPlSoѩ9 ,9UXDXsk/_:~R1Ep:ϕí7G祕_9# B'+x/?Gu9YSID"Š˚m2ZˈRQ`aLcVNsk#9w?KiRc\Ȩve=<@ko%PX @N5Vum]"6\m-HA~dѰ:t[F}0kzX]@0t|4M9A*9_CT)M{CMh|0p0eMY蔪0@ɖCj&W; }`9Zrm"\w] GATm<[?N%XEb ‹'5"7C9rU-_`C|U+bd}۟Z9*eNrYV2Kp5̓YPB}džxp@4x+g-(2b(f\|s,NunsA A,ԋlɬ8KU Ս[OO[$.}x:us.I.+ӽ"Yy7 P1hĜEF첳UsIxId%'|/˫5lL_M c-qVh^ˍPu +Rb(eѶo"cY}2 tuқ9"&֌4g/`w%%f#I>}2I~hnvԟ"|Ae䇴a&GcROm>IA4j=:֥M)z򺉈??n wފ:eWxc5Q62K4{|(ODX_D_Aʀ-;${ E+HKZfחXAo'g:\\;cB:<'5MeZ~C F621u_{a=Pz'9;-ȑ̻4֫bӛa5s 'fI,$}vMҊJKƧ]Z`GMT鎆l >[a]40OmCyI|GMՈiA.8 G]zY]_K߲G=B@8J5Mujb^ˣngo|W ׄeoL~,T:mo(|.!uH^Ji ip6BZfk~nMQ> n$6>nj5)3 B jw(`;h6z𐆶z/{(5]DSDz >5U: Km$OO_#>Md92Mz"b\SXE=lBqj3yKZ6@ Ҙ>a\= 8/a!S= a,T =LЇNNf׸xz118fmZ(72PIa$I`l]!Q#_ />iA\9~vޤ̺΃%}OQ;T`:YZAi= {*SuX2 `s 3FtҦTUu/ nvm|_--t/^70 (!xtl${e53Y9;H>(0Ad7]}CXcn6F;w 6̶?+:QJ4( q@8h:q9TݺqEuG't޸n{E?LN7ؚ9&I ٩Zg[IR@`KC$eӐY\akH o]l|ա~,n7-n*۞0:K#**I N5P(zO}'Rn}:Gq6Г BR*52 Qr;=`PȜj#8X:Q9=Z qezogAh4^3*Xm3r lUN4|h}'@_`L^Mz>( ~/\xF}sƌT_et8|<% SgJsk褋["lN}otGMm{o ! y7GI>%M$-bkOi^;Whq 03OMW$/ *mig-Z~>oH)ͦօ2T>-G[bv 6E9<5ƑU7U{/ȲUw.8/aRK rƆcExq"fAgu Tl(ԋ7KwN:OʕDQ@;oXZH6-̒*DAM4d ^fQ\,c!4;Iv@ _>|3B NG%j BS⛓J~5v{Ny@Ȕ=#Cѽޱ6YM-8P2 ݠu9c`Vo:'n[k₷-JukA^]DI!\SI@!3 5eݗk=ً@̾#'w1him'/iDvY[kS+{%/rnj)qoL^_v"kFD~CseD)!_#ƣt6 uj ='^%ƌ* p'iP1#0PphcN=A-HTSgsd?:mPl !t*%m[cC{lf `Dl;c{P #ل'A](3HhE鶭n`VYzןJ $(ygtQKh2ykg䘁 x{CQv;p9,l9n۶?O}9%M@NqTʙ9d;QΛa 3|ԣ UiT ^HDw݈"qEmUh5>4}bHnjS0|p B^JޤWSAv5H> 3Gҽ7٪E"efYH'^*B$ HscekkkNCwP+4)M'.N9K.BRKmlU}'q=ZڼE%#j I&J _2w6إ3owT~zZ>sACc^Pq-hf3ڬw-A%Q:=K?zmS|ɜ)$ P >(j!PߵNwX6Sq%cm_n?kGRKPD _$1\O6І]f?1;7>OEoʥP7h.;)3W]`}22ۋ9 nARVdtl71NK#g#}#^.4;K}!h8}; N_n6`;e9:Cfбq'+vz5BQANɺWZ[f~x?.$w׾vӈb%3 5 4uz/)+䨊Gvbi˥Vlcjb]&گ ,VGtwXMUe|5՟qy GTQ]:\jx)wOc91xXCU;YTzY^b$HXTN"]+›* O ytrc'k&-,wLj,qk J?І1+9,PjŭThs(UwgCQthZ˰*>B-_$$53q+0(C/+iX_(5;7oSRNଡ଼ Cmt'bb`nBd v 64^vTN~ԴAq.J{7+ 2`@";r)sZ=a{f:C^*7N*2-B˝q_No[c[)ׯ&#[('%Rl pFF_H0e *Uj=pkqfve5#HtiVf%؋P-xIݼɍ.' =֪C@as4#Xg&lK2 xf/8'iKL硩5''/(1R/ ojYdߺﻢO3ݧӇ"nm\-Z6ﯰl::L9KY?b)QװDk PDcgv=(wCUYu}za:0w6`f i(3j]J㑫 ~3G.Ik[/͉fAZn8?*X3O!H]pШ, DMmLox5uihM#'^G?}䯕'":Cdg+* LZ@"|t S 1ouȐ΁WfGNU=c~KlVsROoF7[ױB 6R]|ױ!\H õ!ƈ8243rXg.yS-ԠD6Ȏ0n8]#P|N:)2Cԣań 1<)0{1W,jaG}uj09XeW0X|G/](ˇ2TQJ״ysyϤQ$kzUX'+`bzT>b[a96xo~M@.t"FH5*2\d$ʠK Nh>N Bҗ= /&ҾǦt": Q[u%zB%,ISU9} q]cɵ:B6GT368&P]9.\Hpeչ/+P5ܦbLXnD"/?KU_-pJ|=bp&*-֗"X`jV`v Q; GXq&iu*ԅX&I?ɻWl8@\?+7YkԇeY\liMg0WeH+oM Жzx.X9o {n2{ܪ8WqAhchh$Ygs\ &LR`~Zgxq0 mu3vߘцE5; o(g3vE7<g\eg;#T82j/qVHXkL 7R-zt>G'+"m2d|џ3bPAMFH^`̝$wojG}kdE"+d@ Ӫ5&"ؿcΨe}q̅ -&)<&_.۵]`凘UX"k`өݐ YbXւX7:iB"SPfٌZ#3Já9Vlyx@PeY39S) l:8~WK:ގO3@=8M5c\1˙^xs}6%rSzR,),hl徔6vCaF 9_4)g6,Kox.BVBv PcwU5qgm]G L`}[l(xWcw|<^?Gu=+d*, d \e2𡄰6u\ڤT쮫'-vdwui,ʡ7]͗AB·/t.\HGYZ)kҷTUM6ޟOǐ򼠂DN-4g{-\Ls\iD7JYkd.ZK3uҀQsT}O)pj?s%[b鵜SRp^P,Zƞr0-[`LtiNvZw^TLɴx-xH#XYbVqMiztbtr QJTfљ2RZOMP;*M*6!{Nc;ZΑxS e?-hY1s[J̿hOa42w!!L}h6aј=;Dm};c~5},a'_:W~8.BfT醢8-%u:jz܊qQ0/,c %Tf.\9,Q7;HC ؂aՔLp+cw pix*n +r'l#gBǥ(ID4sMSڪfAqOgЌ(O.gӐ }ߟ2tOSƅQYxr9Pxs':MZä9$&A"ȭ&d1m1|AO**(!R`cGlJ8$ _ suSY1x HU/@R0ej{T7\5ѳƦcsM%OjT!CCV*fOս'։VD6xzX][V!u>K!nnsHͶ.%=bж1&IᶜL锝-88AZ{%aSY@zͅx<["zV;/_ɖ2,ԝ_p2N{1HGLM?We}*vߗ@v\okn1f[_ʌ-썂VFՉ]Xh6Б.M]hXŁ+st׭fvVEZ\us'͂:0ҁ `'% 9(v\QեaCl! ^+5tSNw:l =Ј ‚=5.* n $d|q7EZvw %A;#l<vU-%,IQ@mXqHSL 0MiЉ'C$:7`C"K{0/^Bxۓrju2~nۗqҵ n13ށr\eFHʌ,i~tA[<>U2QFy10L;7ĄRNwXkˊFu|!bj+e&NDz5Dz'q]CQ1T&u! &)ˆSԄp*=¹8 *@UYY{;§REtn@R$3U҆Yz9le߹#\񗚊 ME˥DMӜg܀13nwqX{eu-o&orE >/Q#*BqGGD@o ,!AaA粡F/{v M\cck͘1` Sg;Et%2 Fb`OI`ZN"Z(o(vt8{K kk˃ reZbGRfJ sGL$?U@/Y.^_%~k }O=X$\c,=,T,-S MYةTXp[,&Vk uRHD!|Լ48Y o{JPNI87іnaAօѱ,@V3W~aG%zҞGȉ {0 'FqSubtLg /H@԰=p7X$o+(1>?pdZFT6!n[)2Ye$P6aDbL/M윦7Dl T }@Aо&N@XեCb/3~H|euJ+&BLb[43c1jecY B${j1ڝW<(vρ34j-FkA5ӤYXpaZ<+(E~Vvnhd+Ǥ[d6vpde;ܽq,*GEN5!`}6DB r j}F Cxޗ?\'K7l:^,h2, #G5 S.ҮyFȓ>ߑO6`}F:IIo7\ySt޺w+)u۬jV-߇̮?W&vzFֿȰIKPóݍ5.qU:r5sGn^$%Դ 2ȁF8A9 FҢ9UD‘o_KNIЄ{2%WhaՇo@($kN^լi=KVD^OQ#ZҜEy +K Bcq]hwKј3%@87U5t-C^\5'*KAé:^W@>#`/ڑ?# !FpXLX8lзbhV@ -nk*ZjIRkb{__@4f:^lGIY{J_Lctlf}R<,pJ3M4o(wr w_w;U(\"L<7R Bz3s$_: F(/`fcugwGF%:S  ;l͞NihvWOp7~20lIKy? %/GRC0BLVy#u]ŌrRG9/AYp7RL֞^H?yoJt.zzbD,b#g)Q:6ܶl1~^T͚&+K_{ىtyeۢj;oB@7vx@M"SP{;vݙ(E ԌmZyA`ᣇeoT2Ϡ6nn94[4ަdetzeOv>lgیoԲSs dqu0Wp_b vaܦƄ$7Nzzv _>1f"]Vk#I5E]YF|Z^pVʼ^>i"ҍ+ܚZ3sqe{@o޹0(Eym!½uYνzgUkJj-֎ *J5I* +@:I@b_ΩQ@gޓ Ik_eqcF]dt(,<%R䭕a$ӓ$k5P!b_w9ramDj/ƃveWS5Mu_3Ώ0ې Y"C6[*_MMpaj$XGB%Ebqvc| mmg9Qfv34Z EP G((--[ ޿OO?|QYnϾ HLa+[5p `LJmo99RiV Uto -9TWM >lLOJi{Af7eȨ"5ݦH$wʒ^чe%/bʁw̾>XjۋXx<ɞ}W%|,Fp/VP}Gk(է*,މR_juezŁy)J{@/ yCDa),'~+ͳ̸-`6Rzo?6E?~k6|u҄׏R([gf\:Uͳk4zkvXa]77uɮ)̵;wˤ MN(ۗ3Y!lwÊ-zjULkqV/B[hW{3~NV$> |>U\Ev3Bn!٬Ԫ,M  [G/R2[$"mU"+r.~0gVS.@ DFRgT:]~M!A`X FԶLD?rgM2h;P%.I↻D2u7\lꯩ/8SmRڑ5ZQv$T5K#$<`Cp5d7Ƨu5MmhB fqsEv[6,I[ZrES9Q30%0,ll@ &F{v"9e>9t\坴AN@Gx\ v`G6L9*S3UՐ3Ȋk̚ɺ&喘'ci zJs4&ZdxߕVh%/YQ}NG{dX0Fo)[CC ՑTdfP+;cf#P8U\$cT 5vqjZX>p٤yFվ7ꍠ+zAl6@vQǽwOvo_TrUNՔܽ)G`TRG:}KY E7,[ ߉/_~~ˊ(CٺO}ٳ㕄 z%۸65 P{Ϟz3H['H\F(N1/6y.[v_ ծm`w҂oC |+jfDi-&@ьn{=g)@ȒL9=P [:J y0ϒwLy|T"(|oKσ:p{Uq>Rliαi~"Ƕ=T6X0#r@.ӣcVyF@8đ3+Al]|./<Ş 7J !*c63yLՏM@ *SAQYմf)>R̩jF^ v5Gn裹b5̹ lBGmw(ֆWzQs(eyCV^d<G+eihiր%S7ͬUK o1RQ_*3"Qu~CW`eMk/xqY8 Bx,8$&x4K O 2 aN|=6\Pj ^T43 KaA-\3h\=/)=cmyS_s8bb56;FS1ȱmB!*txV^ 7қbf"ԛ>%RwfJف>] V\q {:!MrkUQmAZH<CBAl,m QzZRI@U2ٝ<aJx>ĦPxs건@L?4Q~!KI-/یV Lu5!Wםbbs$%zy|6uROT~pA+XE<\X4(+}ּƘQvAv˴4؜_ I.+dfeSaGܸ_)_AY,/7i^ p;Ivy]:Y]6 HkrC"?禈{ȭG* uZ\! s`QDŒ5+άmjBuʱIcqDhԘ+H(m$!˷?ۗu.F[ҀEmQvk* <`;I5dDuICue'+,hVCEىc a6P]aի].z.CY~(T/̞"%h࿙7~v}ӯ| IӐ^1s-I@`1+:>t|4M/!كP"b處}brRFߧ?qnx:&V`|m'֌S=3ε9K@k{Ws'@RLn~9u jD|qqF*L%Y$HWKwЉ{CX,Ղ`fMC90%g"/}2JwcκR4Re̮_{\1/AjT,)P18ҁl?w/PoHLu25xiA>7߉jf6Y>"E_֚z:LR&Y//#_Sl"صu'ΔTeCt)y'X\U.OGuՎa@+@ݼ ` _ކ}IDF~$bm!y|Tfhwۈl5MY߆rV]A]MV2q=eh ΅TdtR'%Vfq=V;9YĘ"zT-8L㢂P>]+|-m LZ#AvDUxch\LtH%^Z ZPus{ױņ̹+iOAGcꕯS02z]$9eά[I0Iavd󭮣id PN)Ҵ8)F:qLJve;;&Ǎ?'M5,y;xr" ؝XD_û£24!in6)!@a[yE$Sݱ@ol-v0Tq͞AyLde hBioGZ "KQ.yfs "5NYf-fUO+ї5DɎPg[oа7bsպa"5ǀq:Fm+"gpDk|ꦧ#-~ہ1'vm"}Y,5pU;q{4~67F`(ZAQxWU#KEt3߈:!mmz^ʭӆ;P4& |綀 J?-uqp\< jpd-7Z8_} Lm$[IO_sPʙAoT @C)!qQ \%q*f95dQ}OKXb$3 ecDnd5b"߿9 { N|]gH2Bsڱmsj?ßpjW+L7o8mPoM qX[{ܠ/牘̇/'9=A!+=5GGWl7e3*g YE3ϟ!2SsUXEԏTD -@9_P.Nx~Rf>/e.MGۍ,oAp~[ rABç-1\|ȬwB8+n'LLU =~ C~nˣ2[ ! l>^tεӾԄ2Ufp6 3Dă6$rN1|(=&$NKơ r59طkh xva18!jDm~"k~ .7[>=àpQH_j[`b?R9;'q U$=+(k9ZDDշ7xq)DX琼{ Ҧoe8TvOQd1^0w[> ܙ7gFD1Zr |*5aYw_0aɰc /`@V 9 7ow>R̚=L8o#AyR _J!eE&S桥"S@o^<,l3Yi=+w e 6/?3+ fG4yh">5Zyp^m Z "nӼq RD[B6T+SlLkSK"al+}]ʧLࣗwkuSW߂R9SK;Oj兩PL iXXf F4+C$HP_A<wp /O0#PtqJ̜7i_Ak'4f {'.4hoTVuQk^v1Ro3T/fqb `Lf8AXDZZ,lg 2GJi?Wr`W jAmSuNtpﾉBA3|QL,.sCI#gge=5ܹ l&][&Fla N`!PI~ŽO"7v{ #xn}CyZ3yB2fT^6HN`6&tMq`tK:չ(O7b0y[B2,9ܕC e=Ch1Hyub!56;#ӟ+g*_A!fU9OOrQ䀹N[5amHˆ?&XpD/ATۭR1L{0 ;Z-돃6 ܭt]|l'"]E.E li5E9fE ?֠\rd>AILkw¯X :&zrNAE_fX}_f8#ru'^Rkf4Yj0:ɜI > .ӽV"lrk%d$s]\.rCq|3{-E] Y.FfX?ug> "EPď'W5R>}U#ՌY&!p5aJ)g呇31!q qC16:}O>MP[ ioU6g:m E}Ak0]Dp i9WNB9}[# ܽLdWiH-M@ bV\= #@<£Ff':hI]WQKk}[x[a.q*m#, ttH J264v״b"o}iOHN\Q\1$m !"# pW[TW\$`rɎow7*G5Ж>!3G K Fgv?_h . "|| Z 1n"p `Yܥ2[?͂RDX1j`b~J1~UcŢ͌˄f3NY 2 6=(ȁ!Eʎslh:<5x2˴Տ08&w30&_@1mMD!Dةd: v[@x*?ݛlXr▌5c|Єg͞E ԮŶ9v-I KT S(q>rI|Y#Tk+atK@Xnr2ߐ`oVmqCl?3%/ jb񹼛q/<+0nՁZ Dpf 4Gznr|&q+\^3Lާ$}RR u0> X2\' n^3ܫ6a4LE_Žٰ|ϯ'BhOaf{bWAS~Q|E%3:_3b?zǎ.a851 ػ3pRQ.@KrG"7f)FDBñc b{e4D$J4{ a7ˈc ~KYgd`5ڦAi.@rjFШg.:22+sOYF>,&*i}z: qL}_ Pe\,bcF~Ϸ[Qvq6`p"EoD_ bhZ !~/QO?iߟڄB`α i?|Y7qMߢ\;Iak?fo?{RHqDCq-H iĂ40USf<C98YhNؚhɁFp榤DG1 *oa.@ f*k7R#3N2b*o~f 7i3/OS]o.AR >)K=#Bʭ~-x:ծb s k@ū(QJzY7̮\UZ 85_E0d~dF0BM?5*5e$ז(3w4 %1Y is軵ݻ˽3>iuE+8 )8m]CJbKe4f;3=tgg`sBfܞ}rV{[\YVejVτQtc~n'V ,4Ѵ%Wda]4&#y:@_WФ֊иEM?~ngxj8V]'"LYH{ҏtQ"H1mSV :[ar2#$5Q/tZ[ R8S6"gIIU if36ꀛO,("0dd@^ #p RJq+nOPk4蹿U2 hkrmԭ+P; ςqM錹UT>C6:0oCd.{̕-T=H!RcŖj Ni0MvI'D!lU}Vڰ:]ᄒpsINd]G5S Jf~zIbXá mij҆y>o%&hܺTrxK5@i5%|dX8}cI;k6!!5~Kò+45RrHtm z P[Zg ;ݧ&h'6Y{lXZd,(6ݫpʮCv kӏ?\b΃Lb]^B-З07cmŤ\@3'3 :@3 zR#&m ;a> rL༎NaD+ebhbӵ(o\oE"M^bU1dĬ3QgRH=Az\p/J nYS8I;3Ə0 ^V>bN_D9;/b.^0/Vߙq{ߟxU&uD>_zxKif5G: ?< ,_YSҫ`M_HD x` [v=tg+{#Г. x io' *U)Fjw]\ Uω.gU[kr] 0-G]osaQh!uUS@OgjOD$k7 {m̸jRRS9X KTSuՒU`I z O+B>*NFxu&A:C󠎸T}e̢m # ae+X$ڎ<x-.NswkrJ[B/*8Uaw$C9LQ~}T9=cv ٝ(~ -rQD#qT;W3-/Ckݙ0oR_XDԟ11", [n<7؜IB<'?-S,J_2q)}wۃvcftzzWG9/xw`>f3Bi]x&813#(?&gQ*LYX/%d+BM.LV~PXgz,Jl)`.5OR ƈ?}FO_F+Vڑ>ߠ) `P0!!WyCS[˶@+=魈.(?g@DWxmbrs<З9/)ɭWYK9_綦y5S!lVj?-^d+)2bU-i*D ֨y*$dM -J][9jv%ۘ{4/JR!ϋjt~ĵQ f=GV`JB?N@IE㱏y@xrKIm2d7&6o 1κa,ѤzȕB71KzM,#}Ƹtյa@YtDv@vs6U3:-+j%IXap~.>eN ]6)6 P^j+τl7./ /r)3rz H |* /0WoJڲ>#‡YJfkou2yzb/4[|E `yObam;|wu7-l7Csg õ SlhHǿr@70=*&Ci6,s\+QBa(#$IzU`NcZ=AW¶"-^UU:`-18 ' ~@MXo EdgQh<' H@7e}y' p9hOMW_#M[V{i '&RKٕTͫ(. )|BF0`X|tU Y }W?rYGiʔ|6\Ӿڙk\vph-IͥZ+bm!_]&fWML]5R,+>P[Iӂ`!h5qPTub9!=HctIAѷm_cs^iQg& eJѕGgzԖl7Ґ?x$$2J ,gKV3졔g|ڡ'jBj{[z2U]A2"qbax̿E_w;hqtw|/27j#Ѭ 7z*X%֔F%^pD(Mf yM irj-ϫ'bSl%Y Gs|jsŕEK7 # %_LQ#)I3EїB. Yn pTem^C3hw L/CL{R_s:ñf͐#jrr3mIߑ%SG-Dʆ]Si4D B%")n&}eKŧW]'5!EX_=vAԏG3p[s-4!{xm3^$voDh~㔂ddBcEss_1¾&oTMrUI#IL} 8؛ Yd]\H\GtVNl3Ј*/!{g8me%Le$ QiyEul0ͬ^!Ea0ۙH9Y 7/F"2mU1@`jtT~gx\ l"a]o~dmn'Jc$G{ZWm  Oqhʞf~KLJ9f+,8U9c1~AX.sRU5>?= lz+MDHv"AD'PlyG-o`@F\!ʂ_uv\82,ށMk.}ʋ0ټH R;K'Oo|dmUljoV9!K= 9F FF1pa$=$i(Zp0t-.1w (~T /̽㪯=/9l׈S/֥޸Ny_I"]W%.e> (qVܟꘑsg/yG!p@՝B -~B|o&w,X KK0)hk 2;zM&|r$+R&f\@bDZ J.p,(WN%ӎNUg TUVD o U3Iˀt3p#t2ukA{|Nca94t?$ES-X滋 rDZK v:AfRV/r\'0ps:(VxR2מN#?{83gcd^8٧7ϳukm]{e-݆'`#Enxd7 ";Kû"~֧tmt>X|-^ S;#gM1=Ѵ.6T\>Ǒm6z'ZQ;UD\B3[KPPMOXWt %|L3yȬަ?]^tNUmڒ24z' rPҳ#,yb E&eV7[ɯ}E{]5^ߏ*:*zUCypAe|h_*&,ŚRvtV銀Y@dyea'aP`VV\V5PBx,ۦ'ҬT$z!.v\ NӺ۹@s21Cm %d.SuD}ɼh_ ,%LBFcGQAOp"i/I YUj#PlhMȿ&wɰܽ?Kѵ=yi{ t"ODC瀹AF?]byJL_eB ꢫLZ$A={ 'cs"= ט_SV8w gndǘZZgn a'W,yDr+V'/J+ߛ⑃(M}/Vxu$*["O@o;K3铊0%|ɫ^uޑw# ߐ\tJ'0bmoT^]S F9뙵H6;08̋As vd L15wEܿjB,kT x0VΝl]yW=[vʲX;WĊ\mH$֖ois8){-"F,Q|2kbi&" K jXϽh͍8ƎR$9L5ExjĊ:y#% :lU?V, J10H.mr!|p`D:15q.t}RZ8,.7-4`Zp?޹OE]fp..{_uOD^*Ҕauܹ}j vE.pNqsP>.(P* t<+/4e45>Uu-xe#V% ,N%,l*<w{MCk?qg8f"&&n%9zPN`O.(%s֩I$C7dU=ֳb.MtC~mk'n(%/;am`2 CǏac&E'Mi!io dLKE$I&D.Xx(82+=N=;k)º6mtbw荡S^ٖy"5邲EBfOe ed%Cт{!K5¸._=5' a.LgOAS;.ehk/ s amna(51% ֳah`cI b+"Ȋ6{}Gf-K q:75JTJSW>)H3KYPﮣHbghĪךk&Gn2}D~Y:qh$oWT&o'k}ړ#s{C>ä\@`NMlgWpդcn:@;+r-ݝ5wuTER+ӦPUwPQe&L㜺z{D,qy)۵"lӵZKtiǚjjr?ûЅ?}5М7`N4" 'S%o!NQ@v$asO仃Ih/E |"HvAuz'+A:[DWhÖdVt5oHdSā`ԒNUߢEX$pW(\D#o1V V@ 1?%Z1GCmtE:%bۤ~(J6PR03SI7~,xx҃ah; ?w iwWBrg# EO=]l/Zm /MAA '咥ѶKhF\Ӕߒ$!Rfv44ٵV Y2s<÷A3;=tJ:ks5GIwFv q%pDdv뽽vuyr q1,犺<㐬e_ЮҮoJ_L>),+9% :gw$ E?`'0/1v#He4/`z?B_6fBqzb'#YkMٮ_n LD1p1$ɥIHqp~S EWigl3I蜝b8d6+SyWɩ_. GKӱUy'f,%y!kL 2gM@?4 廁 $zb]n21{,h:vɔN`?vG0K*KL"E XJS5!!3ɃIy8~޹ 6jǰ?H5I5\4zG>W@4(w)Rw" fN1:>ҖKL@ُ>곲kDك?6m\76Qуf 6ZhEJ9D>׆3 ^$J561s{/;;,H8&!+0⧆ 730b}|qwg.hUb %_EdzTDϜlo umh+O. ;Dtk|LeEVwz3ޘp|$tӖ=N|Zou}DokorA@l!>䢑M Gk;ܟ_M]k~͔ }/+^ptn>;yM^+oER]9\[^2̰gg;p([[)!bӊ1ڟ]Pu d$E(:zN|=X{8T& O _9m$QlX9U(8\;%lq&Z$/4|]*5OI314--vWOG4j\۞[#gYyVklfi\[iM!Cyxп>3˅n'9RN9藍 o83z%:zwA„`zA6B!GI_bF~G.m iɁXrtJ-a2'xy U8XʫNѥ۝giwMY3z+KXm[4s r^O"  'X /21%I)~0PtFOzI}8 zg$KFފ]4%qA9(u[EWMD_u1nlʍ3(Vǟ++%Iy Q1!d'WX& pnp.A> D9ŝߦ,]x op^P_Glpd%i#$f.]#xWz3؉u [G NH0W).ǎI@-Uo>E2Ѝ13p6a/jnv35VU(Ȼ䆇aM\6,b8SȔ2&8fi. >߻aYO-ްb8_ I+i?54>~|]Hˋv7/uF>MTKSOl%ݚ0{|!VbZ^z/wc|&u7cOxP9Y VQnu7 RfNmb^S.$BVm6 ]7F'q?ByM;*#kג<ՅWC:\i`sätkTF k(ت-=^7;jLeWpc!)г}d@Jqgs6cD[Kߣǒ:F? M 陓4$x-dwW++pcqn#Na`ΎM[/~:x;/ K&D כ]3D 'Eq}P PۢmCE*s$Z VTqjQj݅S"\mf'VpٌBiRhj̔!yejljvZc$PnOȚv(;koR qH!53EȻ;Eû*$S}n݂jHHK$6t .,J専;B;sLYYHgj~kР_#HW _血zLmifS"kR?>eU;+UJ*a,HvɩӢT}?H"^|zV˺.pFO=ЀTfk&jᛙs5cٯ M'-z­6 ]m_v -Y1}- dpT𪽛 V6DԿAg)} W/YR!IT>ȖrzM.6t||+b?j\Hj;@8t8E)"(9LJOQDB^U_rl>N-y 9v6n2*@̙G%q^= ?k=9esX/\.eLMKS7E+K-yc>!9t{A:U)4hKH*#w(PGBa2p$5wTq݀]*":^lW-ޏaΎd>"in#䈣ʍŰa޷ʀHH=CjT٫5uUtVx C9o@f]lVƃa=ro{lEB xjiP?6iD`nȴb;JL!{ f[@X׆[q#Q +*fO~|Z;RM8ph2M?Jo_"ك튱Y.Ǿ~D1*.p`_ quBLW%> CP`8}s_C//2b)9񾲅dB \s>)0 TȂ`x"pwm.3l-2ׅqN)đpO%$ P\aI|9K@/<.lҏlI_c V jo})9Wv0/Ļm+\Gk5¨ZoܔmlY2*p˲!P95{")kA-W"`9)iU󂣏8>EgnEiajƌ+q"˲ORS(O _DrHf{}ؕ6%*z oI /<4vm4qY5YxԮ|P/oۘ%oU@Z׆N_^>&M +1̵sy(enȑ_S/ R.$;Lf0Bڑɔ (Z/̉ @q",&==>JukXuhvFIww'FHzESX܏\0)vey-:?J(GC ,xCȧ2=-ARdeT.9qq;ma{Iwv%[iKĬ;6 ӤLXxT+֡p~c!ڭ"}u[&UCcHDF:vavYeMb⢾~I1f}C;cWp-*Mw|w)5+3K8zzQDKʜ9I]Ǣ;+<1 КTEBz؍DC?sn5,,{˿Brnc{J.Z,{:2MvqF"kP%;"L 4* 6CV#4ݛw:Ev->p{hȊA>ޛ)Jc{ pb1Wc d|QεW~[v: VͽZ`}bؼP1,~|pe{IvtqH_}4ؿA3DEqVn[Mz yM5of/"C|!:PLARoP#>ByS)D+܈ 8[L0] ^ AI@(J0qO@5lG(W`Wp5YA%PGeDW#v*M>urI !4YP#/U\:@M dVץ俍ᰬ7ҮG:dRg7Rg3cS#Vz7ix}*/G{7wl{Fjc6y6 ӱhRū$f ?vx7AJo.zl(uc oԫLju>lq֡JyOL{_7u<&Ĺh&MZc[n3'[ o m(X5rzqhU\7b67_1x,9G:b;6t?֠Ĕ $/spOw4$ "Bu֘QD.P ?:{;j5/m%"-'r?IT!mϽQH*84qT!!H&I=1i?T`| 7*QyY7ҷmBr(?*xYq>/rsU9QΤ/}::|X =/A.9j?ESbrO@$8R#TAtѿga;U? @⣂6*]^ 6'OqlӧlbzUՅH0Uell~qe kzH"AKpǕ GluHtȼ iz>1h!LjBPf/s~{j[ ,A2_9R#^T-Z7(oH}<256#ՅuɌ{ ¸G, !-]`v6Jj$m5K񗜌v7F&EO\nP6L!(ۑ#]uAHjd-.gCB:/g>̤iO#8x֌6zȸ`02aDĺQ#-Umݡס1w2s#J=՟-'jp3&xԘIWF!Ě5bHgFPݗ@.N?;Qwr6tR !de]0$cA+-G :0D۸=||iƟēcȒցo `tǐsLΥ*-~LXy=L{9ei:Uq[/k-^z>h6>y6=O3D4 8"k:w`9^1%ߺ 3+y>ƴwґÉks{wD׹vdDi-%/tOmAy,{_?"[lԓZ)i.Q>Td_:>na'N;.jhj}6R7x9/5mסl'Ku?}{}zGc-DŰBfp: GYm֚ 6&."]SOTH'd~OLC|QxD[瓦u# u"  V̵x/,kǙ Hل n۝WhR,DBDyfLr@Ǜ܃aMҽ Nr I]7C2mf 6nuN)#1d/CὈ!J}I3pdP(<:)tk^1[~ mW/"fHO׃,ʑYPFվFӧemֻjik "d_`޹snHpi0s W=52vk2@#5"Qp #d/m騡[*ָH0/0.T5ItQ߇dnӛ~QݤmO6SUu}!r߂tZ7A9w%Cd?Sߒi:~܏:J0E9-_Xlv $tkR;IC'iuU& U$9*ۻrֱ<]@,L{DIw\_}>˧ )s53QZHIEqe2҈F9ue≮G;AE,pP952{*r[?%ucB(*󊈫]`QNOM[oOuTSR{&)B:-amEJqhL4!zmfQ jƅ 92Tm{iUXht1Yi Y* (] ΏP bn=97YBջ&X8ߌs)"lmI;KT̈Pp@[pЄnv+0 mQ+@ ׊:rxhJH< kt\iS\$"nt\Lb;8<#g *3B7mr;oH zYydTaII}ru ]80m&OP':Bl 8:r7xlO;pXVbqfͫ$hg]Wy0]ayW^%ͫ"&i4k'1콘6f7gbIe7)ྩH_F7t0($m.MN=?񉯴~ّl<{K3:C 7d%d CD8j[o*¿uOU0z6욚Jv!'+TZ@:aRK('^>(B*JCZsfUX7e6 vk:oKG9'HD-g+lϠtɬ%N@@д L8̈L;1oKL^+*m|zIaYO,C/=TyVtZ#q'$~-G^2 .GE;څk9> X0ub poevEC)"|'Z. [3*ղ@-#t YZl487pc-w ~ʟbͲQƹjsPqa3.ee^!_+dL=Mݠ z0P{r^N_0],k%p aٛ}RXဴˈ n\"BI5EyPȢA(tM[}C f8N8- ?__8)N٤+J<( ..ё&imVϽ=39@٦6޲(`a(soB܏0Ha1ȹIR] :_p_zTZqU(bGtqA!^u ?j/:Qq&I)t#dWZnZ5 QD}'b8Myk 0a#(dz8i餖6MIx?ژm<4bOnҨI6YdHw`qBwD-#;Μ(eh{ z@~v&֥lš w8HyNXIy'(񑖸/R ONDx4%]CHJb e~;.9;L++7?NH>^i]HE?.lw_)O M5f~eWXUKZJS #0N70LdB*j[D Ş X!l~5݈P?Exa&"cdK&SV]Gw/]8Q|?47mO ASDEL_sBQ֣|Uצ`}ݸstf=ÄNEd}m$-[ͤ@Q'ԹoN ܘKV*T4W>i>nȚzf6] ,=͹f}Qέ*ss M&&K9Җ5v@q`2 [Նm})f%G1 5Jz ?e ])ьux.Oy[F "gf10 Q5I*yIF~pL= pU|XLdI\͜Eφ"&SW8y3j{#rR;z0:}q0<߽G7KCJZ T.?NZs_D`Wg0PژNTcV{EDB- ('7ϙo,jgF'ʍX^LawFDZڨX@TΉ.bw :blCW4k_  s7(<{/(p7]:d3؈SX_6;Q;/آz՚(kLw֚7}^ 0&6l_a.c Bw\xp|Ei{|ιR?YEr|!"ue8tSe2ҔbX™k4h6W{=nȾ+xlB戙'Yόk_dt/8c#"=e U# #Ots+':uaM5]݃z ӱ]ӊ_mɜi[m?*aX0BaLN"imӻTeQsZ [zO39$E[ u0?.}9}.D թޗ!>Il*>Fjl?"i~)۴nk R-q@yMz2Ph(`P/A;)e=v"8|˻M¬y ITLQ+1_?ݽR?5̖] [ AUU\!ϿVGؽ "Ok i_iLRYa4_Xncw<4H/қoJԱ&\_3>aQ18{P'N ۽)VxphR l"oݍ,H?c$LNV$iwG+7H/tAI %9 7"$*!SH4'=7C 'l:BGP/=ōr=b6g0(#@*"^8#ԃ%50)o yGZ'pTԥBrp2z2Q KіrF2%mWICwvWȪ=o +h7xmka$AIFL!eZWb })a]C&!/NSn;kŬO}`UVA:o}Lކ|jPꄑL=jc gCXDUb +-^do{eg`(4l |E3i˱@a[G31yK.Q nDNxa~[ n&*C4bt{?p& B 4hl`.Hr (t |R#fvšv =7=,+n,xd5br1[DӤmae=8blQ"r<⪴::THqb Vq*`Rֲedƈ8a5bG N. 3?";Vݐw#QWr& f6(= a|}F6|ē*,{j|+)mFVY'!ħk2Gi,ŕAȨي.BvZ`YRӮk Y1?<3kے :吭:5WNri,*v~hX1i:(KI5̗-rT ~ QWN\Bnc ڐͭUOз}ʨ}l'j.CSx9x(utsn˚%5 &!Ge m`~F|bdf;DRjk.4m;bo:͖D.( jdɘ˲abΊhzaqv.!#/k~{{~ӂ fxfBKm|>d.Gb}OUyJ$[b4YQl>>'~z%+bFUC:(tZ}zd;b%A6EJD(Ø|-?sTA¶/&Bz.D厵8mT$"/F{a46¥ tXC:A̐T.MlIm"wEY -b,[lr_ZL`l N &=rkU+gvw&MќvsMźrLV `‹9=H\2@QNQ#KALwY"ըŤpFr(pn.˫>iT+ѯ6own\2Hˆe+i35mJH|B’n엁 1J#A4s҈+gx#h<|8(rOS7׉i{(jr$t'm,PrA# ѾzU ?j12xiM2*4%FO(N'"<8"G85z0 6S|4%pMИBj`QӌruPqM X|u sBlYq@A6:TaZʹ<QӜUyOB`| 0`} Rm,;}ƝmSDzm^x.);O<ɕ:\ȄtsC#M@X2QHթ :!l c,-ޝ&j1 b],t>@YT_ sAnZ#DXtGZB^$Ybne4L9:tuŚQxZ?e&sdOӞcV@谚 ;4,U[ ,xfغ<3i?:./@dU R P?H<3eOs*<⃢+7)Q j>AXԹވ^qmm ur"X) Dbh @&;AcsA dyڦoR$Ր{U?5*e H fL)_ Xr00vlOz#`b c(Oz []!km$4sc6cżJz?}M#C:ZM2B-Mxs04CI֦ܔ{?UIxvw.QGdLt1B=r"t n,oP f >5kC?Nϥ?SEx_О?R/>V˄lgwKSikhgU)(۹1T!A-Z%u 3ָcVH +0T8!]{PMjAk+RucFZAIŘ ] WmMay"ʏk Oc5׫~ݻRsjoH_IMHU= vrg}@#rC++aM[)^fP) CxH6U\^7lɵB\XE;{Is:E@+H2ßF -\)BU$4Ƴ`֗nq@vYA$/Mu̻T8 ^ 4J[flF.R[Bh #0Cov?i .Q'|(x0IӒui6 º~pbfv>;oZ1a M (Vm-J6) ݆1Bd>m1c&Q4ptX$s/iP[ `V2 b~&oONjǺ7B8X*2fҘ2ěޟ X Ut֫U -V't؞g찍usotwNBa5vEJqeB9ڏ,)k]!o>fx?D3*ǧH adF(Y ?7ܭV,A)}}wgqHH&A4(х1#&)=rB?H_,56b߶kk;1NtBhJz X[DýsrOi5ЩѺѡ:?Uѫq; ] &8TjdIQ&=Lv 0LÄ@Áu9%ZZ&aXz֫٫3Ƕc L)R~ĸ$:$ n>~Ci[L <, ^6g]vϙ?7W^w>ք[N5#xe` F/[to+xi>[L4EߝG*C[4;EE SChvnUqz AqO8~#g˞.鿍-SkL1P VUl5{+B [wMX{k*thMw1n ܵ+F@Z ym4U$%߫3 ,S¾4L'\f 3K9crO*2~{ nVd>-),=6i?{w0z|#IlN8b]uclr2x=v..l\P_yiYtǃ-2#&b┛K;cBL%Tq/~]=#2%ch1ߘ}77KCtڢ"_ *3Gfs쳳R}U+kl' -vl$3yFMooΗu$gD 0!G~s>c{x!YOc_W 6).O ,5+0NPj,*R%ݤIEζd3 %(!!#`ha5̱=qq|8 N%I2ڪY\Ѐ){<?uEZs Z٘AM+ Nzx Ϡ;:hT+F/qRlβ;' :hy$BѷeXH.U'ɹݫ$e8䊆_CIʓ,5W'shjAZӶr_%xW~n_=1N--%xDIDl@t *`#n.D7i0G .d #算lI\d9E:+ fȧo!PA9QQ+7|5 MXѷw (x{{/4" ?V+?٧!S'UWILBmŃ7ʗmWPy<4?*)ȥ)jEF(n/X"w mܥćxL ipap##jWxW_GR#EH;&"M'LY/Q^^Uh=0L̖5/D/5_neBPfۭrHhr P&yR #YPŁ(1"a?*Ԑᐋb}n*ž8 fgMi991 #NZa{!K>$=f.j,uy=i`%9`<>2xޓ .KcʯƱsyrMSTIu /yF$ gJɮղvRvQ |*ʒ qR=h䲥jv)>:7;_q7^Fh.Ix%8(7y-D1>J'ֳԱ*tV8/YNLrrL-;o@ t4TX4&-v2,CsnSjypEo(SA s&%ݖ6Ƃ/4!KZ z$ʦ#(ַjwSHdQCˮS]ɔ}lKks&W-%Yۻa$=N]P$ PځRԕ:<h(Hg< ûJ5Ppm@eഒ>hG|@o5 }Lu8b{z|TNAk $P/#>|s{F)m0'ͥ]E:Nviǎ`Sh<δderxV]u6 ͠"9!BQ"4Ùuc}$xF!u/rnh~}UdjZ܇~*OQ!J0T<5:hVWp{D,doy[͙< d:gSH((P{.|dYl= 0}) o3˛e7.F$-%vJLhFx| ?_ΰʹ┚ U|b%K&Jj `Veě a![rS~Ԣl~G"0dStK7=f8I_Plo$3[ow|c2eJMNbG0☲^`Aȹ"ȾUZѕ( \]4QbP4 o?R Xʇ0WT*}a2 Ћ˓ xC0j_1u5Q*b}Rms 2J߱$Omnx1yw@ʇ~7(Ks^e UFTVEhpdXGFʍbDr~JђL@QTWJ#!KYV,r"$ o<27t@wr# ³}7|]R {Z)Y[jn60gLc A;aНQ^;HػbgVs/I$}>Nq2:xL&Q>&#+q-I`A7U:D9ҨpF#dK1`Z[IK8'#ul2F=V5iV˲=Oh΋-jxAcgۇ^輥DOy?rc["K+Y8^{' ,] Vl(s#_._K855ų'y|Pe?"gCCr<O17b}ݰ8A~æQ@y[Bj;1NT\jySReܝKoN(FGƾO,L]̶#HhN?.7lTQ[U/ h 6x/X'*nKɤݯWsX`+qiaRѴ?T7ļ炜KT|+xʖ%-NYRjl"#z5_TQRgj/6h>/*k΁deO6y{A \Qmf*Ҙfv>ȉjnq_PS:R&" s}y鿐$Ffi`y޳nb[4iE|,R8X^ 9!C'uFH 5q% CJ㩽X*d6Ä/% #4Nx :侟*rgTH)9u7`0'g-pAF$O8虬{-ֲDtȷM/oSh;V] %68td=if`z|.p{KZv]0P2]8Z@6c~3q VUyJwO<Ǯv(678AH߇25+Нs|}ms8}$}8\z 0#.1Yfo5=2^ZWLt3 EI0"_OBLqO Yȴ!A&8I6`l=$EgJ/O_ˈhέ?N&Q߆+<ߛ]CD~c2j:s`&-hPثRPn(z-Dx]BOS RsqF5jOr1n2?%C'| Wcˆx},LʉcvR ]'i蚙EӕH{.Zjdd6켱4=aν#=f/<^)u䒄Ur\&dǞ2}/=O^mĨlw ,5zT ءXW"CڇЅ ټe+q$ c.\Ɋ޴!UϨ;#oWuB߷|} 2E@ o(PZToqkg!Sy|-EK%u#]ZZxBNe#3bF˙3&4s<* kjd5of9wd/ Ğo uiՒR-{玩iڕGj‰YԵNu{͟+y-"D.zjz,?ʹbQJa- d;v+Hy[`EEI/t׍Fma|wk=R~\#yn]6>$=\^c\r&P+E!$ ePEIcϖŭZeё˶TIeڦ6{W׶InSQڙټa{%L3PD逯](P2#.Wb!,V@tCkbPXͥ&[Q1Y67X~42TUI2eg_fy藌3cόeL\87d"!IѵN+bנ#BT A12ƅ5/܁w.m[`K[`|fG 6U^_?|(T`Q6`ٹs%4Lv:T_`LLU~ȗ0D6l|=a) .ǀtῲLb8H_f#SooA췹)?tg,k)zvd&T~M5C/l?*팆8WzOǜώ:cIປGM'I#ћSWO& OVצKQ&Bn^H@9 V[Y޽ ^`ș[@8)l ئ gSv:{ݗO]ǨoJ<ڶ(z~s_~҉j) )OZToq J73&'00e * ͳ4$2|M 4SA5$E fQh Yj \d7CFMrdGZտR^6p{{/ƤE\5txوɘٝK"Mpz8|\r `?\5e@9***(^gG0ȋMR\[G8ty""87 bN/"1+ R~y[]{9y/R"Aˑ@s\A@8;H(<}1"JF5kyߘnٙjv4v;3$~|*̀Ou  ԖȆwL(CIE u!զˍ9heq( )g%+5vtC44 7ıPT{+bL6x"E^^'sqvL{ŗlAʖM7ͦP3|FC7(RH)"0y^.FIFG-e{CbMmmޔdú"ACx"=Vh)nrrc\ ВUW_[C]%?ߋMnʧ'9rۅQkfI=^b#YPdˆ}on4)"Ranι?DD>1n.ƛUF>1̕Im <̼gpP֒E3 I^7?eVW 4dó!MCVA]±#*T @䗐@0~΍)U HPJt1KZs<]_١V!g*^AU:g;jdYk [>?.i+> M_}--r}E?*uK ,yTY/L?hHCXt="SVOٛ뗩qv.7M"?q\ \FS C@SGzYM3X_P VdQ ;[P#aPkK`!%BեOsfa{%.;"K7B<&&VFDCB=Q=?e³) ⭇ M2Lq2W!DHڞAg9iՔ>xG&ͯON١NO =-V!0]ua9 Qs?x)%&[NǼ W|˂*T05p.LfdoW>wBwʜD A5Ґv;w {L+Ӧ(ilu)TE l8Tg9y+İogY,yIG >Ğ@U]ɯI64Lr4ph2I9+_\tI3NO'6x'[,϶T_BP 1nЖ"0=L+gx7j}bnܤ5 {z#֋î\am|YCRЮe>[bʫa\+}柤G?Bg0,qͺ򖑀TХ1U%Otܑ=/~:#E{b|K+XgF:bҽ.y(f N 2(r.L ;R`4ob@[ @bmYH@(xs%>w\x>ڻ*[3*pğy>;!:||8?*/*3&EH)Q)Wp(\y)Mdƻk̴;cN۩&U b\N" I$l +0VvG$DZWR4HaB8p]6!Kv}Wt#ݥSdwּ)@#γoL#:f@7y0mqYhh!HS$1{$)",Eɟma KV+[3iB#ѺV}Gmҭ#NvT6j9 #MMzTs9Fe Oj,4WyJy1|$}cMTUxQIr_@ϵFg-Don}Zo{RD ij&U7pܓeN~m[,Ke OFx+,)9s 4)$iDWt PiO+FXN[Tz<< edO’)2ws5m"j*kJz5'ԯ4ǝM%͵< Eʅɂ1'BxuM4jEEwݸhg:5?SZI7lȭ|j@N6/.ͷNEͤE+ƕ}x&HNR|A7{X xSw8$B3s}|-}fAA; "ԃc?'FQ]D'z+ ׳L9nz?dJA;;&hƙHK@DBS;a[ @?;"קu.\t&W2}hx×@ֳZ>S5 >('ख़0F)n8 h][\@tt탰vK0N|+^o Rbˊ_>h25qlSF2B&榣h'R&[QX #TT/r\Y'I[0臛` ] gƯТpcQD8^P90 rk3 MMN8}=dhrZ?ToJ`wEf9^<  C1%)' ~zcd@| L/R\I'zu1 81< 0,5A:yvQUj)vAt*2 !j=|bDB)W /C 1SNA.!'>|oe3Z'EM,/YFuM q=}9 7Cغ| _}L_hM.Aj(H`O0wU>Qbf)<Ȱ4Bu@5e—YS IAiVD;Ju:zE> v6$*;/g _|}I]&RƮ'@WyMk0 ~"~[` ھgOCE̸9_kZ~0*Eaw0}쏣M /?嬓>4aaI7l&1{As!2T:b}-Smnl㵤!Jդc4012y ;4;$[ÿfA oUL3;V9O~k#4 -#j,!Sf7#̜}U 焪  5*b #b^g}tY~!ğ0vK}g>m>61Dɮ.䠹ˬ2w\{T:su>TKqWfr)M`Ÿ؎&0--t>?'ɷ"OTC,S=r.lhґz՗D @#$V=nb1e0Z9IaǖC쒍Dlٛ0kɴyWqV ]îA'yD5с;5VEݝ6Fz󦦜< Oˮ - n|KrڀE݋vMJE%Ek]}{so,y7x_%?,($X3EޥNȂ9j'ŋrd'ܢ.s0TX~#PGMzhcI]B_@=1MW$sч痧֓5WK=3MO/ĆjrjcFNl78ğF;b7dSVŹ*N-' ,ӏes)_^~.Y^J~q]їS;dSK_3,G|Oau1Es(|S6UVbTO6k4jVfCx$1' hPl\'Z|j #fy0ȌD+zJAȴj:U.ehyW:Ӯ}BmBa (?f8|pu.kyqoc H1sœ+,J xL3V'YLb4S?WxH7EzjLwg/b.Ե-hj">*+tg r#kc`[h tQLQUi@ ^C5]}t5g dÒ UiZiZdAګE”J_uԥ&˫Ûiω'd8HRQdof t;_q<8AFoNGoͮ6ӱ uHFT`;@>`)(<ʼČ4Va{Ń"^?tq*?!k02^Z tWJ͜FPGSȹ}o#'|cjËsE{u/e 5\J6Sڛ ;OO &;B3SOED=92'>#@YG~9nAQ.% "vQ]rUtG #hbLQ?D,Y< ;*(23?eQ8Ь[ߜ!␿_aT@ritW@?X%sayhoV[so &~ey ZYSl8PxUVǫrl@.{:乔CbLO{Ujw8T2khtlUZE\ZP| _o 2Y$ZeV--jwpaJƷF-,x4Ctꐖ2"_ZO0Wom[%>k^;`:BFس{h+QOD:L0cgL6X7ih7GjR"io& ̃W|wFKlzGVUpA&HDbn*rHg+7(M49pNH_:NDKaUy(?IɢG\[^.OR4K x؍Lb!L XTS<0VurͲuiꏜz-!,MB;>h)S |O~c}|" X$b0mFՆ6<(Fm:גz D+%Jy8Yx,o6-prjyn:4Kot5%IZ)p\Ӷ3bHUڽ/m? }\g}Tl=6X칫62C]c[S("+zLxOb~%<7~cXUuF',G*GBCpd[CyGl$EjT AHFQ{&(:6>'K W'- ;iN`*(aRN#-?2T| (P7Ck9x]^qj ~q3V<`[;dxr?R0/tg?4I6UjfӅt%枌5ݏR(i>eOLR [\gt&(Xt$(=uyw#ϥk}$R!n 6QX.:"YKΨ \NYw\X%w\q6TLx@ {wUWOKAK`Iw|T楱(k P Ge'> +n؄,(Kml̲K[8q|?d kڎfɼNVBŷlB6hTXQ ZM25!-Pߚ*ik:"JJO܏ ᘩ1_e{3 Bz;yFg'5UB^Y3Crk?&z5ִ' JY@cn6ܒ1`XA## VɟD x GVG q,k/$>(  $I}?O^KVa~Q xĥ?́'։Aɥc& &D}Q @U1o (zЕ٢o (RzӃឞI1,  )iSb[;;6zB.E$'@m)z1ѬYKmbVUXam435A^ės&ϷgQ/w@;T8 Y#x칪bF -&JF`oBxsأtOfb$ NA\{ӅasGrmZ甔z@=ŕ)0r7"^,]~yb3ZQJ MHx͆Y%0yRQV:QU$!@Letŋq1)H}r)-+^p*N-3p)$8)d7}G@ʈH9$jf=J>ZAT,r,iz[s6̄C$V^3,J<^mvkWwi *&^w@UMe<1b:O|Ж&KB*VKvABMgX0},Gj#Scn[(@J0I(c>ǙAh'͌NűNv8*OVQ*U1m U Hr$hIf^ -M848Io#mtxP`5&n"6^RHIώkpJ.7pe2MNqCaEU(t{֔)1{T"F,ϖZКoGGIҽd,°kg2b8}y'z l<z,_yU-(<4:V8Lj @YU dAh  VXp舨w1-ݰ4 "s2 ^<5“=͕6gq :üE#O(KV{n)3K&i8#_ֶAkI C%a=4/#D`I,{{h49*ؒYX4!LY4ڒ*"ISQU9}~k%-1T)Wb@ݓ挎5 LR_KOFvYZL~ooq{P`kݰp'pYT/7v̡9-·ZHk#$=f 9#P0YI)|JcE~/9/W@!'ShB),Df֎dYf{aqWGCI \TD4ٟv?o‹!) 8%RWeG>k=3TG2'qA8:[ٻ㙔CfUn!BeM3#[X5X9bR 9q)vލ롏)Cd2^lDqR;l t@DF*܏A%"*UD?h"gp䆯Η,|94A!4];K_~/!cHv@Avc8Viϱ== `$S}1}&K6EeJmOnԗI.ךx'ّȜrbt@hsiO拀bE)]7p`Z"h)ڣb7ȊmTo ӽ|y"]άJyc[|UL,Jwv3='5eT{~6V/8n'f0ɍy~?O-7Tθۉ/vdaϞo6#*~WzQ9as[/KpY׭e@ףOlH>15)E)X]y-%fD"]$37LL{Bf~QwJ6Vh;ˋiQoOe}[O/"s׬Rσػ}0iKRuIL$ 7O9͔p}EМq%>lyR~5>,D#8gXqAt,/wcS`Hcz|s1| c6x?;>8Og T9O- Bbxb^ (\YK-> z&Bx] (⦋Tq8VhqFnnB{i t c(K%.I>7L35F^k '`% اh}7L?9f|mTw*0_nxNt( +߃jRg~˶$tUTۯ(wT9Up] j:H5!4RʬҼ kTCi*^="tb,EѪ 'ܒě 3cB/y4@F GbO}c>Ɉi~ ̥A N,e)&$HܽJ*j}"ӡ8V9d kD?,ne gQMnT1MŒ1vq?3(=ᥰ${oulp(sdlWWj~Ҝqcgu]G;A2}.GkMˍ*~&%= 0&ݖ-TүEo2%;,mv%8A #lP<ݴk? #ڳW9۲ `d-%K vR]Ӵzc ̉i oΔI_jh `R4k!!(WAU^D\͵#QGxCp=7ַ)t1.X ̰@ZP BD5#%T(MsKo= H'ޕ妋\V锊.f}{^&G޹iUX=)r/ DNR 2eQ|dC~p5J~{]+qFXF2l(8K $x'ݪCPlAzn<ǽއ_5)h=Cgvi7:4,6"{8P|5Mh5: I59}H+lh1J%Q1 ;:o {8rc3)6Jɥ[(26FG<[͜%L-H*UwSJ*n&*FT7q?ubc)|)8 1A3QZX71\ݺ ;lZc)Yg> ҙA6b{t s8 z6!Ja&5jIΰMUN3W] o?D;$ R!ʜTZyivi_!@JXġ<@}-tu&7Inf蛜QemF5xw}u%N(V#P^/GrV? C)rtn] ;;kexAw{`[m좗¯S]M#iWkᖰ `;v Nf@s)^uM" p^Z @yƥ(¢0τr WMA7;ю7<1*,ER}T !>Λ¦ɇ<H?vѺG%ұx‡jcI%hI慤A^_WepD,*Fwư<+PY@u6/X` h%2{\tOKI5PHrǟ`Mwtz;DVKA  ~_ c,غy#)2sT %Pu-,o[3qo5;DR_Fezk% f)<~& <,N?c]$ GR %K%9saH n 0%ۦ.SQao{aǿ=1 sd6o۲>i3֘D8Ge r>5F*UN) :(Jvs3y9-X*! t6"'t-BCW1ڃ&-QhknVNfi Q`JG~(Uvyw2wkO2D~78ǧ)0 / wwlu)?%HDݧ̗-ҞNP!#%lLGqLR*M"gP;w*c%"si4oͻ$D,Oք]#EߗS9lon.e 梅SݙIŔ#2el ePSqj'xj.7rp˓n&km{ƛ_MKYf)&ˬ LY=43\aV xe 'c$g4x$(Bf6jkl*,qa(|-} x;$0]38(d8LK:p?(S֒1JgL{e`)'SI[Wp|b?/ 3\싈DVx_B똅uLb"إųh(|o/Bۓ/d6mg\pL!|{!'Q2P6A{0&{^}8sWBJPWoӔϯiMUDR`+LKy&qxE^Ck؇(x~J %>1AlZ'.W=-|{u<2f&E($~єklM8B5`RGy(z`c6yn3.$F:!Q=Zo|nmōIJ^k!MSҿ:JA:`@JΖȴyf ; vL=j۞)G&͑Pzf|"ej*r"b[.Wy`~tx K,R :L;@Bp:ݠP1¹3 @A%gd|?Ѽ6BAz?iz".&  YZ