systemd-mini-246.13-7.5.1<>,l|` !p9| 4.shoqذ/?`Fג7~6cFڧʘkpίg̣Eks"!f.iDDeҕ 5C;fbdRuq_B.b}t,/eqC2L 2~LlGk\NPd*=@>3 S1ſ9'{A{ m2cۃlFUT;iʠ<.YXRzXN!u(Np3ש ]SX܋qMU"~B>JCh?CXd  9@DPTm (/p 3& 6 >H  \Vx :”:~:((809:=>@BF G8HIX Y Zd[t\]^=bc=defluvPZw,x4hy;zBCC CCTCsystemd-mini246.137.5.1A System and Session ManagerSystemd is a system and service manager, compatible with SysV and LSB init scripts for Linux. systemd provides aggressive parallelization capabilities, uses socket and D-Bus activation for starting services, offers on-demand starting of daemons, keeps track of processes using Linux cgroups, supports snapshotting and restoring of the system state, maintains mount and automount points and implements an elaborate transactional dependency-based service control logic. It can work as a drop-in replacement for sysvinit.` !mourvedre[SUSE Linux Enterprise 15SUSE LLC LGPL-2.1-or-laterhttps://www.suse.com/System/Basehttp://www.freedesktop.org/wiki/Software/systemdlinuxppc64leif [ $1 -gt 1 ] ; then case "$(systemctl show -pFragmentPath tmp.mount)" in FragmentPath=/usr/lib/systemd/system/tmp.mount) ln -sfr /usr/share/systemd/tmp.mount /etc/systemd/system/ || : esac fi# Make /etc/machine-id an empty file during package installation. On # the first boot, machine-id is initialized and either committed (if # /etc/ is writable) or the system/image runs with a transient machine # ID, that changes on each boot (if the image is read-only). This is # especially important for appliance builds to avoid an identical # machine ID in all images. if [ $1 -eq 1 ]; then touch /etc/machine-id chmod 444 /etc/machine-id fi # /etc/machine-id might have been created writeable incorrectly # (boo#1092269). if [ "$(stat -c%a /etc/machine-id)" != 444 ]; then echo "Incorrect file mode bits for /etc/machine-id which should be 0444, fixing..." chmod 444 /etc/machine-id fi [ -x /usr/bin/systemd-sysusers ] && /usr/bin/systemd-sysusers /usr/lib/sysusers.d/systemd.conf || : [ -e /var/lib/random-seed ] && mv /var/lib/random-seed /var/lib/systemd/ || : /usr/lib/systemd/systemd-random-seed save || : systemctl daemon-reexec || : [ -x /usr/bin/journalctl ] && /usr/bin/journalctl --update-catalog || : [ -z "${TRANSACTIONAL_UPDATE}" -a -x /usr/bin/systemd-tmpfiles ] && /usr/bin/systemd-tmpfiles --create || : # Create default config in /etc at first install. # Later package updates should not overwrite these settings. : if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" ]; then /usr/bin/systemctl daemon-reload || : fi for service in remote-cryptsetup.target ; do sysv_service=${service%.*} if [ -e /run/systemd/rpm/needs-preset/$service ]; then /usr/bin/systemctl preset $service || : rm "/run/systemd/rpm/needs-preset/$service" || : elif [ -e /run/systemd/rpm/needs-sysv-convert/$service ]; then /usr/sbin/systemd-sysv-convert --apply $sysv_service || : rm "/run/systemd/rpm/needs-sysv-convert/$service" || : touch /var/lib/systemd/migrated/$sysv_service || : fi done fi : if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" ]; then /usr/bin/systemctl daemon-reload || : fi for service in getty@.service ; do sysv_service=${service%.*} if [ -e /run/systemd/rpm/needs-preset/$service ]; then /usr/bin/systemctl preset $service || : rm "/run/systemd/rpm/needs-preset/$service" || : elif [ -e /run/systemd/rpm/needs-sysv-convert/$service ]; then /usr/sbin/systemd-sysv-convert --apply $sysv_service || : rm "/run/systemd/rpm/needs-sysv-convert/$service" || : touch /var/lib/systemd/migrated/$sysv_service || : fi done fi : if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" ]; then /usr/bin/systemctl daemon-reload || : fi for service in machines.target ; do sysv_service=${service%.*} if [ -e /run/systemd/rpm/needs-preset/$service ]; then /usr/bin/systemctl preset $service || : rm "/run/systemd/rpm/needs-preset/$service" || : elif [ -e /run/systemd/rpm/needs-sysv-convert/$service ]; then /usr/sbin/systemd-sysv-convert --apply $sysv_service || : rm "/run/systemd/rpm/needs-sysv-convert/$service" || : touch /var/lib/systemd/migrated/$sysv_service || : fi done fi : if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" ]; then /usr/bin/systemctl daemon-reload || : fi for service in remote-fs.target ; do sysv_service=${service%.*} if [ -e /run/systemd/rpm/needs-preset/$service ]; then /usr/bin/systemctl preset $service || : rm "/run/systemd/rpm/needs-preset/$service" || : elif [ -e /run/systemd/rpm/needs-sysv-convert/$service ]; then /usr/sbin/systemd-sysv-convert --apply $sysv_service || : rm "/run/systemd/rpm/needs-sysv-convert/$service" || : touch /var/lib/systemd/migrated/$sysv_service || : fi done fi : if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" ]; then /usr/bin/systemctl daemon-reload || : fi for service in systemd-timesyncd.service ; do sysv_service=${service%.*} if [ -e /run/systemd/rpm/needs-preset/$service ]; then /usr/bin/systemctl preset $service || : rm "/run/systemd/rpm/needs-preset/$service" || : elif [ -e /run/systemd/rpm/needs-sysv-convert/$service ]; then /usr/sbin/systemd-sysv-convert --apply $sysv_service || : rm "/run/systemd/rpm/needs-sysv-convert/$service" || : touch /var/lib/systemd/migrated/$sysv_service || : fi done fi # v228 wrongly set world writable suid root permissions on timestamp # files used by permanent timers. Fix the timestamps that might have # been created by the affected versions of systemd (bsc#1020601). for stamp in $(ls /var/lib/systemd/timers/stamp-*.timer 2>/dev/null); do chmod 0644 $stamp done # Same for user lingering created by logind. for username in $(ls /var/lib/systemd/linger/* 2>/dev/null); do chmod 0644 $username done # This includes all hacks needed when upgrading from SysV. /usr/lib/systemd/scripts/upgrade-from-pre-210.sh || : # Migrate old i18n settings previously configured in /etc/sysconfig to # the new locations used by systemd (/etc/locale.conf, # /etc/vconsole.conf, ...). Recent versions of systemd parse the new # locations only. # # This is needed both at package updates and package installations # because we might be upgrading from a system which was running SysV # init (systemd package is being installed). # # It's run only once. /usr/lib/systemd/scripts/migrate-sysconfig-i18n.sh || :# daemon-reload is implied by : test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ $1 -eq 0 ]; then # Package removal for service in ; do sysv_service="${service%.*}" rm "/var/lib/systemd/migrated/$sysv_service" || : done fi if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart ) || : fi fi : test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ $1 -eq 0 ]; then # Package removal for service in systemd-journald.service ; do sysv_service="${service%.*}" rm "/var/lib/systemd/migrated/$sysv_service" || : done fi if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart systemd-journald.service ) || : fi fi : test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ $1 -eq 0 ]; then # Package removal for service in systemd-timesyncd.service ; do sysv_service="${service%.*}" rm "/var/lib/systemd/migrated/$sysv_service" || : done fi if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart systemd-timesyncd.service ) || : fi fi # Avoid restarting logind until fixed upstream (issue #1163)/  8@8 @@@8 8P (@8 XHH  P A 6U*;(P7BW#S|5)PP H@PH  !%VQ/16H #  *PiG "Ah.'$ $$) $%!i[,C!13jU4rP,*'Xy " 8H@8@h X` X8@@X@8xP@@@XX@@@HP< 8qH$U7d o| p~ 6_RXL9 m3:J9N^ 1FCg 8% C'FCg+ _ 5 % &+x*J("AAA큤A큤$A큤AA큤A큤A큤A큤A큤AAAAAA큤AAAA큤AA큤AAAAA큤AA큤A큤A큤A큤A큤A큤A큤AA큤A큤A큤AAAA큤AAAA큤A큤A큤AA큤AAA큤A큤A큤AA큤AA큤A큤AA큤AAA큤` ` ` `z` ` ` ` ` ` ` ` ` ` `z` *` `z` ` *` +` ` *` ` ` ` ` ` ` ` ` `z` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `z`z`z` `z` ` ` ` ` ` :` ;` :` <` ;` ;` ;` ;` <` <` <` <` ` ` `z` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `z` `z`z`z` ` ` ` ` ` ` ` ` ` ` ` "`z`z` `z`z`z`z`z` `z`z` `z`z`z`z`z`z`z`z`z`z`z` ` `z`z` `z`z` ` ` ` ` `z`z`z`z`z`z`z` `z`z`z` `z` `z`z` `z`z` `z` `z`z`z`z`z` ` ` `z`z`z`z`z`z`z`z`z` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `z`z`z`z`z`z`z`z` ` ` ` `z`z`z` ` `z` ` ` ` ` `z`z`z`z` `z` `z`z` ` `z` `z` ` `z` ` `z` ` ` `z` ` ` `z`z`z`z` ` ` ` ` `z`z`z` ` `z`z` `z` `z` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `z` `z`z`z`z`z`z`z`z`z`z`z`z`z`z`z`z`z`z` ` ` `z` -` `z`z` `z` b` *` f` +` ` `z`z`z`z`z`z`z` 0`z`z`z`z`z`z`z`z`z`z`z`z` ` ` ` `z`z`z`z`z`z` `z`z`z`z`z`z` `z` "`z`z`z`z`z`z`z`z`z`z` ` `z`z` *` ` `z`z`z` +`z` ` `z`z` ` `z`z`z`z`z`z`z`z`z`z`z` 0`z`z`z`z`z`z`z`z`z`z` ` ` ` ` ` 62c1279a9e7622576f2caabbca2fe4e30d34e9704a2994ceb3341b4fce664712c5c8396cca2d5f090db5e62cf735d06f60e0d6356585d43d7e24e471023635fdb4fa1b54aa769c419a70d94340750f94d0a6918f29985fb2b38d04e056602a8003d1f96ac6ae972ee34aeea279b1fed5caaae0cd5efd423672b7cb5374234b6d7e31316213bfdfa28038188507a53a94696da7699828e85369ec343f9fad17e961ed95c5dacf89df1c52d706130ba7f7e006c2b4ccbd91ba1d47d5292a7640051a3215710a0d7fa719a6c59b4c1b130e678198da6d455f49147e0cd524c632e89874823665c3a81745f100d25929e68d327001e3aea9a9ef55c997459edd7c89e799c9f2e0c07b189b29f7296f8e06e531aae2cc2719ea4326b2a309f21e7d509dac3e2fa0c7725fb7cd1011ac45f04adab953faa9314eb2237949a3f8aac60144a55ead50ffc111f11ea1423c921dec2c86c34a813cb5ab96db96bd66c736ff13800ee6af2f4cb3ee0c97423ea63e5881528a811260ee46fb281b990fc074f739220028ed164c3b2db4ebb3ba37be7cbcb0026986ca7184e3e5f26a3f33cbf5c690b11c75163c23391037da64710344c4ec5019e92a2bc4aea8bad3b95f9f25ec7565e13393181c3c0622a8de1d6957925b9ffa9d475b24e7725fbab37db807b4c88a87330415acb7b431617c065d142d1e12e54f74c15719bac79aa8afb15188a7683e2ac771aed0e0237fb4f1c97ade4c7c65cbfe07595ddbfd2600b278fa03fe702f70aff659e6921de0ff7050d92e430a5d296007ffdf24afccd4434f5e6bbfd441200ac07afb4986d946da66a66f8bf55ce6b212ab74510e820e55c51baa6f728dcebced64bf8efb79c561f650fedbb0f72ec98fbf19466d0be3f2cc0acb8b7fa4da87547c21d743f10d35671f4bebdd5f20fcf6173d9e935c4a3c33d60ef558735560e627823da493bf05a7cc2735e64d5927b21dd60ebfd435eb54cf196f353bac0f7b945efe5e40eea6d2d9443ddda5ff947d9971152b4d70aed27246caba3103e7b84025b7a05e48a1752c18251284a36919277177f037567bc51172f0142950f635a7afecdf0addb890f1f56d53e2c4dfb4c78021ec1274271a25c5e52c19c850da4bebc97d37dcdf77a20985f17254ddbe37c8f441139aed873aad068b3b93681e6e07360d3c698f812e4b7cf702e1be174a42fb90f52b1c846c6131809bd0a9fdca1ecb75fec67b54e10e898940f2cdf32354a75fce14f1f71420c1d97d9411107eed8c10a6f102caf9612aabd5343069f8e9b7d6f769093a57964efe41f858b87d496273a3dc6582d55c92fea946a95d0ad4fe36f910c01ce96b05c98bcfd200c9066c16bc8d265bf189aea8022b1698077b0588200dd65250bfd449e7c72e8f7ec2a1c7842b7149f9f17f80a2117d7d614cadc333b4d375f490cdd360e2054b3946ffbadfa8eb7cd595047d576fe0b4ef85b765ee466840e7fd9d7a65a2da8393796d6533859d25adc6b5292572c11497df856782fbccf17c34e7d887d97871bfe9d1e13a71b2a92e6f88cf6c6b5947dc8a76c27253118c24261c1054707fe27e995f083bee2fdbb1dbe7967b708a30d43047cae27ae0ddfe3bd9a85b283a448f5e154ba5639f74907a89c03e2091f6bdfa96ab63054b751ca6782c76965e9173626eb556df05526ca0915b7776dcde7081430f8c90086d28b29f182bbb51de0c2bc003df74d74fce586fcc46a8e7699b49d38d37ce0c54d0382f824b53303f813c473072f2fa15a18f58f4ff0e89e30d3fa149a43b4cd9781efb29b472abda093a80a3f20b2fcfdeca4891fa9c3471825456e47dc27ad09d694a9b9546c626d0a332ece6f2fec52d0b8a472ca2279bda2c520478591168189b559ca107858d342b24d08802e5f8013edb36c8f297e4e59a8f1ecc26246c9a05b0eec74cfe25afd065987907c6645bd8e4f0aca38f23be0a7a22bd927b6b4e426891862071ce6f5f4cf0c4a9159c475d1a96dbe2f238d49a1a3839be76511c7091e0022d869819ee04f91d53ee66d12312a0dcf3e6262f5ace301f62dce33320c2bbd04710b627fa5c6b44ee1005e844112d39ad04e23a9e45fc8c477800af7c5e16f4a74f7d20fb4b84b3c718d7b71f86dc46b559dc09111f508308f0e1e11486e34c7c19907975cc1a888b0b34125c4457b0d11bea06754c678fcd1f9fb80faca854827f0407aec49cf492a5da550cd67b19573294f01d80cb69b2aed2cdb6d599af2fca9168511de546379a7139584a29ea8043c4100ed31d99a07a6f949b9b4c2739a13679c5ea1527da8bb03ad7704c44e3845c05bcbdf67128a37576e6f38f03ddad10e48facce9fb0965a8187402003bedbcc284b61f98cd4969d246f1b512bd9b12a896887ce617f8e2842895b00b5c0a98c62de9d17d52b745d460a12dec08b8e9e7018820bf17c6b757f3dccccfbbec6620d737a0864a161ef33be34f266f2e28c1184aa7a90ae1e242af8e63564910d640b63bd7943348b1b84b2e7500fd017646396ff924ece18552223fa501cd8430652f388149a23d44451f7c30d0a46ca6e2a8f52c58ac8c65ff0af7e12dc97a490400e3da04b62d352332fd2bebf928c5365782a2509d3ffba8cbf7acbd0f448aff9e535f996e1965671ca20257c4387a410657af3712011944ccf5ed3f3171c06035898dbd63882861eba66930c4fdc28976b7f2caa35af85c90b9decebdec7db8925a4c0c1a63e91fef15e46b98aa0886031fd3814c3fa7fa408136489d5e1947c4f4ac1e1e00edb240d376192112099ff140bd64953ed577d62ebab117293f04e5df62073cc45e0c8881f2ca398e8658635034a6a9d628e01b84f0593d65c48acbee987c84931a7cd6b35d51957f82c677263b255fe4e129291e4bef66ebbe0884bcd3983f47c360daca87b34ed19ec08125d06610e2cf378735aab31ead01c2a4d9a14fcf6b170e1b0bf0fe9afea3d5737bdecac019e99dcff7ae79c15318da69faf522b3cb8efa214da8a1a1f5280ff02c474edb65c2b4ab33903e57bad2c9cd586a1eaa70be8f03127b197b9eae62eb84eeed69b0413419612238332006183e36a3fba895783780d2ac4cac5b7932a60fd3bf8dfe18516467cb1b75b0639515928f65eb7c1f4a494cecdee0ab3c55e9886a7bbd787d105ae0531d9503df72ccb5e8d3117ebfa58d88010e8218b5a56d6ec4b7b3a123dcb9c95429aef19817d02fc3bff764e7a78146797e480e9493163bff8f4df445279b49c30530054948d0da88eb1dafbaaf7a7fbaa48feced37d8c15b3af6fa4a4518ba5d03ea66f7945c53c4b42e1c9194b00a7b50ec380f94e094ac9a4c06eb663cc30bfb39f314bfb15b4309950dfee5a6142c15af63063fe31f2bca4faf67277e8e267e7442a2bebc246a61411d368285c97d48ea46a6977cf93ceef9db8453daaa2b2587f9bda85d7e08a0d000513ace393462b24160fb8c5dc2f0c88013aa990bd9dd3ca647dddb3348f8e220a6c7350abe4124ccc8e42471728a1ea1bc7e46da1b9db74d7be0ee76d52d117341edab12087ec1856af173dd93eb67c3de2124e3ffc095a5feb7e18520739bf95012f8007b8a94075e14f4b306d26723ee5ae5ce944b86c5a79fef96fb549c892717392f51ecd53d6bc7380ed19349519872bc83ed102fe45ae3c0b80189762b061590bfc7f59c7f88c4e8513a112447a4e3c01aeed858bc19109a169535ecc9c1231e79c7f1a7f75116f99eacee0053a68bad270747fc267c2066c5b7f5ff8469e96626128caae4a6c36b289d15a706524825e4817540de01dc748db158771aced595064c0664818eaa20ffb783628ef614d8864984e499f25282ab7c1021781b1e8255c7ba4e9b2e5aa7dff63fa5900db8b056bb52047d96cd9a70d535f41879ee51365f20442f938a22d38de83d7de37947de190bb1190c87a4808880f76e598203ba387ceeedfc6e9c1bb6e9ffbc0b2205313255aed815a658b31db2bf3ea2535acdb33dfe236b0bce0e3a7883d4faa3d51a75b047031b0aca82c86df602b43d32bace034b2984afde547bdfcbef419b707e577095faceb87e3928185341d06c8c6da5e5ff31e5ed1e0dd8da5cb4321987ed6950e88ada5595d496af4750af99c72415aee9209c7e0048124c6f788c255f445bfb175746e466d44c2a86099cbf8a7109c95363abe2ffba10b6893dd33f8b8dac783e36c64fed494bdb7923cd91f7b9983aee2506711736cc3352398e67aa117fe684a743664dab1b3c1cd6bb8818c22f7df97c927b64f6ef52fd7671cacbf15ff1fc5eaa1e7e7dfe09986f7de7028dd438ed63c5d41743ffc1a84380797cbfa565b968619e09e43ffe53a3ad120b6b2cdcb6b41e55a5163820c1bd31ded117f10d75b50537e1f39a65d9d1913fccc9955c31dbf1368401fb766fdd510fab64ea66769e1bf9686d0ca71c29f06e3b1d579ffe8471ee795e46708fb32f489153c07bb4917f41f73f9db790c212fdc62b92f7d6e571eb1c010d4d71bf31512d9c2fa24ae32e3204658ec6a4902d6ccb36765b2105e045e90e400c0b5567a0d868d0060a1391a8e07c6f42d0e50d0db4c1126c9a006f29320337913cf0d1e6d108108bbdb1ecbcff984697a09255038f3ab592f9c9fc6174c5177c0ecea368f6a832e998cfe5481ca0e449e7c24938ce57f384474fa52248f912b11cce30dea793db7fa26a6cafea7213716eea1806800d64f04ab86d078c0858f6c2d39df25941d0bff06a781adb1b9a519c44f1341b67c872776d34433a7fee8ee89c53615617b707424801110c4d5b22ece1884af51a62bea8547cd74802c5f394be11196edad8a0f51b1aa0861ba356c781bcdacdfb73f79a2d30d6575dbcd091f66a6191918b5f19cdc894957763a098485f8b5d1456fe3ecfa3ae9c3e3bcaaf5a46a35f27fd3cda9e529a55000e4cf064251464f699d02449375f392c61a85ba6f3a016a5784e8571e4897c07cf3011a3a87f14eb6628a68ad5e7f393dcfffe3703dc5489b67138f83d4889e7efd89913e5325d1f01bb0c93148bd0a397d2d075b5a514e9d9ca33040d2e442cda724f9124c7b1d9eff420aecdab1ee7162f2732105e07d8deccf5aa7d1d78ab6194cd7c2324a5e171588fbc415536a92ec44586faa5476ec0631de022698ac3210a1264266b3955f4128db5c87920bf9d77943a21d9db5baed19e7660d5df9027d42edca251148e25ebb9ef0c1a1a4a369948691d57ee6363bbfe124daadbf41a74e840ce9e534088b1dc45071c7ca18f32a2c3954213496a99380571f9e8143d9a1fd9aed16973827e5659568134a123af241085373b974f211a466939b4af081ee1317cfa2f20cfb7a36e494106d8c09e41711ba27155e99d0701be0b52d513f624485f384832fe8316cb92018636d70f6afc3ae63107064936dc71109b8bbd1ca0a5d2838388f84fc7df2658eb221c1d076a62beb6c2061b80b061e1e36eb98c717ee3ff75a8a5b48b6cd6e09878266362c6d5c3c8c22d07199b5d087667d0c8f27d21a1b75979a331adbecdddca10151c270a197187de1e396b9608558e4186dd4eadbdd9e596bde57979d2b8ad1693ef89ebbd69061b522e335526196cd01a555da0bd617af014aaa018d21da85d642f9f15979fa699ed315b3268c3c0b460c7a81a046db8b99e38e60072fb7495482e4e18afb8804fa0c9bb8572355bc68311c653ece2ad5f8dae77603bbed92ea025553d38111c4af29f3a8b8b45a9303b0e4c54d44f4362dd5140e8e476e88c4c556a595f780eb7b6d51240c2e4e0b838ae33d3b7bbade0a1f0adec3fdba5c76b2b50b3b251c79a731851ebec592b6850a9710a3a821aefd75fe9dacae47e9b75ae813b33d9890b64879a1b2c5fa1175d259da1bc8acec592c25438d9199a7b1180b960d98b08b711e0b95f040444cd1e892106c3e22f54205370b0595530d31f9b8fe8ccdf2b9aaf2dff9cf5853127ffa0e2c617b5cbe1a09799fdf7b933916de2909c4ab11c96b8a11bb5dc00a116661ae7e552ce6b39b9d2687496c92d478920b523e3dbb9f119f6a393a99849540ac1247e2b310de7f7149b3c5ae1acf92fd3cbe0e9431430e7c0882543aa83f8a022224c0a515f71ad201582bf3f85ba09e57e8a2fbf136dd14aa94f06895f1403fbfd93704f7526dec8fc845658e8d743c9659f8e37f439913acefa0b6671bb97ad4f41691ef7dfc4efe363eafa096dc7a327476f1f122b99c789147e908d9a75e8b0fdc8be971e6fb66248ef6d5568e86ba8a8d278fdaccb3e19573a2ecb1661dc8d526d5f66e26f876a730996762c0ef3f95c04a0e43c31e2766a8b8dbfb7cedfcac6d4ca97ff01de17667f41c487336fc1dd78fcd6d33e667424e4bbcd5d4fab410f262a76f72298c5f76ec2a0799f263159522bfd75d0fd4fa653d72311e9ecac9ed6626d8cc35b81fa1c9a5b0251378265e176ab429b30c34a059aa8b34d92de2492d9d1348da29901b9be19e36b3d428d9fa7e4c110a8570063cc3e49fe23cfc172929f01cea4e1bde3beadaa873364e2364fa911746186688d0b81eb203e6cd3c8c8469dba9f575e7335039b5fefc2c433adc635353c452d6fd5fadfe8fea2de833d9a7341702a40531eb7d8b4a6e4e05b7a5b1cb18a623f9cca434b1286530a11460f5a0d5c74c9fa9a6ae3d164c5133fc146b5b99d6e41dba2aaa8497b7b67849c4f357da299e48c667288323f5d532a93c552b6806310b98ce9a80a876b0f6d55ebb2853e945bda01ab91541e62784d09de81e7cca8983c7b0b1efdff0a07c1b499960e344ecdd5892bb97033c418f0b2dc0c15da119c802aff3907f965bce296528f83021a0e7ffaf2c20cad607baf63b07239db92e584d8f20bb23dffd3f7838b50d286275367acb77dad4933fcb758a9cc8b78264298f6b842bf87e2ef8bcbda2d66198e2982efe933288dc5cce9d372dd6a769e594ac4d1624084883741b586f30b5c54edb0bcec40962f187c6d791d574a16f74ef1b66a3139bcd0c741200f5923f767325bc3c22314d81cb61c4138df6762c1542b46abe46ba95ee0d724e71814ddc5962ade792e6ac0c316282c4236d9c27b57ea5baeae05e324a874a65e0de6759579c567d703e3f2e5ff3f901f4c56e365d2febcdc745f7e58843ec4f40ca0714278cb6a588e35f2ec1ec21c2b0065c55d3da780b6f38233c2cd1edb736d5b251aeeb20e8ffb49da45e6cbf7723a56e6e44f087fef614a664312c9ea42104ae7cf3391ca2f90ac66340edb1c5e50d02e82ff0a822dce8681b05679003669d8674626d9fa8298660c1d34c7af7a683cfe35935217902cd33c16a3b6119e96a3bb9c841df0ba3343877f9b54e847a9b2597cf651e3342d0167a6e5b5f3303f17a17837179bd604330ac0edcb6e00a2265b4b9d0e1946900660cacbe06b710fc1864fc491cf78235c8a69a27614ad63e0acbcb50be336605f83cb496dde25372a9939122f28ee10d3384fe23fd948d6344c157e447dfe97c3e0bcd041b2ce980293c9e1a6ccf516c72111cff19d5fff6b5a4e0ede15fb694905bba6049c685d4e5578fe4fe3a7a5b2f347e34e8bc55c36f92bc595394247b14d5340f388e00f3dda9c89be4b577f6c63dba27075d00efd1728c1b00be93cb9b095deff67652dd929b2719321e80424763d47d6ff2674b3b8027598b1915afc957036d32ed22b18fd0edd01e126247c2d1f1d16fd8907233a0ead49fd3b78db4e246bebbb07beb1c68cd7c206b130d74a1e8661f51bfa846db87bf7d1be2951a361baf0110eb25cd5fd820074584c879fd225a58040fa4378185ec7ac89a5841e3f86aa60e8e8a55cb806b14011005a2523b9883e39cc0b694fef472afbfe00e2014a2f1869552aebcc4c69d8c062bfa395e9f8b90f6865527bcc0993cdc449c5f282e32870c35a6884a75ca5a27c10f8ed8dceea2acafde374e902cb117c7015b85a05b778fdced0466a95f94f6abed347a6ff9301361dbad2823e5be3e4a0355c5aedb8d10c74af05495c0cdd693fa8501173d6f259c457237960dd097b0fd2e1a114007c9f009cdd1204f0f4df6a04fdfca4a35acc19047dd0dd6e690ba20a7b874d0c682464dd5bdf5eff5cfe7f2bd36be0966774167b4c89be02dad6b7d29ea8b10b20557747035e866a7b731562c142a4d84d981642feb59d7ec1fdf0b11bf932f0f6fd2d33dab70c75716d9578af498d4fe503ae3317a9d0e9ee9091126462d799de1bdb24c46e27aeb148f97bdbfb85661c8cacddc8a249b392ef08379a2748797f75223160b162296b16a7f585004ede412433736547f0eca2b9e44d2f697fc3112b6fad919a56c163216466c2f8977433ca71e342d98dc2ac1420fb3b3b73a5036c4d5ca481ab6fac2225b3db966f995282ca659c239b1a55767f04211ef87f4dace6aec6142ef16f29d508ec99d71836d316c99fb0216f71f0ce5fc2928ca7e66b09ba5e1ebd672ddfb368d24685a6a59e7ab6e481464e3c473eb12f5c0667acece4969ecf8e1d7c9ff022fc1b2f9340b9e88f387dab9d8f007b38224b2804f4b86b5fd12c7d96237dfcc43c1d860cdf447f8b95f3943f3909ffcbcdad5930ec59736b13dea57b9a58b495a2ae3e2c78ca9b638d6724d057578ae567c615d189e670826c89de0efff4e560e2c8fd0f53d727ad0e21b89ffeafbfc313d8dc09b2f746cb2a5ed40e8f4b514b5e2bca7fa2e3c864cb20e94b15a0f63e153106184180ebc42111cea07a661bbfea1990c44f64aad154fa3e43fc7df6493f65642d7d475594fdb573a736dec942d2d4cc0521249568b3f4970eeb8231cab68fa00d1173d5bf10f31ba84ce5e24eb731d1618426d70a1971b9ed85be7a26ed9aa307db8a61bb11a95423f53baf3ed5d5e51a60909d174e0221f35bc5e153c6a7f4e0a5cab7df44c1316470ad0f2988a65eb1fade772e9cabdc2891cf1e52a4c2db362be3bb5b62f2f89c5c34000381bcaf6d0852c2707a1e9749439a7ab7bd2f27b58a67857d05529e62965bdca1f52b425d28c0ef97b94922acef0cce5d9c25af6600f5e7640b625cd41bfa3b58b6ce83986964fba70d70713ef97fbd1d4e9c24b88c697cf6a2c16f903caeb6575c9ba2719cc11930d665e22a0c7b73f0f09d2c8068dc6a93710adcf53bbfd01bd48445b73bd0c923495cf86097f8cb906247c8db68a1743e480b7d5d2eedba7231b5f675bca587558760f04e23b4e3003eef26b2c8f391da366bcee7baaef9c67ac6e38f91280eeab21c939ca9c97ecfb01da54dace36706215b830158014e94f18581fcdc25be2663e701d957e222dd6541aed3ddeded9611513639438a80eac8330dbde51654228249dda28379fa60c3630ddc12ce5f92971313d1d06412e65bd2e69606ef4474c77da8136814bc5b1560ecfca380e69319ce19d5c3ac5c58e81343a324ea86be26ded814c988e9e612c1fd027e0354b1019516ee2cf246cb8a013d9c84a14ac84b9c103662fc119bdf2ce6479e99a87e4912ca9afcdff615f3645b93c44bd41cdb0b55972c051fcbdc9a0f432d1aa0788d37559b1afa0d18586ded7ba90e0125fbaf2f3977d257ac52a7b98e24042b48da2861d71b01c58c55bc76b8e227bfa7754ebcd78f7cc7cf995c35d1e54b0944fc7b7ca2b887be7e6f5c7d66e85cac2446df9875fa0541bcd2db0354fa596264540bb4af0d615daf92c37143bfd709423ee3aa8ff5fb42d3cfe30ddd54a124b66e23f4862a1b18b3b65eff2d430be0cba0f750251ca17ddf54583f2ff3ef17caf171ac9344b5a1237f7a1252e313fd783350730696495324c4ab4ad17694725badc0f268dc7fbdfac924e20acf66ae44ef56c100cb8e0d791e764b6aa61cf2ebb4fdcead5c1dc39f27a5c5f7ff77a375effef4e07a843e4e8bb5cde92a45625b264eb3c8fda07c2590c1db444ee896da71e8e474b0379563039eb36eb02796e13c96d98fde3085ae342130c200797935d5795d905f8ed85973466a5c14f41440fb183d966f7af1e8446a47dcfd8be3b826c8d01388c714c35b9d5930cd3a2e0e1a30f71a6b04580bc83a44888e6a0643820948524c043cefd0e07b6ed21260a7d388c7990f87e6a2aad1b96584062e187409bed696fa2d654dbacf32259f4a9521c5db10056598411a588de48d5857e48c881aa0cde9ef203d3757ae4dd04fcfe76675a2dd387e744df74319677e65d21e1a3f9f364ab1e9b693ad85c409ef4d429e795ce7bd49d16940045dfae7fecc284e4281d74d8f46582309b094b97bb988018c08d73f1b0844662786201c92d6fa4263bd28b6443c88fad848fb469b24629c64ed8b016505e0837fb87e8aa86cf952c2312b883e4e285c193ed2da8843e1a16047a778414a96ab57b3e408342d90f5c3b770aadfa3ec23a2ff2f142a85dc08288279ce956fae323580af7dde3ebc1bf742a89a28b40807740389849bfd07320a0f39405fd3c76ae04811473d93f8bc190de1d6d4172c2c4dbab498bdefa5d2a9c8da5972466406533da4e3a86ab7da8a130cf967e3fc97b41221b873a797ef5859592a88c7d3b152a0a2da89f89a12c12112eb9fe5bf22a6a330a991eed3d248cdc8aafdbad8b84b19a5d28239d623431711551757907df3337370845eaf76b666f5cd12be5941d0131e4ec084ba3b22e0e93cc4a2b8436ed52d892738e3f5c24698798ae2115cbcb5d107384a21f334e0fac3f2a436fb2396b37b7d0213acc2e5a6bb5792a83de62fd4c5b24eef5e842e66da6b4244deaa8fd9653b40e88954346983455c3944a9020becf75e5724a296fea544310d636a511e39080b87a6e8c1611ed3a31a63411fdee1f57c22bb1a8ad02ec2f7f2785bc6fa188348fc63169d20764ce2aa3674934a3d48cec234cbc404263385d839b60dd6042850b96e8b9bdfa742121a6e5ebc55751c5f8ff21cf260168f994dfeda1dc0921d36bcba78eb029c9b3ae5ac1be6afbd351de91aeddcda6501b839ed416d1587650e5673bf7f67c793a13f972e61e106a7d637ceb50f7996a8d38d5c66b77ce238b23826e9f4e597dd57a2198c229f540f1a9e957a4c83c1febc2df31fb3127b197b9eae62eb84eeed69b0413419612238332006183e36a3fba89578378c8b9a76e1f28581d40d2a443fce804b493e3d60f619dc16e8edf6dd71d684c1e146797e480e9493163bff8f4df445279b49c30530054948d0da88eb1dafbaaf78c2a086ac5c2b139d515a2ab49d8e5278c7ee6471e1a159263595a976869489fca26638ba3227bff746e9d58c68d77eb4efd904ddc76ecc98dd0de397c860825b4b3a15f32d9de7391f001bf5813c0f0dbd9bdee9bd3c2273e572972c2fbe5fa1fef42486250c523257387fafbdc0f30126c75a7f9d9dbd7a89a79e328239a184f699d02449375f392c61a85ba6f3a016a5784e8571e4897c07cf3011a3a87f1d1f01bb0c93148bd0a397d2d075b5a514e9d9ca33040d2e442cda724f9124c7b75979a331adbecdddca10151c270a197187de1e396b9608558e4186dd4eadbdd2ad5f8dae77603bbed92ea025553d38111c4af29f3a8b8b45a9303b0e4c54d44f4362dd5140e8e476e88c4c556a595f780eb7b6d51240c2e4e0b838ae33d3b7bbade0a1f0adec3fdba5c76b2b50b3b251c79a731851ebec592b6850a9710a3a8934cc532a7e24e4814f597bfc2f349fbb2ca920152ed4e39933863d65fbc254b267d26d7ae6c0ed320e6502436d3c5664bf8730369da7de66bc2eb5c47a8f8c5261ee4679bc17b5ada1fdabafb47bdac85fa5def307e1ca38b50b25f65b38c87ed9394c6e9eb437002b3b649d9c2d05d6c5ebb6c40fad02e6b4d0edae1017a0362be3bb5b62f2f89c5c34000381bcaf6d0852c2707a1e9749439a7ab7bd2f27b2ef8199b5198377486714e69f032369a0bc79ad0f92956a1458eddac44440c73a7a2db359f4e7c97677a0ada1388410ac0d8bf03c20e81c5d0b97e8c81bd4483c53a809900502c8cce9a2dd1a37318aad2a3988592c4493f2c0c2bfd49c2b65631b94855f61be94a9967ab91418d5e6bbcaa1f240f5c5ee994ccf7c82d1d118428867896a7af2883461777f068976e302fd7ef3b3f2b409a86c27c8fd7402ce9b19b25702e003a96bf635250751c58824531834d0bcd5c98575f609125b1b1485814667bc3c0c5064405446a88b49456f4ddae00a5338f645daaa30ff8f9fbbe3d9b0936d521320e310ff786bf9ac68d96c80977b4f2e7f926456be1eaed36c3fbd4bbec65eafdd27eea4725c1254cd2955285f2d441238f18451e9c285b72abbaf20471b356a030c52114a90776ca9fb94536ff333a174ed38eb38945a18cec0a76ea4a4154bbb7335197123cd3878a2daa7a71994c4a0f115f91ea4e6d8282dcabfab6c5ca6e76d994fa183cb26b72a4f43912a071a61e1657716a15cfa7e0b5ba766cee5e3f7140b3e996566225674dc98bb85fa31df7f0cd60dc4816190d072a4786d0ac9c795c3f9315d5ad28d466b224778b22feb6ca2d82978e751836bb3ba1cb9b08518ef0a210a8cae87f2d26391615d7756af7a228dce26c367953b6ca026b0d2f1959581f74ba08a90093af3d34230b968ff1c1574edd06a79932847de61af2f51a87bbf6dfe2cb2f5f8b50d0c1c3695e562378540b654bd71763200a65d04ebe2ec3de293226e09fe69a7743982f2f3fef340c58b97044054a14ffc67437b0ff672fc2dd0c422494c82ed8ab54bd4b44e03eecdc7d6b33099e46020ccd561ac44f24658999e995522583c832ce36e973facb1e3459c69c28fd35ba052d28d639f675cd2b7df476b45f40df6349c967f717a5364b046b5513849da3272aeb0fd97cc9a28ca5cbfb679e95e7fb96971a82f539b117f234a2c9a5aa56f0f71ed060ac32bbd14a991dda88bb05e6ce8b0f44dffbb6d97fae0bbe982d6d4dfc3cb8827b225c03f0bc3215789f6aa9e0c6d26d8f3cfe3a252f5512be16c25b8726ca01e314452150ca2b4496a32ce16949585e24d7476b03361638c5cec97cfe1c83477500063c855b6b06687fa07fa88d316f3fce75b18bd699c4220b9aadbe6dae05f47ede63d9da70a376e4db3c5e8c9d17f9a34ead125387c229a853d6fca2daae54699bd8c76b98d852bec949662887e68b320f8d465ddf6a04f4fb2f312bdfbf0345f4bd6bfd54a2678e300507b306ebd923b59d7d9d5e54bbceff9e8aab934214649dddf6b3a1d6f5ce866951dce4614a760612e4ef3d1afdc73d323784f3d04eb4091fd685cfc799f3f7cb554b3573b795ccd488aa3a173dc3f0f8d0a30c78587a05cacedad03ded6463aa786b27f294a9269630f670b6b88237528893af70a45277ed0823b8325a1c59640a4c8dfb0123f93a92f5fae50e389c3d7752da25a7b03e3a7b12d268116cf78d09f9ba77072198f70fe970f1f1125514402b3ecb006a365ae9a643873d06a4e6e3b8120e0a62781e99a42aa9a0b4b7045bf9eb1f6887f1edefc1b27e8bfe252d0794479a9c3d333cf40356bb2eb937a68d852e39114b9691001fc91c9db098e506e077a324329c46159020ab3f39b35ec4d91382655caad10cee4309b848e1ab6062b18558e7f2e5f5b86883045948a69e9cc7ee177ce548cd540b437d5338a9cb859965cee94ecc44033528bcb7d0d00f7a7d92133c7e3a12d2397a8a460730630b015aa2b37331834e3c73ed08f4520acc3be8066d1505d1c45cdf3a469f695bc7a12e50ba35c3e2bc2125cb08a6d522ecabae08d285fb5da3b1ca488bb159f0fa3f32d0c47c0503a32f1b50edab7eaddbe453a08d762c45666380977e619c5d375712344be61119c2c1319a0a68313a0b0f119cd79d59d65726bf0e317a5fee43322afe4debcddcff3a92d9866275f8caac3bb88601c87f079a45e86694864cbf5aef5dfaeec6df0db7c057250ae351043c5be905895dddcf7aaaad1d629222fa826ea4f6cdb95bedbd77c6ffc5023499385f76b33dfd17c1379235a3d4ba42382622f0136ddf99f08e77bd352512a12de61dda6e9470423c33fbb583ed0c750994e6ae193aec8dcab258bd1b43ebe5ae5ec9a9267337efbc537f71a4032c178eb1c417f4a9e18701d3a747f766b0dd2f9b7ffa02c6aca6b02cc30273c217cf742c8aa811a5bcdf35e252df36ab15fd526bd8dd18a9e77ebc139656bf4d33e97fc7238cd11bf60e2b9b8666c6dc626520dcd53a22f727af3ee42c770e56c97a64fe3adb063799d8ab032fe551737d1e0d1bc8f96f44520593f2e9c12f3b2b8cc9ab7d620e1abbfa03d606f7faacd67c21b7f6e9c6793a255e487075be0c9db3a4617fc4b3fe76d62b0fd4928498f46a06199d12506f7867ada0ec03042c6c83ce9f6d3d384be9d3fea0646083e69cc987ae1525cd4c102e124b685a390e2900068caf7131666ca67eebd8966e816c03784f946ffffb5a6eb4cee545c340ab3e0d1a75b8430b7db5f2ac094c70ab15fd526bd8dd18a9e77ebc139656bf4d33e97fc7238cd11bf60e2b9b8666c6dc626520dcd53a22f727af3ee42c770e56c97a64fe3adb063799d8ab032fe5510c6d652cb2187cd6b5f3de4e05fc4d1598dfdf9d928b80f65f729733ee9d24780e0c66fb7f9b1098f63dbb2b808ea827e90ece9b1d39d74eaf6c9064f6971437fe59aca9b10e8d9d46c5200748996c50dfaf31f87804c6f6e86fd09821563d1962f31a042d04e792cbf26b0a0c6c0fd95519e6fceb7593eb6985bd8610a20779b90a48db31839a1e939c7bbe5922b3af41a1aabbe3d8fb0bcc7b78d526f098462a6bd7c61a16ef4c949ab5fdf05b1372f602003f83e50dc9bd73ef805c8888ac5f74269e9e0e3f4f812b3bb1004713da6eb242a7e937765bf295bc77ca314939df256be45479f419f5671ad5fd99a647017f31a6319b670c72fc2660d5f78c9d3c12ba1070f37a5b8dda8cd84b64a7a013b12c439ecd15ea6e15fc29fb7233eefcedbd9c0cd0b7fdd1676fcb945e7f3c63544d95fdfabf0a748add53b42b644c1983bc55ffa64eff1ec9e15b3fc74352b6c6d86fb0147699f5df16d04121edbf55ac514b4a9aea8ab572fb6a023084c1caaa850f88bf357fb575f112205a66ddf389bc1d6ab4bb78e27c23196d9ba37ee7bcb765244d48fa1153849fda36e6eb524041b444a49d2d0ef26dd1c3c6ff8adc4cf2212e9a8157471975b42fa42ce7a0efab879597a5dcc49fc27a40eb877a27b813fde3155c76730cce03ed60ea59eaccd6e93cdabf23eb8b00d2fd5cbc9db23f4769e4d8ecb406fbc1ae6b8e24bad5998af92df2196de3e9711096dc2c13f6e52690d6b602e11bc1a25a808fcba4ca77e27058860ee3da0bd0c736d40ca64f168d1cf76d65d0c52436599ffa3cb4f4e9149c15646777897311c97752c509ba3ed18db160da13c75c25ed308bfe305c8a298c899d264746794244edd83334a5c3fb7f18e34ac6202ea39f14dee9ea428d69af8b5b2eded37573d8199c1a672ce27786a9353205ff812f015784256f5b436aa78e49ea708a2d7ae3435bfa73790eb9d4f4c17d01cf21816c618cd53af63ce9e7e2733167ee25c8af2f7e076740f943a353f2a59e13d6a3d1d22f5079613fb9d4097163895aba01dfc76c0de501b2113c8231924dc8c89e2b5b11886e457519a0d280399c6582fc43532b5bca1706bedbd86aa9abc2301c8ad9e2e48a363392e75d4455e5527416de815595ed22f45893059a30e7ca68cb7e834f8741e6ea76c21ace06b9efca46ac00d98f5105a80c0dc6b73f7124a9261fec08e73d379d6a7634d9754d1a08b0b1c51ef8fce05d0593a6964a7564f2d8beab18bfcef4153d6290ead5b135f3244a9e130cc20682c8e5cdf714c90713896d8a9e3a1b9090d2e47dbbd43d558b8dec2db97efb467bd998d5f3aa83079fa18eba21b1368944bc7da817f84db7c723748bcc9eca61eb3e58690abbe84621c0a66773e248/usr/bin/systemctl../../systemd/usersystemd-mount/etc/environment/etc/sysctl.confgetty@.servicereboot.targetsystemd-hostnamed.servicesystemd-localed.servicesystemd-logind.servicesystemd-timedated.servicegraphical.target../after-local.service../getty.target../systemd-logind.service../systemd-user-sessions.service../systemd-journald-dev-log.socket../systemd-journald.socket../detect-part-label-duplicates.service../dev-hugepages.mount../dev-mqueue.mount../kmod-static-nodes.service../proc-sys-fs-binfmt_misc.automount../sys-fs-fuse-connections.mount../sys-kernel-config.mount../sys-kernel-debug.mount../sys-kernel-tracing.mount../systemd-ask-password-console.path../systemd-binfmt.service../systemd-boot-system-token.service../systemd-firstboot.service../systemd-hwdb-update.service../systemd-journal-catalog-update.service../systemd-journal-flush.service../systemd-journald.service../systemd-machine-id-commit.service../systemd-modules-load.service../systemd-random-seed.service../systemd-sysctl.service../systemd-sysusers.service../systemd-tmpfiles-setup-dev.service../systemd-tmpfiles-setup.service../systemd-update-done.service../systemd-update-utmp.service../systemd-tmpfiles-clean.timer../system-services/org.freedesktop.systemd1.serviceQQQQQ@@@@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsystemd-mini-246.13-7.5.1.src.rpmconfig(systemd-mini)libsystemd-shared-246.so()(64bit)libsystemd-shared-246.so(SD_SHARED)(64bit)pkgconfig(systemd)systemdsystemd-analyzesystemd-bash-completionsystemd-minisystemd-mini(ppc-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/usr/bin/env/usr/bin/pkg-configconfig(systemd-mini)ld64.so.2()(64bit)ld64.so.2(GLIBC_2.22)(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libblkid.so.1()(64bit)libblkid.so.1(BLKID_2.15)(64bit)libblkid.so.1(BLKID_2.17)(64bit)libblkid.so.1(BLKID_2.18)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.22)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.26)(64bit)libc.so.6(GLIBC_2.27)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.30)(64bit)libcap.so.2()(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libcrypt.so.1(XCRYPT_4.4)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libkmod.so.2()(64bit)libkmod.so.2(LIBKMOD_5)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libm.so.6(GLIBC_2.29)(64bit)libmount.so.1()(64bit)libmount.so.1(MOUNT_2.19)(64bit)libmount.so.1(MOUNT_2.20)(64bit)libmount.so.1(MOUNT_2.22)(64bit)libmount.so.1(MOUNT_2.23)(64bit)libmount.so.1(MOUNT_2.26)(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libpam.so.0(LIBPAM_EXTENSION_1.0)(64bit)libpam_misc.so.0()(64bit)libpam_misc.so.0(LIBPAM_MISC_1.0)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.17)(64bit)libselinux.so.1()(64bit)libsystemd-shared-246.so()(64bit)libsystemd-shared-246.so(SD_SHARED)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)this-is-only-for-build-envs246.13-7.5.13.0.4-14.6.0-14.0-15.2-1filesystemkiwimkinitrdsystemdsysvinit11.52.7.04.14.1`\`̊`````O@`O@``~@`}p`n@`m`lM@`c`OL@`OL@`J@`H`H`H`4@`3`3`/@`-@`-@`!'`3@`3@`2@`2@`2@`2@_@_H@_إ@_إ@_إ@_@__@____/@________t@_t@_E@_w@_h_cO_cO_cO_a@_a@_Z@_Z@_O@_G@_FN_D@_>e_ @^@@^^^^^@^@^ϧ^˳@^@^@^@^^@^@^@^^^s^^r @^ku^M#@^;^8 @^&^@^@]@]@]@]N@]ʞ]d@]]])]@]]]4@]@]]m]@]@]@]rJ@]nU]S]A]5@]\"\"\@\@\ڭ\\@\@\@\\\O\}\\M\M\\@\~d\k\f\=@\73\73\l@[[[@[v[[[0[<@[<@[<@[<@[<@[^[ā@[ā@[[[[[@[j@[a[[ @[0@[!@[Z@Zz@Z@ZZZ@ZUZľ@ZZZZZZZZ2@Z2@Z@ZZZZ@Zw@Zw@Z%Z%Z@Z@Z@ZZH@ZZZZ@Z@Z@Z@Z@Z@ZZZZ}@Z}@ZyZyZyZyZyZxG@ZxG@ZtRZtRZtRZtRZqZo Zk@Z]@ZX@ZV@Z%8Z@Z@Z@Z@Z@Z @Y@YYp@Yp@YY@YA@YA@YA@Yo@Yo@Yo@Yo@Yo@Yo@Yo@YYW@Ym@Y{'@Y{'@YyYx@Yx@Yx@YqY_wY^&@Y^&@Y\YK@YK@YC@Y7Y%uY;@Y;@YR@YtYtYtYtYtYtYtXXXsXg@X@XXZX@XYX@Xe@XpXXX@X@X@X@X@XtXoXn5@Xn5@XWXQ4@XIK@XF@X=mX43@X.@X)@X$a@X$a@X$a@X$a@XXX X X X XX`@XXXXXXXXXXX@X@X@X@X@X@Ww@Ww@WW@W@W@WSW@W@W@W W Wv@WWWίW@W:W@WE@WPW@Ws@We7W)@WKWVyVVVVVaVՄ@V=@V@VS@VwVwVhV`.V\:@VLh@VEVD@VA@V'~@V@V@V@VV@V@VV @V7@V@V@U|@U|@U|@UUoŬUUUȒ@U@U@U@UU@U@Uy@U@U@U@U>U@U@U@UUUUU@Uyx@Uyx@UmUY@UY@UTE@T@T~T~TTTTTC@TTTTp@TTT@T@T@T@TxcTw@Tto@To)@TmTmTl@Tl@Tk4Tk4Td@Td@Td@Td@Ta@T`T`T`T\@TWn@TWn@TR(@TJ?@THTG@TFJTD@T>aT>aT=@T=@T=@T=@T=@T=@fbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comthomas.blume@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comdimstar@opensuse.orgfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comaherrmann@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfvogt@suse.comfbui@suse.comfbui@suse.comfbui@suse.comrbrown@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.commatthias.gerstner@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comeroca@suse.comlnussel@suse.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comstefan.bruens@rwth-aachen.defbui@suse.comlnussel@suse.defbui@suse.comfbui@suse.comfbui@suse.commvidner@suse.comlnussel@suse.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comlnussel@suse.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comThomas.Blume@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comThomas.Blume@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comdevelop7@develop7.infofbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comThomas.Blume@suse.comfbui@suse.comfbui@suse.comfvogt@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comrbrown@suse.comfbui@suse.compavlix@pavlix.netfbui@suse.comfbui@suse.comfbui@suse.comkukuk@suse.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comjengelh@inai.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comkukuk@suse.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.commeissner@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comtbechtold@suse.comdimstar@opensuse.orgfbui@suse.commeissner@suse.comjengelh@inai.dejengelh@inai.dedevelop7@develop7.infoasarai@suse.comarvidjaar@gmail.comThomas.Blume@suse.comschwab@suse.dewerner@suse.dejengelh@inai.defbui@suse.comfbui@suse.comfbui@suse.comfbui@suse.comwerner@suse.dewerner@suse.delnussel@suse.deafaerber@suse.deolaf@aepfle.defbui@suse.comjengelh@inai.decrrodriguez@opensuse.orgtchvatal@suse.comthomas.blume@suse.comjengelh@inai.desor.alexei@meowr.ruwerner@suse.deschwab@suse.dedmueller@suse.comfbui@suse.comjengelh@inai.dewerner@suse.defbui@suse.comfbui@suse.comfbui@suse.comwerner@suse.dejengelh@inai.dewerner@suse.dejengelh@inai.dewerner@suse.dewerner@suse.defbui@suse.comwerner@suse.defbui@suse.comfbui@suse.comwerner@suse.dejengelh@inai.dejengelh@inai.desndirsch@suse.commeissner@suse.comwerner@suse.dejengelh@inai.decrrodriguez@opensuse.orgjengelh@inai.dehrvoje.senjan@gmail.comwerner@suse.dejengelh@inai.decrrodriguez@opensuse.orgcrrodriguez@opensuse.orgsbrabec@suse.comcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orghrvoje.senjan@gmail.commpluskal@suse.comjengelh@inai.dewerner@suse.dewerner@suse.depwieczorkiewicz@suse.comwerner@suse.dejengelh@inai.dewerner@suse.dejengelh@inai.dejengelh@inai.demeissner@suse.comcrrodriguez@opensuse.orgjengelh@inai.dejengelh@inai.dejengelh@inai.demeissner@suse.comwerner@suse.dejengelh@inai.dearvidjaar@gmail.comwerner@suse.dethomas.blume@suse.comthomas.blume@suse.comwerner@suse.dewerner@suse.dethomas.blume@suse.comwerner@suse.dewerner@suse.dermilasan@suse.comrmilasan@suse.comrmilasan@suse.comwerner@suse.dewerner@suse.dewerner@suse.degber@opensuse.orgledest@gmail.comwerner@suse.dewerner@suse.dermilasan@suse.comwerner@suse.dermilasan@suse.comthomas.blume@suse.comgber@opensuse.orgwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.de- Add 0001-login-mark-again-framebuffer-devices-as-master-of-se.patch (bsc#1187154) Restore framebuffer devices as possible master of seat. Until simpledrm driver is released, this change is prematured as some graphical chips don't have DRM driver and fallback to framebuffer.- Create /run/lock/subsys again (bsc#1187292) The creation of this directory was mistakenly dropped when 'filesystem' package took the initialization of the generic paths over. Paths under /run/lock are still managed by systemd for lack of better place.- udev requires systemd in its %post (bsc#1185958) udevadm, called in udev's %post, requires libsystemd-shared-xxx.so.- Import commit ac812b8fa0c2ce74bad8dd199aa0505621f6cfe7 2741672b14 nspawn: turn on higher optimization level in seccomp e104e31534 nspawn: return ENOSYS by default, EPERM for "known" calls (bsc#1186411) 6f2c44b6bb shared/seccomp-util: added functionality to make list of filtred syscalls 4bf1b121c1 shared/syscall-list: filter out some obviously platform-specific syscalls 0a3716ecb1 shared/seccomp: reduce scope of indexing variables 7820502e07 generate-syscall-list: require python3 3a180f788b shared: add @known syscall list 2fab3d0179 meson: add syscall-names-update target 74430ec23e shared/seccomp: use _cleanup_ in one more place- Import commit df3aa430629f9aab8821c7f882a401a2886b9e82 5354e4896a test-path: start infinite sleep instead of a short command 934358e538 system-conf: drop reference to ShutdownWatchdogUsec= f198dea989 home: fix homed.conf install location- Fix 1001-udev-use-lock-when-selecting-the-highest-priority-de.patch (bsc#1185828) We need to make sure that the creation of the symlinks is done after updating udev DB so if worker A is preempted by worker B before A updates the DB but after it creates the symlinks, worker B won't manage to overwrite the freshly created symlinks (by A) because A has still yet not registered the symlinks in the DB.- Expect 644 permissions for /usr/lib/udev/compat-symlink-generation (bsc#1185807)- Drop "%bcond_with parentpathid" as it's not used.- add conversion script for moving legacy collect based udev rules to chzdev based ones (bsc#1183984)- Import commit 60e71ffa7e339cfce8cf70d127f1be9134a573ac fa79627ef7 udev: ignore additional newline in sysfs attribute on verify (bsc#1182870) e0028b4c63 fileio: introduce a new flag to make write_string_file() ignore trailing newline 1928da1337 Add WRITE_STRING_FILE_TRUNCATE to set O_TRUNC- Fix again 1001-udev-use-lock-when-selecting-the-highest-priority-de.patch (bsc#1184859) This time is about the removal of /dev/disk/by-xxx/* symlink that can be attempted by several workers at the same time. Let's restore the old behavior in this regard and ignore any error that might happen during the removal.- Fix 1001-udev-use-lock-when-selecting-the-highest-priority-de.patch (bsc#1184254) When a symlink is removed because there's no more references to it make sure to remove the parent dir of the symlink as well. Also add some logging when something goes wrong during the removal.- systemd.spec: clean some of the build deps up: - libpcre is redundant with libpcre2 (only required by the full build) and the mini variant needs none of them. Hence drop the ref to libpcre. - normally libidn2 is needed by some optional features in systemd-network (only). But it's implicitly pulled in by libgnutls (required by the main package). Let's make sure the related features won't be disabled inadvertently in the future by making the dep explicit.- Fix fd leak in 1001-udev-use-lock-when-selecting-the-highest-priority-de.patch (bsc#1184238)- Import commit 480a6d14725509307a0f3edefef3876c107ee7f1 (merge of v246.13) 423b1e759c Revert "resolved: gracefully handle with packets with too large RR count" (bsc#1183745) 4723778738 meson.build: make xinitrcdir configurable (bsc#1183408) [...] For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/8baed1c6f82798c2374bdbfdd440dd065d09fb99...480a6d14725509307a0f3edefef3876c107ee7f1- Import commit 8baed1c6f82798c2374bdbfdd440dd065d09fb99 (merge of v246.11) For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/bb5a31f416d17c5d3521900bebad885ca8f0ba8b...8baed1c6f82798c2374bdbfdd440dd065d09fb99 - Rebase 0001-conf-parser-introduce-early-drop-ins.patch- Import commit bb5a31f416d17c5d3521900bebad885ca8f0ba8b 846d61e0a1 boot: Move console declarations to missing_efi.h 171a37228b boot: Add startswith() and endswith() functions with no_case variants 0fad9f309a boot: Drop unnecessary braces c38bbb0874 boot: Fix void pointer arithmetic warning 438210924b boot: Replace raw efivar gets with typed variants e46cb3e4a0 boot: Add efivar_get/set_uint64_le() functions e16bee35c8 boot: Rename efivar_get/set_int() to efivar_get/set_uint_string() 2808d0e9a3 boot: Tighten scope of variables used in loops d3f3d57743 boot: Add efivar_get_boolean_u8() 0551ecce71 boot: Make all efivar util functions take the guid as an argument 8376ba3b9f boot: Turn all guid constants into C99 compound initializers 166fc2dad2 boot: Enable C99 c87d66e261 boot: Move Secure Boot logic to new file da7bba9438 udev: fix memleak - Rebase 1001-udev-use-lock-when-selecting-the-highest-priority-de.patch- Make sure the udev socket units are reloaded during udev package updates This uses to be done on older SLE distros but got lost when we branched systemd for SLE15-SP3 from Base:System.- Update 1004-udev-don-t-create-by-partlabel-primary-and-.-logical.patch (bsc#1183702) StandardOutput=syslog+console is deprecated, use 'journal+console' instead which should achieve the same purpose.- fix-machines-btrfs-subvol.sh is only shipped when machined is built- Add 1001-udev-use-lock-when-selecting-the-highest-priority-de.patch (bsc#1181192)- Import commit 628333aae3e893e225a42fbbd3734d10058edeef e06139117c nspawn: make rootfs relative to oci bundle path (bsc#1182598) 8ba587d46c PATCH] Always free deserialized_subscribed on reload (bsc#1180020)- Drop 1000-logind-disable-RemoveIPC-by-default.patch Disabling RemoveIPC is now done through systemd-default-settings package.- systemd requires aaa_base >= 13.2 This dependency is required because 'systemctl {is-enabled,enable,disable} " ends up calling systemd-sysv-install which in its turn calls "chkconfig - -no-systemctl". aaa_base package has a weird versioning but the '--no-systemctl' option has been introduced starting from SLE12-SP2-GA, which shipped version "13.2+git20140911.61c1681". Spotted in bsc#1180083.- Add 0001-conf-parser-introduce-early-drop-ins.patch Introduce early configuration drop-in file. This type of drop-ins are reserved for vendor own purposes only and should never been used by users. It might be removed in the future without any notice.- Drop most of the tmpfiles that deal with generic paths (bsc#1078466 bsc#1181831) They are problematic because some of them conflict with SUSE defaults. Therefore it seems better to let the revelant packages owning these paths to provide their own definitions instead.- Drop use of %systemd_postun in %postun This macro is supposed to operate on units but it was used without passing any parameters. This call was probably used for issuing a daemon-reload but the following calls to %systemd_postun_with_restart imply that already. So let's simply drop it.- Add 0001-rules-don-t-ignore-Xen-interfaces-anymore.patch (bsc#1178561)- Import commit f366438ca2d66c287ea836174e73dd03a98914bf (merge of v246.10) 25f220eafb sysusers: flush nscd's caches whenever /etc/{passwd,group} are modified (bsc#1181121) For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/64dfb99ca3c9cbc75f6abe7aa6aa60f66ae4210d...f366438ca2d66c287ea836174e73dd03a98914bf- systemd-sysv-convert: handle the case when services are migrated from SysV scripts to systemd units and are renamed at the same time (bsc#1181788) The list of such services is hard coded and contains only the 'ntp->ntpd' translation.- Remove a fix specific to Factory/TW distros.- Leave nss files in /usr/lib*, glibc loads them from there just fine (Changes from Ludwig Nussel, backported from Factory) - Define %_pamdir until it's defined by pam-devel in SLE- Use %_pamdir to install pam modules- Import commit 64dfb99ca3c9cbc75f6abe7aa6aa60f66ae4210d 65f4fa852e write_net_rules: set execute bits (bsc#1178561) 4a543f0257 journal: send journald logs to kmsg again- Import commit 68b1d8a9472091ccfbbc2ca234d2583716d57a2a (include merge of v246.9) 26df96473f busctl: add a timestamp to the output of the busctl monitor command (bsc#1180225) For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/2acc5eb602eb8029f4547e37eb433c804a7db3a1...68b1d8a9472091ccfbbc2ca234d2583716d57a2a- Enable support for zstd compression systemd-journald will now use zstd for compressing large fields in journal files. systemd-coredump will also use this algorithm to compress coredump files. Please note that systemd older than v246 won't be able to read new journal files as zstd algorithm is not supported by these versions. This incompatible change was actually not the only one introduced by v246 since the hash tables in journal files have been hardened against hash collisions too in an incompatible way with older versions.- Drop 1001-journald-turn-ForwardToSyslog-on-by-default.patch ForwardToSyslog is turned on by rsyslog.- Explicitly require group(kvm) by udev: the group used to be created by system-users-hardware, but has been split/moved to qemu/kvm, where it is more logical. The file /usr/lib/udev/rules.d/50-udev-default.rules references this group, thus we should make sure the group exists. Otherwise there are errors in the journal in the form of: /usr/lib/udev/rules.d/50-udev-default.rules:86 Unknown group 'kvm', ignoring- Import commit 2acc5eb602eb8029f4547e37eb433c804a7db3a1 (include merge of v246.7) 6131548b0f udev: link_update() should fail if the entry in symlink dir couldn't have been created f6cb8c7d79 udev: make algorithm that selects highest priority devlink less susceptible to race conditions (bsc#1084748) fc64e47291 basic/stat-util: make mtime check stricter and use entire timestamp ae91d45d3d test/sys-script.py: add missing DEVNAME entries to uevents 09e3473a7a test/udev_test.pl: add "expected good" count fc89379b5b test/udev-test.pl: suppress umount error message at startup d9e114f10d test/sd-script.py: new helper script for udev testing f2672eae66 test/udev-test.pl: generator for large list of block devices 42b68e43e2 test/udev-test.pl: add repeat count eec8ec375a tests/udev-test.pl: add multiple device test 73b8f3cf93 test/udev-test.pl: count "good" results ee04d70bb6 test/udev-test.pl: merge import parent tests into one 03942c8fbc test/udev-test.pl: merge "space and var with space" tests ec95546189 test/udev-test.pl: remove bogus rules from magic subsys test f704429217 test/udev-test.pl: Make some tests a little harder ce1a877dc0 test/udev-test.pl: last_rule is unsupported 913c72ff2d test/udev-test.pl: fix wrong test descriptions eeb25a1be6 test/udev-test.pl: allow checking multiple symlinks 00ab4292da test/udev-test.pl: test correctness of symlink targets 5b71ee2911 test/udev-test.pl: use computed devnode name 2e04bb9ae8 test/udev-test.pl: allow concurrent additions and removals 8816dd593c test/udev-test.pl: create rules only once 214418632d test/udev-test.pl: allow multiple devices per test 1eb6b23f27 udev-test: do not rely on "mail" group being defined 4a0a4dcf10 udev: Fix sound.target dependency (bsc#1179363) For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/9dd0c9a724a9361207ab4a9ad29d144987fb373f...2acc5eb602eb8029f4547e37eb433c804a7db3a1 - Rebase 1008-Restore-support-for-halt.local.patch- Import commit 9dd0c9a724a9361207ab4a9ad29d144987fb373f 450792497e sd-event: fix delays assert brain-o (#17790) 1040a19d08 udevadm: rename option '--log-priority' into '--log-level' a7b41e19bd udev: rename kernel option 'log_priority' into 'log_level' 617aed9236 scope: on unified, make sure to unwatch all PIDs once they've been moved to the cgroup scope- Don't post-require systemd-default-settings-branding anymore This is actually not needed now that the branding package issues a PID1 reloading every times it's being updated.- Import commit e139d4c9dbf6d735a624574dbd7db8f04eb93598 f8f7286527 units: restore sysfs conditions in sys-fs-fuse-connections.mount and sys-kernel-config.mount e9c7158dc7 units: wait until some fs modules are entirely loaded before mounting their corresponding filesystem (bsc#1178631) ac7ddc4201 Revert "units: skip modprobe@.service if the unit appears to be already loaded" 17310a1d19 core: serialize u->pids until the processes have been moved to the scope cgroup (bsc#1174436) 1416965614 meson: add option to skip installing to $sysconfdir- systemd-default-settings is needed by %post scriptlet- Revert the change that dropped %{release} from the package version constraints used in Requires: The release number is actually relevant since it can be increased when patches, which might touch multiple sub-packages of systemd, are added/modified. However the %{release} is still no more used in conflicts.- Simplify systemd-sysv-convert - the previous code incorrectly assumed that the sysv init scripts were uninstalled before %post get executed. It therefore save the enablement state in %pre and restore it in %post. Now all is done in %post (making --save option useless) and there's no more need to remember the enablement state. - "--save" option is a NOP but is still kept for backward compatibility. - the previous simplifcation made /var/lib/systemd/migrated no more used. - we do not search for units in /lib/systemd anymore, this shouldn't be needed anymore these days especially since this path was only used when systemd was introduced in openSUSE and it was never used in SLE (checked SLE12-GA). - the option --show has been dropped. It's never been used even internally. - the DB is populated only once even if the script was enabled at multiple runlevels. The runlevel info was never used. A dummy value is still added to keep the same format just in case.- Import commit 7435299e24327ed202d686bf46a626b99f105870 f71a1ef5d0 systemctl: give a nice hint about org.freedesktop.LogControl1 when applicable 20a3f9fd95 systemctl: immediately reject invalid log levels 9f67d2e57b systemctl: merge log_target(), log_level(), service_log_setting() ddf7cf4872 systemctl: add service-log-{level,target} verbs 026d7d156d systemctl: list unit introspection verbs first, modification second 05fff5bd02 generator: use kmsg in system-level generators, journal otherwise ecc07954de log: normalize log target condition check d32ceea42b log: update comment 2ebad02b60 basic/virt: Detect PowerVM hypervisor (bsc#1176800) - Drop workaround in 1006-logind-keep-backward-compatibility-with-UserTasksMax.patch which consisted in forcing the generator to use kmsg. It is no more needed since commit dee29aeb5909f4f5604012ced250488286b8d468 has been backported.- Move systemd-sysv-convert back from /usr/lib/systemd to /usr/sbin (bsc#1178156) SLE distros still expect the tool to be located in the old place.- Fix paths of udev rule files in 1004-udev-don-t-create-by-partlabel-primary-and-.-logical.patch and 1005-udev-optionally-disable-the-generation-of-the-partla.patch (bsc#1178023)- No more need to clean the journal-upload stuff with --without=journal_remote Since -Dremote build option has been introduced with meson, this workaround is no more needed.- Move journal-{remote,upload}.conf.5.gz man pages into systemd-journal_remote sub package- Explicitly list files in /usr/lib/sysusers.d shipped by the main package Currently only one config file is shipped in this directory and we want to check any new files that may be added in the future.- Use %{_modulesloaddir}, %{_environmentdir} and %{_modprobedir} wherever appropriate- Do not include %{release} in a few places where we explicitly mention package versions It's usually not a good idea especially when used with conflicts.- Rely on systemd-default-settings for overriding system default settings (bsc#1172517) The new branding packages now ships the drop-ins to customize systemd either for an openSUSE or a SLE ditro.- Remove mq-deadline selection from 60-io-scheduler.rules (bsc#1177490)- Make systemd-mini-container conflict with systemd-mini-container-mini systemd-mini-container-mini was the old name used by older versions.- tmpfiles: drop entries importing files from /usr/share/factory (bsc#1170146)- SLEtify commit 2ac606cb508dc30a27aa539bcc18b4bb07f87a71 (jsc#SLE-16318) This forward port most of the SLE stuff from SLE15-SP2 to this Factory snapshot making this version good enough for starting testing the version that will be shipped in SLE15-SP3. Add 1000-logind-disable-RemoveIPC-by-default.patch Add 1001-journald-turn-ForwardToSyslog-on-by-default.patch (bsc#1065301) Add 1002-udev-add-option-to-generate-old-buggy-SCSI-serials.patch Add 1003-logind-store-a-timestamp-when-the-ACPI-power-button-.patch (bsc#981830 bsc#888612 bsc#1072933) Add 1004-udev-don-t-create-by-partlabel-primary-and-.-logical.patch Add 1005-udev-optionally-disable-the-generation-of-the-partla.patch (bsc#1089761) Add 1006-logind-keep-backward-compatibility-with-UserTasksMax.patch Add 1007-tmpfiles-follow-SUSE-policies.patch Add 1008-Restore-support-for-halt.local.patch Add 60-io-scheduler.rules (bsc#1165579 bsc#1164717) Add 80-acpi-container-hotplug.rules (bsc#1082485 bsc#1040800 bsc#1078358 bsc#1081170 bsc#1075743) Add 80-hotplug-cpu-mem.rules (bsc#1076696 bsc#1127557) Add 99-wakeup-from-idle.rules merge compats/persistent-nic-names (bsc#1061883 bsc#1083158) merge compats/udev-compat-symlinks networkd is kept enabled as it's shipped in Leap distros (bsc#1071311) Remove TasksMax limit for both user and system slices (jsc#SLE-10123). This implemented by means of 2 drop-ins shipped in system.conf.d/ and user-.slice.d/- Import a prisitine copy of Factory which will serve as a new base for SLE15-SP3 (osc copypac from project:Base:System package:systemd revision:1120, using expand, using client side copy)- Remove dangling symlink /usr/lib/systemd/system/sockets.target.wants/systemd-journald-audit.socket Otherwise the build system complains.- Import commit 1cab0d44584687ace92d1df30eadf264231e3b65 (include v246.5) 304ec2c7ab fstab-generator: add 'nofail' when NFS 'bg' option is used (bsc#1176513) 6ae277fb37 test: adapt TEST-21-SYSUSERS for SUSE acd8bfd2cc test: adapt TEST-13-NSPAWN-SMOKE for SUSE [...] For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/a4e393eecb9dbe140a6c7d57419c291d786155cf...1cab0d44584687ace92d1df30eadf264231e3b65- Drop 0001-udev-temporarly-restore-the-creation-a-few-symlinks-.patch linuxrc has already been fixed.- Add 0001-udev-temporarly-restore-the-creation-a-few-symlinks-.patch A temporary patch until the installer environment is updated to create some of the symlinks that udevd used to create during its startup but now udevd relies on the init system to do so.- Rework how we prevent journald from both enabling auditd and recording audit messages journald.conf gained a new setting Audit= to control whether journald enables audit during the boot process. So let's use it and make sure it's disabled by default by shipping a drop-in that overrides upstream default. Also we used to patch systemd to prevent journald from reading the audit messages. There's still no way for downstream to configure that properly (we would need to mask systemd-journald-audit.socket meaning shipping a symlink in /etc) but I think dropping systemd-journald-audit.socket from the package is a nicer way to do that as some users might choose to reenable this setting (by reintroducing the socket unit in /etc).- Enable audit support (bsc#1175883) Enabling audit support in systemd will only make PID1 (and some of its services) to generate some audit records for certain events. But it doesn't affect journald, which has been prevented from recording audit messages in the journal (SUSE specific behavior).- Upgrade to v246.4 (commit f1344d5b7f31e98aedb01e606f41d74d3caaf446) See https://github.com/openSUSE/systemd/blob/SUSE/v246/NEWS for details. Now that the number of SUSE specific patches has been shrinked and is pretty low (12 at the time of this writing), they are no more tracked by the git repo and are now handled at the package level. Hence It is easier to maintain and identify them. This effectively means that SUSE/v246 will contain upstream commits only. Added 0001-restore-var-run-and-var-lock-bind-mount-if-they-aren.patch Added 0002-rc-local-fix-ordering-startup-for-etc-init.d-boot.lo.patch Added 0003-strip-the-domain-part-from-etc-hostname-when-setting.patch Added 0004-tmpfiles-support-exclude-statements-based-on-file-ow.patch Added 0005-udev-create-default-symlinks-for-primary-cd_dvd-driv.patch Added 0006-sysv-generator-add-back-support-for-SysV-scripts-for.patch Added 0007-networkd-make-network.service-an-alias-of-systemd-ne.patch Added 0008-sysv-generator-translate-Required-Start-into-a-Wants.patch Added 0009-pid1-handle-console-specificities-weirdness-for-s390.patch Added 0010-journald-disable-audit-support-completely-from-the-j.patch Added 0011-core-disable-session-keyring-per-system-sevice-entir.patch Added 0012-resolved-create-etc-resolv.conf-symlink-at-runtime.patch- Adjust %pre and %post for the restoration of upstream tmp.mount (boo#1175779)- Import commit a4e393eecb9dbe140a6c7d57419c291d786155cf d8e3bd4e22 Revert "core: don't send SIGKILL to user@.service immediatly during shutdown"- Drop requirement on 'sysvinit-tools' It was used to workaround bug #886599 by explicitly calling vhangup(8) from getty@.service so when this service was stopped a virtually hangup on the specified terminal when were stopped to give the shell a few seconds to save its history. But this workaround was dropped since it had no effect (SLE12-GM was released with it but was still suffering from the bug) and was replaced by commit e9db43d5910717a108, which was released from v226 and backported to SLE12/SLE12-SP1.- Import commit 6d6d92930acad63f9b9029c305a672c32c550d2d (include merge of v245.7) 797ad47d3e vconsole-setup: downgrade log message when setting font fails on dummy console (bsc#1172195 bsc#1173539) [...] For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/b12cd8b89b4bccfcf972b47153a2b01cd7775932...6d6d92930acad63f9b9029c305a672c32c550d2d - Drop 0001-Revert-job-Don-t-mark-as-redundant-if-deps-are-relev.patch Upstream finally reverted it and it's part of both v245.7 and master.- Restore default upstream tmp.mount (/tmp as tmpfs) behaviour (boo#1173461)- migrate-sysconfig-i18n.sh: fix marker handling (bsc#1173229) The marker is used to make sure the script is run only once. Instead of storing it in /usr, use /var which is more appropriate for such file. Also make it owned by systemd package.- Fix inconsistent file modes for some ghost files (bsc#1173227) Ghost files are assumed by rpm to have mode 000 by default which is not consistent with file permissions set at runtime. Also /var/lib/systemd/random-seed was tracked wrongly as a directory. Also don't track (ghost) /etc/systemd/system/runlevel*.target aliases since we're not supposed to track units or aliases user might define/override.- Include in the package version the stable minor (if any). Also update the version shown by various command such as 'systemctl - -version' to show the stable number.- Don't restart udevd sockets during package update Otherwise we might miss kernel events as the daemon need to be stopped as well.- Import commit b12cd8b89b4bccfcf972b47153a2b01cd7775932 (include merge of v245.6) For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/a6d31d1a02c2718a064bbbc40d003668acf72769...b12cd8b89b4bccfcf972b47153a2b01cd7775932- no longer explicitly package setgid directory /var/log/journal (bsc#1172550). The bit will be set during %post by way of the systemd-tmpfiles invocation. This avoids a conflict with the permissions package and an rpmlint error popping up.- Fix build when resolved is disabled While at it sort the build conditionals.- Import commit a6d31d1a02c2718a064bbbc40d003668acf72769 bb6e2f7906 pid1: update manager settings on reload too (bsc#1163109) e9e8907b06 watchdog: reduce watchdog pings in timeout interval 385a8f9846 udev: rename the persistent link for ATA devices (bsc#1164538) 66018a12ae tmpfiles: remove unnecessary assert (bsc#1171145)- Disable bump of /proc/sys/fs/nr-open Hopefully a _temporary_ workaround until bsc#1165351 is fixed otherwise user instances crashes the system is using NIS (and the nscd cache is empty).- Drop legacy /sbin/{udevd,udevadm) symlinks hopefully for good Since boo#1160890 has been fixed since a couple of months now.- Drop content of /usr/share/factory/ (bsc#1170146) systemd ships several files in /usr/share/factory/etc that are copied to /etc in case those files are missing there. Unfortunately the content does not match the openSUSE defaults.- Drop most of the tmpfiles that deal with generic paths (bsc#1078466) They are problematic because some of them conflict with SUSE defaults. Therefore it seems better to let the revelant packages owning these paths to provide their own definitions instead. Meanwhile we still keep the homeless definitions in suse.conf until a better place is found for them. Drop 0001-Fix-run-lock-group-to-follow-openSUSE-policy.patch Drop 0001-SUSE-policy-do-not-clean-tmp-by-default.patch- Drop %tmpfiles_create portables.conf from %post of networkd sub-package It was probably mistakenly added because systemd-portable served as template for systemd-network.- Import commit 08cd65ac385c884ed6e4bd71128a0796f56ecd17 (include merge of v245.5) 1ceedf8535 meson: fix build of udev 'path_id_compat' builtin with meson 0.54 e61569d4a9 pid1: by default make user units inherit their umask from the user manager (bsc#1162698) 64fdacd5f1 user-util: rework how we validate user names (bsc#1170272) [...] For a complete list of changes, visit: https://github.com/openSUSE/systemd/compare/c5aa158173ced05201182d1cc18632a25cf43b94...08cd65ac385c884ed6e4bd71128a0796f56ecd17- Drop 0001-meson-fix-build-of-udev-path_id_compat-builtin-with-.patch It's been merged in 'openSUSE-Factory' branch otherwise this branch won't build anymore since meson has been upgraded to version 0.54 in Factory.- Switch back to the hybrid hierarchy Unfortunately Kubernetes and runc are not yet ready for cgroupsv2. Let's reconsider the unified hierarchy in a couple of months.- Import commit c5aa158173ced05201182d1cc18632a25cf43b94 (merge v245.4)- Add 0001-meson-fix-build-of-udev-path_id_compat-builtin-with-.patch- Import commit 31f82b39c811b4f731c80c2c2e7c56a0ca924a5b (merge v245.2) d1d3f2aa15 docs: Add syntax for templated units to systemd.preset man page 3c69813c69 man: add a tiny bit of markup bf595e788c home: fix segfault when parsing arguments in PAM module e110f4dacb test: wait a bit after starting the test service e8df08cfdb fix journalctl regression (#15099) eb3a38cc23 NEWS: add late note about job trimming issue 405f0fcfdd systemctl: hide the 'glyph' column when --no-legend is requested 1c7de81f89 format-table: allow hiding a specific column b7f2308bda core: transition to FINAL_SIGTERM state after ExecStopPost= 2867dfbf70 journalctl: show duplicate entries if they are from the same file (#14898) [...]- Upgrade to v245 (commit 74e2e834b4282c9bbdc12014f6ccf8d86e542b8d) See https://github.com/openSUSE/systemd/blob/SUSE/v245/NEWS for details. This includes the following bug fixes: - upstream commit 7f56982289275ce84e20f0554475864953e6aaab (CVE-2020-1712) - upstream commit 66a19d85a533b15ed32f4066ec880b5a8c06babd (bsc#1157315) - upstream commit 7f56982289275ce84e20f0554475864953e6aaab (bsc#1162108) The new tools provided by systemd repart, userdb, homed, fdisk, pwquality, p11kit feature have been disabled for now as they require reviews first. Default to the "unified" cgroup hierarchy. Indeed most prominent users of cgroup (such as libvirt, kubic) should be ready for such change. It's still possible to switch back to the old "hybrid" hierarchy by passing "systemd.unified_cgroup_hierarchy=0" option to the kernel command line though. Added 0001-Revert-job-Don-t-mark-as-redundant-if-deps-are-relev.patch: upstream commit 097537f07a2fab3cb73aef7bc59f2a66aa93f533 has been reverted for now on as it introduced a behavior change which has impacted plymouth at least.- add systemd-network-generator.service file together with systemd-network-generator binary- move html documentation to sparate package to save space - move networkd and resolved binaries into correct subpackage- Import commit f8adabc2b1f3e3ad150e7a3bfa88341eda5a8a57 (merge v244.2) 77c04ce5c2 hwdb: update to v245-rc1 b4eb884824 Fix typo in function name e2d4cb9843 polkit: when authorizing via PK let's re-resolve callback/userdata instead of caching it 83bfc0d8dd sd-bus: introduce API for re-enqueuing incoming messages 5926f9f172 polkit: use structured initialization 0697d0d972 polkit: on async pk requests, re-validate action/details 2589995acd polkit: reuse some common bus message appending code 5b2442d5c3 bus-polkit: rename return error parameter to ret_error 0a19ff7004 shared: split out polkit stuff from bus-util.c → bus-polkit.c 1325dfb577 test: adapt to the new capsh format 3538fafb47 meson: update efi path detection to gnu-efi-3.0.11 3034855a5b presets: "disable" all passive targets by default c2e3046819 shared/sysctl-util: normalize repeated slashes or dots to a single value 6f4364046f dhcp6: do not use T1 and T2 longer than one provided by the lease 0ed6cda28d network: fix implicit type conversion warning by GCC-10 f6a5c02d26 bootspec: parse random-seed-mode line in loader.conf ddc5dca8a7 sd-boot: fix typo 2bbbe9ae41 test: Synchronize journal before reading from it 072485d661 sd-bus: fix introspection bug in signal parameter names 80af3cf5e3 efi: fix build. [...]- Use suse.pool.ntp.org server pool on SLE (jsc#SLE-7683)- Drop scripts-udev-convert-lib-udev-path.sh Nobody should need it these days.- Temporarily restore /sbin/{udevd,udevadm) obsolete symlinks They're restored until YaST stop using them (see boo#1160890)- Import commit 8254b8d9646f3e0f5f8057d1ffb5d6c20f079aaa (merge v244.1) 639dc9f4bf network: set ipv6 mtu after link-up or device mtu change cbced49daa man: fix typo in net-naming-scheme man page 7dd04c99b0 network: tc: drop unused element bf4b7d07ba man: fix typos (#14304) 1ba2e7a730 ipv4ll: do not reset conflict counter on restart 49806bb310 macro: avoid subtraction overflow in ALIGN_POWER2() c4c1600689 test-network: add a test case for SendOption= 6f15b45949 network: fix segfault in parsing SendOption= 2e531b830d seccomp: real syscall numbers are >= 0 f7616ed52b network: fix copy and paste mistake e8b53300c4 network: do not drop foreign config if interface is in initialized state 00f05813bf seccomp: mmap test results depend on kernel/libseccomp/glibc 4de1909e61 seccomp: use per arch shmat_syscall d83010521d seccomp: ensure rules are loaded in seccomp_memory_deny_write_execute 2c6568221a seccomp: fix multiplexed system calls bcf0aa02bf Fix typo (duplicate "or") 96d7083c54 network: if /sys is rw, then udev should be around e874419902 nspawn: do not fail if udev is not running 29c9144655 Create parent directories when creating systemd-private subdirs 9cbb8b5254 network: do not return error but return UINT64_MAX if speed meter is disabled c08429ae33 core: swap priority can be negative f25c0be335 networkctl: fix to show BSSID 65fd2fce59 systemctl: enhance message about kexec missing kernel bdd0af5f81 Fixup typo in NEWS- Manually set system-uid-max and system-gid-max to 499 It used to be detected automatically by meson but it's been broken by the migration of login.defs from /etc to /usr/etc.- Import commit d8f6a204858bff68b8e0e7be86b418c36087ab2e 6c5e492a65 cryptsetup: umount encrypted devices before detaching it during shutdown- Upgrade to v244 (commit 090da85161ceb1ba0b4c208963c7156a8fdf10c6) See https://github.com/openSUSE/systemd/blob/SUSE/v244/NEWS for details. This includes the following bug fixes: - upstream commit b49e14d5f3081dfcd363d8199a14c0924ae9152f (bsc#1139459) - upstream commit 22683674716fd0e5b016ce5a7d8fd90df5f9f9e7 (bsc#1151377) - upstream commit faf205de3ba9a11b0ba17682123d7f3fedc7da24 (bsc#1151377) - upstream commit 27c3112dcbd1b5f171c36c32550d9c6331375b0b (bsc#1155574) - upstream commit 21b40f16622f171a9969dc334d74fb5eb2f575c2 (bsc#1159814) - upstream commit 9b88bb5023dfa3cea406c14fdaa3d8e3e320907a (jsc#SLE-7689) Legacy and obsolete symlinks have been finally dropped. Dropped 0001-logind-keep-backward-compatibility-with-UserTasksMax.patch. Users were notified about the deprecation of UserTasksMax option and how to move to the new mechanism. The dropin replacement for UserTasksMax is therefore no more generated but its use still produces a warning. Added 0001-SUSE-policy-do-not-clean-tmp-by-default.patch and 0001-Fix-run-lock-group-to-follow-openSUSE-policy.patch. These patches were extracted from the git repo because it's not clear where the SUSE tmpfiles specificities should be located.- Import commit dbb1d4734daffa62e0eddecfa4f784c84a9d8e76 1439d72a72 udevd: don't use monitor after manager_exit() 99288dd778 Revert "udevd: fix crash when workers time out after exit is signal caught" 152577d6d0 udevd: fix crash when workers time out after exit is signal caught f854991504 udevd: wait for workers to finish when exiting (bsc#1106383) Changes from the v243-stable (84 commits): e51d9bf9e5 man: add entry about SpeedMeter= aa1fc791c7 udev: silence warning about PROGRAM+= or IMPORT+= rules b9a619bb67 udevadm: ignore EROFS and return earlier 1ec5b9f80c basic: add vmware hypervisor detection from device-tree 7fa7080248 umount: be happy if /proc/swaps doesn't exist [...] 47d0e23d26 udev: fix memleak caused by wrong cleanup function a6fb0542c5 parse_hwdb: fix compatibility with pyparsing 2.4.* cb1d892f17 parse_hwdb: process files in order- Import commit 0b715187a87907e18edf98eab9d0a50fced4a424 9dbdbc2f10 logind: fix (again) the race that might happen when logind restores VT (bsc#1101591 bsc#1140081) c848bec110 libblkid: open device in nonblock mode. (bsc#1084671) b70ad6c927 resolved: check for IP in certificate when using DoT with GnuTLS (bsc#1155539 CVE-2018-21029) bbedf3d557 resolved: require at least version 3.6.0 of GnuTLS for DNS-over-TLS eb732c2e29 resolved: fix connection failures with TLS 1.3 and GnuTLS 4e45084ac5 shared/install: failing with -ELOOP can be due to the use of an alias in install_error() 2e297f0d87 shared/install: fix error codes returned by install_context_apply() dd29d70d32 man: alias names can't be used with enable command- Fix %{_libexecdir} misuses of /usr/lib- Drop 0001-compat-rules-escape-when-used-for-shell-expansion.patch It's part of the previous import.- Import commit b7467b7b553d6d0d6f92758d966b69f1a88b6b42 441f44f371 fileio: introduce read_full_virtual_file() for reading virtual files in sysfs, procfs (bsc#1133495) 8a1bb5c66b swap: do not make swap units wanted by its device unit anymore- Import commit 5df9000899ef7d45ddbcacd0fdf73afa07a40f6b f0ed7237e4 udev/cdrom_id: Do not open CD-rom in exclusive mode. (bsc#1154256) b37054aa5a compat-rules: escape '$' when used for shell expansion Changes from the v243-stable: ef677436aa test: Pass personality test even when i686 userland runs on x86_64 kernel 3f6398c450 docs: fix inadvertent change in uid range 25bb377a73 cgroup: fix typo in BPF firewall support warning message 6d97aca0d5 fix build with compilers with default stack-protector enabled fbad077cec nspawn: surrender controlling terminal to PID2 when using the PID1 stub 0553c3c668 pid1: fix DefaultTasksMax initialization f406a691a7 src/core/automount: use DirectoryMode when calling mkdir -p 20438f96c3 udevadm trigger: do not propagate EACCES and ENODEV 6480630bc3 hwdb: Correct WWWW Pattern In Documentation Comment 9d8e889810 nspawn: consistenly fail if parsing the environment fails 40e169b304 nspawn: default to unified hierarchy if --as-pid2 is used b5df1037a0 cgroup: Mark memory protections as explicitly set in transient units f14e3e02cc cgroup: Respect DefaultMemoryMin when setting memory.min ea248e53bf cgroup: Check ancestor memory min for unified memory config de1d25a506 cgroup: docs: memory.high doc fixups 2ab45f38d8 cgroup: docs: Mention unbounded protection for memory.{low,min} 19a43dc38a Consider smb3 as remote filesystem 5c0224c7bf Handle d_type == DT_UNKNOWN correctly 8282bc61df util-lib: Don't propagate EACCES from find_binary PATH lookup to caller 9d0ae987a6 network: drop noisy log message f67f0e4ec4 Updated log message when the timesync happens for the first time (#13624) e151bf4674 units: make systemd-binfmt.service easier to work with no autofs 2b8e574d82 Corect man page reference in systemd-nologin.conf comments a0577353f1 man: Add a missing space in machinectl(1) 693e983988 log: Add missing "%" in "%m" log format strings ea7151b8c4 pid1: do not warn if /run/systemd/relabel-extra.d/ doesn't exist b90549290e man: fix typo- Remove intltool BuildRequires, not needed since v237 - Use python3-base BuildRequires instead of full python3- Add 0001-compat-rules-escape-when-used-for-shell-expansion.patch (bsc#1153648) Added to the quaratine area to avoid uploading a new tar ball just for that single change. It will be dropped during the next import.- don't package locales in -mini package- Import commit 428b937f917ae177f2315e8469800941885e441a 0026b58744 pid1: fix DefaultTasksMax initialization- Import commit ed81f69153488279957268e247a5c81b678da491 (changes from v243-stable) fab6f010ac dhcp6: use unaligned_read_be32() f2d9af4322 dhcp6: add missing option length check ccf797511e ndisc: make first solicit delayed randomly f2275b6e12 dhcp6: read OPTION_INFORMATION_REFRESH_TIME option 6dfbe58ee7 l10n: update Czech Translation d4cd0e9d32 sd-radv: if lifetime < SD_RADV_DEFAULT_MAX_TIMEOUT_USEC, adjust timeout (#13491) dbefe59259 polkit: fix typo a321507476 sd-netlink: fix invalid assertion 45dca7fe86 network: do not enter failed state if device's sysfs entry does not exist yet dd83d58796 network: add missing link->network checks b294305888 path: stop watching path specs once we triggered the target unit 2cd636c437 hwdb: add Medion Akoya E2292 (#13498) d133bdd1fa po: update Brazilian Portuguese translation 530e09b594 po: update Polish translation 0c5c3e34c1 polkit: change "revert settings" to "reset settings" 73e0f372d8 man: fix description of ARPIntervalSec= units 5412cc54a1 hwdb: axis override for Dell 9360 touchpad 9d4e658529 test: drop the missed || exit 1 expression 7ed7ea82f6 udevadm: use usec_add() 477bf86c91 udevadm: missing initialization of descriptor 19ac31c989 networkd: unbreak routing_policy_rule_compare_func() a20a2157a8 core: coldplug possible nop_job eb55241742 tty-ask-pwd-agent: fix message forwarded to wall(1) 1a3c53c06c core: Fix setting StatusUnitFormat from config files 91db81e4dd network DHCP4: Dont mislead the logs. 6af590838b Update m4 for selective utmp support. modified: tmpfiles.d/systemd.conf.m4 6823c907cf core: restore initialization of u->source_mtime 29308bcc13 mount-setup: relabel items mentioned directly in relabel-extra.d 8ca1e56165 Call getgroups() to know size of supplementary groups array to allocate 5d84a7ad1c test: add test cases for empty string match 1536348cc8 udev: fix multi match 3ccafef0ad man: move TimeoutCleanSec= entry from .service to .exec 8c0c30a820 zsh: udpate bootctl completions 0556c247a2 resolved: fix abort when recv() returns 0 9a25d75520 man: remove repeated words be3be29347 hwdb: Also mark lis3lv02d sensors in "HP" laptops as being in the base 4b92ffccaa udev: also logs file permission 75a2845e5a udev: add missing flag for OPTIONS=static_node 19e9fc4262 network: do not abort execution when a config file cannot be loaded 3e1267cf50 fileio: update warning message 1b3156edd2 pstore: fix use after free f500d2fa81 journal: Make the output of --update-catalog deterministic 64d0f7042d travis: protect the systemd organization on Fuzzit from forks 4247938ee1 hwdb: Mark lis3lv02d sensors in HP laptops as being in the base 379158684a po: update Japanese translation 31e1bbd1ca docs: fix push recipe in RELEASE.md f06530d86b man/systemctl.xml: fix missing "not" 22aba2b969 docs: fix typo in boot loader doc 000e08ca70 pstore: fix typo in error message - directoy -> directory f7f9c69ac5 Fix typo in comment: overide -> override ca8ba8f8c0 po: update Polish translation- Some files related to the portable stuff were missing some %exclude- Allow YaST to select Iranian (Persian, Farsi) keyboard layout (bsc#1092920)- split off networkd and resolved into separate network subpackage - use separate lang package for translations- Import commit 9e41d7ec3572d8d5ea1e00f683e9fbf8108e85b4 fb1b9d54f9 tty-ask-pwd-agent: fix message forwarded to wall(1) dd14da3bb6 core: restore initialization of u->source_mtime d62f30f647 resolved: create /etc/resolv.conf symlink at runtime- Slighly rework (mostly reorganization) the portable stuff- Track 0001-resolved-create-etc-resolv.conf-symlink-at-runtime.patch in the git repo This patch has been in the quarantine area long enough, so let's move it in the git repo.- Upgrade to v243 (commit e0b24c4356aa0c1c56ff274ff72228f33482a5be) See https://github.com/openSUSE/systemd/blob/SUSE/v243/NEWS for details. This includes the following bug fixes: - upstream commit b2774a3ae692113e1f47a336a6c09bac9cfb49ad (CVE-2019-20386 bsc#1161436) - upstream commit 5406c36844b35504a64e9f05fc74b8e5e5a09143 (bsc#1132400) - upstream commit 83a32ea7b03d6707b8e5bb90a0b3a6eb868ef633 (bsc#1132721) - upstream commit 7cc5ef5f1811c539ae7f20255c2a093f413cc64f (bsc#1172824 bsc#1142733) - upstream commit 83cb24ac20baf19f7834931dcf6e03486b4c9c30 (bsc#1156213) - upstream commit a2dcb1d78737d3daa301ee63fbdd02837acb71a8 (bsc#1158485) - upstream commit 08185cff19efcb1d7d9fb7b546e7f516ab6dae91 (bsc#1165011) - upstream commit 59c55e73eaee345e1ee67c23eace8895ed499693 (bsc#1177510) Drop 0001-Revert-insserv.conf-generator.patch as it's been dropped from branch SUSE/v243 while we were rebasing. Drop 0001-rc-local-generator-deprecate-halt.local-support.patch as this functionality had been deprecated during the previous release and now have been dropped by upstream.- enable systemd-portabled- systemd-container creates and owns /etc/systemd/nspawn now- Import commit 0f9271c1336c5c9055e75389732a44745d796851 (changes from v242-stable) 07f0549ffe network: do not send ipv6 token to kernel 9d34e79ae8 systemd-mount: don't check for non-normalized WHAT for network FS 5af677680c core: set fs.file-max sysctl to LONG_MAX rather than ULONG_MAX (bsc#1142099) 29dda7597a random-util: eat up bad RDRAND values seen on AMD CPUs eb6c17c178 util-lib: fix a typo in rdrand 829c20dc8e random-util: rename "err" to "success" 5442366fbf man: rework the description of Aliases and .wants/.requires directories ae71c6f634 docs: typo in arg name replace-irreversible -> replace-irreversibly 09774a5fcb meson: make nologin path build time configurable 69ffeeb0b1 man: add note about systemctl stop return value 4cf14b5513 shared/conf-parser: say "key name" not "lvalue", add dot 4481ca7f86 shared/conf-parser: emit a nicer warning for something like "======" 46f3db894b shared/conf-parser: be nice and ignore lines without "=" 7d928995f7 nspawn: fix memleak in argument parsing 7727e6c0ae resolve: fix memleak 7f32a81976 journal: properly read unaligned le64 integers fa419099e5 activate: move array allocation to heap 815a9fef2a systemctl: print non-elapsing timers as "n/a" not "(null)" a4fc3c88f1 factory: include pam_keyinit.so in PAM factory configuration a453d63315 factory: add comment to PAM file, explaining that the defaults are not useful d9a5a70a59 factory: tighten PAM configuration 5e2d3bf80b test: make sure colors don't confuse our test 5fe3be1334 wait-online: change log level c49b6959d5 systemctl: emit warning when we get an invalid process entry from pid1 and continue 3c9f43eb03 systemctl: do not suggest passing --all if the user passed --state= 5964d1474e man: offline-updates: make dependence on system-update.target explicit a04dd26e03 alloc-util: drop _alloc_ decorator from memdup_suffix0() 7c46a694ca man: add example for setting multiple properties at once 1d72789271 man: CPUShares= is so 2015 45da304673 man: document that WakeSystem= requires privs bed58a06e4 man: document that "systemd-analyze blame/critical-chain" is not useful to track down job latency c5461f31b3 man: be more explicit that Type=oneshot services are not "active" after starting 455ee07abe man: document that the supplementary groups list is initialized from User='s database entry 5f0cb2616a alloc-util: drop _alloc_(2, 3) decorator from memdup_suffix0_multiply() 7bc336794d generator: downgrade Requires= → Wants= of fsck from /usr mount unit 66465c4381 systemctl: allow "cat" on units with bad settings ca937b49da pid1: fix serialization/deserialization of commmands with spaces 4bb3113023 growfs: call crypt_set_debug_level() correctly, skip if not needed 0db716771e cryptsetup: enable libcryptsetup debug logging if we want it c8b9b3956f cryptsetup: set libcryptsetup global log callback too 679b3f6b7f basic/log: fix SYSTEMD_LOG_* parsing error messages 8d6b5158aa units: add SystemCallErrorNumber=EPERM to systemd-portabled.service 6681fcd445 network: fix the initial value of the counter for brvlan 853ec5f458 man: Add some notes about variable $prefix for StateDirectory= e6d23358e9 sd-netlink: fix inverted log message 6feb862407 blockdev: filter out invalid block devices early 9f7c0dbc75 blockdev-util: propagate actual error 3f5355bcb9 man: document tmpfiles.d/ user/group resolvability needs c15b92cd98 man: fix wrong udev property name 9768a900d6 meson: drop duplicated source 15194f22ed cryptsetup-generator: fix luks-* entry parsing from crypttab c2475390b4 core: skip whitespace after "|" and "!" in the condition parser fdc754aeb7 shared/condition: fix printing of ConditionNull= 572385e135 test: add testcase for issue #12883 9aa1edddb0 conf-parser: fix continuation handling 8fbc72f45f networkd: fix link_up() (#12505)- State directory of systemd-timesync might become inaccessible after upgrading to v240+ (bsc#1137341) This happens for users who had previously used systemd-timesync with DynamicUser=true, ie the ones who upgraded from a systemd version between v235 and v239 to systemd v240 and later (v240 was the version where DynamicUser was switched back to OFF).- Import commit eaa7b8b148927d471609de75e542dffcc1b36df4 7e58b89136 udevd: change the default value of udev.children-max (again) (bsc#1107617)- Add 0001-rc-local-generator-deprecate-halt.local-support.patch /etc/init.d/halt.local support will removed from the next systemd version (v243) so for now on warn (hopefully the few) users who rely on this script so they have a chance to switch to systemd-shutdown interface.- Add 0001-Revert-insserv.conf-generator.patch (bsc#1052837) All remaining packages have been fixed so they don't rely on the insser-generator to generate proper deps. So let's drop it as all services should carry the proper dependencies itself.- Drop debug-only-remove-new-policies.patch The new DBUS methods have been reviewed by the security team.- Import commit 9984a86d0d2259d54c7060f9c09f214202b4efa7 f2459bf373 random-util: eat up bad RDRAND values seen on AMD CPUs c90a2e9793 util-lib: fix a typo in rdrand 4db1cc9d46 random-util: rename "err" to "success" 981a62a102 random-util: hash AT_RANDOM getauxval() value before using it 64a9c3d918 random-util: use gcc's bit_RDRND definition if it exists c5d6ecfdca random-util: rename RANDOM_DONT_DRAIN → RANDOM_MAY_FAIL 298d13df7e network: remove redunant link name in message 77cbde31f2 hwdb: Align airplane mode toggle key mapping for all Acer series 460f03794e Revert "hwdb: Apply Acer mappings to all Gateway and Packard Bell models" fe9271ad84 test: return a non-zero return code when 'nobody' user doesn't exist 29d355e755 fstab-generator: Prevent double free of reused FILE* f30f1adc11 meson: make source files including nspawn-settings.h depend on libseccomp 84bab914b8 alloc-util: don't use malloc_usable_size() to determine allocated size 5240972d8d units: drop reference to sushell man page 0a26de5e33 codespell: fix spelling errors 582de105c8 nspawn-expose-ports: fix a typo in error message- Buildrequire polkit so /usr/share/polkit-1/rules.d has an owner (bsc#1145023) Otherwise the "post build checks" would complain and would force systemd to own this directory. The owner should still be "polkit" and the perms should be in sync with the perm set by polkit itself.- Add debug-only-remove-new-policies.patch A temporary patch to suppress the new DBUS methods introduced by v242 until they are reviewed and whitelisted by the secteam.- Add a comment explaining why static enablement symlinks in /etc are suppressed Also remove any /etc/systemd/system/*.requires/ symlinks for the same reason.- preset remote-cryptsetup.target during package installation This target is supposed to be part of the targets that should be enabled (or not depending on the presets) at package installation.- Upgrade to v242 (commit 071c380dcc434dca2a0c8b6de0519cc9e816c6d6) See https://github.com/openSUSE/systemd/blob/SUSE/v242/NEWS for details. This includes the following bug fixes: - upstream commit bf65b7e0c9fc215897b676ab9a7c9d1c688143ba (CVE-2019-3843) - upstream commit bf65b7e0c9fc215897b676ab9a7c9d1c688143ba (CVE-2019-3844) - upstream commit 37ed15d7edaf59a1fc7c9e3552cd93a83f3814ef (bsc#1124122) - upstream commit bf65b7e0c9fc215897b676ab9a7c9d1c688143ba (bsc#1133506) - upstream commit bf65b7e0c9fc215897b676ab9a7c9d1c688143ba (bsc#1133509) - upstream commit 1f82f5bb4237ed5f015daf93f818e9db95e764b8 (bsc#1150595) - upstream commit e55bdf9b6c5f72475b258a7a4585a0480551cb60 (bsc#1173422)- Drop "BuildRequires: -post-build-checks" from the specfile (bsc#1130230) The syntax of this directive is obsolete and should be replaced by "#!BuildIgnore: post-build-checks". However there's no good reasons to disable these SUSE extra checks, so let's re-enable them and fix the few errors it detected.- Import commit 4e6e66ea94cf5125f9044f0869939a86801ed2d8 430877e794 pam-systemd: use secure_getenv() rather than getenv() (bsc#1132348 CVE-2019-3842) 3cff2e6514 man: document that if the main process exits after SIGTERM we go directly to SIGKILL 26c4f7191c bus: fix memleak on invalid message- systemd-coredump: generate a stack trace of all core dumps (bsc#1128832 jsc#SLE-5933) This stack trace is logged to the journal.- Stop installing macros.systemd There're no points in installing this file if we remove it right after.- Make sure systemd-network.rules take precedence over our polkit-default-privs (bsc#1125438)- Include the SUSE version along with the major version of systemd $ systemctl --version systemd 241 (+suse.42.g15a1b4d58) Note that the SUSE version format maybe subject to change and as such scripts should not try to parse it.- systemd-mini: explicitly disable some of the systemd components For some reasons, some build requirements get pulled in for the mini variant now, enabling some parts of the code that were expected to be turned OFF.- Upgrade to v241 (commit 15a1b4d58f1d2bc9c21c7cbab6fe63b58e48bda1) This includes the following bug fixes: - upstream commit c0d76959080e3ba6534bce1c7053c750668e8b55 (bsc#1160595) - upstream commit 7334ade4a7e103b1a01d1c8fe1ea7c7a854a1c31 (bsc#1123892) - upstream commit c7e93c4d15019323973baf12daa76357c83892c4 (boo#1111498) This also includes the following bug fixes released in v240: - upstream commit 2675747f3cdd6f1e6236bbb2f79abfa53fb307f1 (boo#1111498) - upstream commit 9eb0fc32d6cb63e71f2cfc1e7dd34c3ede4b48a3 (bsc#1140631) - upstream commit 1432d2dbdfa90963272a9b581dc4b55dd3ac514f (bsc#1155574) - upstream commit 26e35b164b8d0603629b3d394554cfa728e8c3e4 (bsc#1169488) - upstream commit a9fc640671ef60ac949f1ace6fa687ff242fc233 (fate#325697)- Import commit a1d86af7ed49dacef671e8ec8dae9472a8fa47f5 92d860fc12 sysctl: Don't pass null directive argument to '%s' (bsc#1121563) 1379e30d59 Allocate temporary strings to hold dbus paths on the heap (bsc#1125352 CVE-2019-6454) b5569a03ae Refuse dbus message paths longer than BUS_PATH_SIZE_MAX limit. (bsc#1125352 CVE-2019-6454)- Import commit 01b4746d3c6f6cbf969fa2176c77ac3f616a7eda 7af53e005b sd-bus: if we receive an invalid dbus message, ignore and proceeed 92dcbfdd7f bus: move BUS_DONT_DESTROY calls after asserts a83e7b3b43 automount: don't pass non-blocking pipe to kernel. 726127ea1d units: make sure initrd-cleanup.service terminates before switching to rootfs (bsc#1123333) a6347a3cb6 core: Fix use after free case in load_from_path() (bsc#1121563) 22e2550222 strv: rework FOREACH_STRING() macro (bsc#1121563) 2ddd38f41a test,systemctl,nspawn: use "const char*" instead of "char*" as iterator for FOREACH_STRING() c2c8333e0b strv: add new macro STARTSWITH_SET() 1db243a601 Update systemd-system.conf.xml (bsc#1122000)- Import commit ad34cc45f63720ced69960dc66b47bddb146176d Import a bunch of fixes from stable/v239-stable: c8293f5af4 Revert "network: set DynamicUser= to systemd-networkd.service" 7f605592e6 Revert "resolve: enable DynamicUser= for systemd-resolved.service" 5a48e92e06 test: Fix networkd test for an already running service 36eae1688b Revert "timesyncd: enable DynamicUser=" 3a11f24cf0 Revert "unit: drop After=systemd-sysusers.service from timesyncd" 23cfd15ce9 machinectl: fix verbosity of import-raw or friends ba037daf29 Make bzip2 an optional dependency for systemd-importd fb609d2721 pull: initialize libgcrypt before calling any functions provided by libgcrypt c50857bc6b hwdb: remove stray 'i' in hwdb match string for the HP Spectre (#9571) 9a12fd17f5 man: Mention that paths in unit files must be fully normalized. 76fc2ab4a6 tree-wide: use instead of #ifdef for HAVE_* fcc699c093 network: update log message a4f497b2cd Use #if instead of #ifdef for ENABLE_GSHADOW 121c662eb8 man: add missing option for system.conf 564341146e core: add missing option and drop nonexistent option in system.conf 7082a3599f journal: add missing option in journald.conf 3c15efa9c1 basic: add missing comma in raw_clone assembly for sparc 4c210b6dce cryptsetup: Add dependency on loopback setup to generated units c777fbbe3e journal-gateway: use localStorage["cursor"] only when it has valid value c5b1bef639 journal-gateway: explicitly declare local variables 2361522ca6 analyze: actually select longest activated-time of services 3e810d92d9 sd-bus: fix implicit downcast of bitfield reported by LGTM aef660a4cf resolvconf: fixes for the compatibility interface 06b3f54f50 install: fix error handling in is_symlink_with_known_name() f70ab9a468 portable: fix error handling d2c40d4e80 resolve: fix return value type of dns_answer_has_dname_for_cname() 6f684e0670 resolve: dns_scope_network_good() does not returns negative errno 15d83e1138 bus-util: fix error handling ba0a1f3384 core: free lines after reading them- Import commit 3bece8a25ae11e8ec132cdecc7e72a00ee790994 89a9721a47 Revert "logind: become the controlling terminal process before restoring VT" (bsc#1120836) c3a8dc821b pam_systemd: reword message about not creating a session 0ba0f5b3ef pam_systemd: suppress LOG_DEBUG log messages if debugging is off- Import commit a3b059a8c60622e4ec30aabda93c6b41d0953dc4 9dbe9f12ec journal-remote: set a limit on the number of fields in a message (CVE-2018-16865 bsc#1120323) 61d569ab1b journal-remote: verify entry length from header a08760b26c µhttpd: use a cleanup function to call MHD_destroy_response 43f46a1a3d journal-gateway: use _cleanup_ attribute to stop microhttpd daemon 437b0b2d01 journald: lower the maximum entry size limit to ½ for non-sealed fds ac9e209710 journald: when processing a native message, bail more quickly on overbig messages ce103705b9 journald: set a limit on the number of fields (1k) (CVE-2018-16865 bsc#1120323) 35538171c2 coredump: fix message when we fail to save a journald coredump cfe247b555 basic/process-util: limit command line lengths to _SC_ARG_MAX 9d59e6f6ee journald: do not store the iovec entry for process commandline on stack (CVE-2018-16864 bsc#1120323) 8d650a68d4 journald: remove unnecessary {} b608f532a4 coredump: remove duplicate MESSAGE= prefix from message 0dbb2dc066 vconsole-setup: fonts copy will fail if the current terminal is in graphical mode (bsc#1114933) e501d65540 Revert "systemctl: when removing enablement or mask symlinks, cover both /run and /etc" d3ea69961f fs-util: rename safe_transition() into unsafe_transition() 338470fdc9 tmpfiles: use CHASE_WARN in addition to CHASE_SAFE d9ae1b30da fs-util: make chase_symlink() returns -ENOLINK when unsafe transitions are met 8b76594d1f fs-util: add new CHASE_WARN flag to chase_symlinks()- Import commit 8ae56af7802ef8f91fac64fa244d62a4468fbbd5 4474878178 udev-builtin-kmod: adjust logging 805534aff5 core: use the generic module_load() function ac7e902530 shared/module-util: fix preexisting mixup with errno sign 415aa40793 udev-builtin-kmod: use the generic module_load() function 8a36b4bac6 Move module-util.h to src/shared/ and load_module() to libshared 999b910752 core/kmod-setup: restore comments 1f2b822a21 logind: stop managing VT switches if no sessions are registered on that VT 5ad8d374c5 terminal-util: introduce vt_release() helper 145d492490 logind: become the controlling terminal process before restoring VT (bsc#1101591) d4b5dbc033 terminal-util: introduce vt_restore() helper 2e8af185f0 logind: make session_restore_vt() static ff3048364f udev: downgrade message when we fail to set inotify watch up (bsc#1005023)- Fix the test for figuring out if /etc/machine-id is writable in %post (bsc#1117063) "test -w" always returns true for root user even if the writable mode bits are not set. Fix this by testing the file mode bit value instead.- Move systemd-sysv-convert from /usr/sbin to /usr/lib/systemd This tool is not supposed to be run by users.- Import commit 69f9f79e1b03e3d23df25b61cbcc9304af3e358f (bsc#1080919 CVE-2018-6954) f3615ce49 tmpfiles: don't adjust qgroups on existing subvolumes (bsc#1093753) 7165e92f4 tmpfiles: use fd_get_path() even less excessively c2c531c1d test: make TEST-22 easier to debug, by outputting to /dev/console 621b78317 test: don't use "nobody:nogroup" for tests 1f9c7acad tmpfiles: return correct error variable after fd_reopen() 2236280c1 tmpfiles: reindent one comment less weirdly f6bdfb889 tmpfiles: use correct error variable bc75127cd tmpfiles: clarify that we ignore file attribute setting errors 621c8b1fe tmpfiles: add log message where we previously failed silently bc9229630 tmpfiles: use fd_get_path() less excessively 5a1106039 tmpfiles: add more tests c974086cc tmpfiles: don't follow unsafe transitions in path_set_*() e64a510eb fs-util: add new CHASE_NOFOLLOW flag to chase_symlinks() 7480154d0 tmpfiles: make create_fifo() safe eb890962c fs-util: introduce mkfifoat_atomic() helper 653bb81af fileio: make tempfn_random_child() accept empty string as path 2b1e12bfe tmpfiles: introduce create_fifo() 6dd80f289 tmpfiles: introduce empty_directory() f2c137edf tmpfiles: introduce create_directory() and create_subvolume() and make them safe 6a76f6dfb basic/stat-util: introduce is_dir_fd() 38a7f2e81 btrfs-util: unfuck tmpfiles' subvol creation 26e19b6fe btrfs-util: introduce btrfs_subvol_make_fd() 5fb5bdf5d basic/label: introduce mkdirat_label()/mkdirat_errno_wrapper() helpers 390b767da selinux: introduce mac_selinux_create_file_prepare_at() 0f72fadba smack: introduce mac_smack_fix_at() f2838154b tmpfiles: introduce create_directory_or_subvolume() 2de697fb8 tmpfiles: make create_device() safe 558c5fec7 tmpfiles: introduce create_device() dee986b1d tmpfiles: make copy_files() safe cacb14d3f tmpfiles: introduce copy_files() routine 81c85ce17 tmpfiles: make write_one_file() safe 9ec6b92ab tmpfiles: make truncate_file() safe 8dde36e03 tmpfiles: introduce truncate_file() which deals with 'F' exclusively 481134a93 tmpfiles: introduce create_file() which deals with 'f'/'F' exclusively 057861560 tmpfiles: make the stat struct parameter in fd_set_*() optional f37caffda tmpfiles: stat file in item_do() rather than in its callers 86f1362d4 tmpfiles: set only default acls to folders #9545 (#9599)- Make systemd-mini-sysvinit provides systemd-sysvinit Some packages (such as shepherd-bins) want to conflicts with systemd-sysvinit: they should also conflict with systemd-mini-sysvinit.- Add 0001-logind-keep-backward-compatibility-with-UserTasksMax.patch We have to keep support for UserTasksMax= for a while before dropping it. This patch is supposed to do that and also to make users aware of this change. It also hints how to configure that differently.- Import commit f39674d6d114d999c50672c7bea8cad21e1eaed9 7d1e04e85 units: use =yes rather than =true everywhere 185ce0d34 units: assign user-runtime-dir@.service to user-%i.slice a051f5e41 units: make sure user-runtime-dir@.service is Type=oneshot 30c6842c3 units: set StopWhenUnneeded= for the user slice units too e74de046e login: fix typo in log message- Own %{_libexecdir}/modules-load.d (again) This was incorrectly dropped during the split of the SUSE specific configurations.- Drop a Conflicts: in systemd-coredump It not needed anymore since the mini variant of systemd-coredump is not built anymore.- Import commit b54f5d7a8b41898ce98f43cd1a6cc92c0071806d 5def29d24 coredump: only install coredump.conf when ENABLED_COREDUMP=true 9133e2d6e dhcp6: make sure we have enough space for the DHCP6 option header (bsc#1113632 CVE-2018-15688) ebc3fa418 dhcp6: split assert_return() to be more debuggable when hit 51eefb6ac chown-recursive: let's rework the recursive logic to use O_PATH (bsc#1113666 CVE-2018-15687) e1e1aa237 core: skip unit deserialization and move to the next one when unit_deserialize() fails 1c726c87d core: when deserializing state always use read_line(…, LONG_LINE_MAX, …) (bsc#1113665 CVE-2018-15686) 4cd7d11ac core: don't create Requires for workdir if "missing ok" (bsc#1113083)- Make systemd-coredump sub-package optional and don't build the mini variant.- Drop duplicated %{?mini} suffix for systemd-{container,coredump} subpackages "-mini" is already part of the name of the main package so there's no need to append it again for those sub packages. It's only needed when the name of a subpackage is completely redefined, IOW when '-n' option is used with the %package directive.- Dont ship /usr/sbin/resolvconf symlink for now It conflicts with the bin shipped by openresolv and provides limited compat only.- Upgrade to v239 (commit 6d8584e7e8e5d13d2bab49b9e6f6d2ec39759978) This includes the following bug fixes: - upstream commit 0722b359342d2a9f9e0d453875624387a0ba1be2 (bsc#1045723) - upstream commit 2f2e14b251b9929e84e8b690d0187b766dfbae20 (bsc#1124122) - upstream commit c839b729c5f7b08f6d91bf9567d0b1f91d17e0f7 (bsc#1155207) - upstream commit 8eebb6a9e5e74ec0ef40902e2da53d24559b94a4 (bsc#1168076) This also includes the following bug fixes released in v238: - upstream commit e8a3144ec4ff332bd63644e468a98e1a7e06e7e4 (bsc#1112024) - upstream commit 4d219f5343b1924e7c519c2c178aeb5d1a5ab924 (bsc#1123727) - upstream commit 43b7f24b5e0dd048452112bfb344739764c58694 (bsc#1146991) - upstream commit bf443be99565e4327f1c8c12b79d98b4c1529cf1 (bsc#1156213)- Ship systemd-sysv-install helper via the main package This script was part of systemd-sysvinit sub-package but it was wrong since systemd-sysv-install is a script used to redirect enable/disable operations to chkconfig when the unit targets are sysv init scripts. Therefore it's never been a SySV init tool. While at it, don't ship this script (as well as systemd-sysv-convert) when sysvcompat is not defined.- Import commit 19b3868d32af20f1ecc86fe3c997144ff456fd65 06c2284d64 core: introduce systemd.early_core_pattern= kernel cmdline option 479b002083 core: add missing 'continue' statement c7fbccc62e journald: don't ship systemd-journald-audit.socket (bsc#1109252) f17a6c790c detect-virt: do not try to read all of /proc/cpuinfo (bsc#1109197) 5a1aa84544 compat-rules: generate more compat by-id symlinks for NVMe devices (bsc#1095096)- Import commit a67b516d49115a5be0f2ac27a2874cee6c59a7ae f8457adf9d emergency: make sure console password agents don't interfere with the emergency shell b8bbb50634 man: document that 'nofail' also has an effect on ordering a5410b2229 journald: take leading spaces into account in syslog_parse_identifier b793c312c7 journal: do not remove multiple spaces after identifier in syslog message f9595f0481 syslog: fix segfault in syslog_parse_priority() d464f06934 journal: fix syslog_parse_identifier() e70422883a socket-util: attempt SO_RCVBUFFORCE/SO_SNDBUFFORCE only if SO_RCVBUF/SO_SNDBUF fails (bsc#991901)- split off SUSE specific udev rules from systemd package (fate#325478) * remove 60-io-scheduler.rules * remove 80-hotplug-cpu-mem.rules * remove 99-wakeup-from-idle.rules * remove /usr/lib/modules-load.d/sg.conf (see bsc#1036463 for details) these are now maintained in the new package system-tuning-common-SUSE- Enable or disable machines.target according to the presets (bsc#1107941)- Import commit cc55f1ea9e1c1ccab5b9fb97e10e08830d02b282 962b38aaf user@.service: don't kill user manager at runlevel switch (bsc#1091677) 3986c4d82 units: make sure user@.service runs with dbus still up 5e68aa0f2 Revert "udevd: increase maximum number of children" (bsc#1107617) 099138fd9 fix race between daemon-reload and other commands (v237) (bsc#1105031)- Import commit 6ac2232d88f4b64428511a4692a51bd00d610b32 6247696db nspawn: always use mode 555 for /sys (bsc#1107640) 72f558b57 cryptsetup: do not define arg_sector_size if libgcrypt is v1.x (#9990) cfcd97cf2 cryptsetup: add support for sector-size= option (#9936) (fate#325634)- Import commit bb5a925bcefd4743873cae3f748ae1a426e92d44 8983bd246 core: don't include libmount.h in a header file (#8580) 3e4156a8f tmpfiles: don't adjust qgroups on existing subvolumes (bsc#1093753) 42edc93ac core/service: rework the hold-off time over message- Enable regexp matching support Currently only used by "journalctl --grep=xxx".- Import commit 0350f62a8cf7f151951b6b78337fe3c198b8bf6a fbf43a697 core: don't freeze OnCalendar= timer units when the clock goes back a lot (bsc#1090944) 4134ba8b6 man: SystemMaxUse= clarification in journald.conf(5) (bnc#1101040) 78bb2a0c4 socket-util: fix getpeergroups() assert(fd) (#8080) (bsc#1096516) 1753d0420 systemctl: mask always reports the same unit names when different unknown units are passed (bsc#1095973) 50ebf79d7 scsi_id: Fixup prefix for pre-SPC inquiry reply (bsc#1039099) 570f7655b locale-util: on overlayfs FTW_MOUNT causes nftw(3) to not list *any* files- Drop runtime dependency on dracut (bsc#1098569) Otherwise systemd pulls in tools to generate the initrd even in container/chroot installations that don't have a kernel anyways. For environments where initrd matters, dracut should be pulled via a pattern.- Import commit f63623c1fc0eb01b8efc2037d004f42ed8328356 6a161916f device: make sure to always retroactively start device dependencies (take #2) (bsc#1088052) e4402648c Fix pattern to detect distribution ad59c7970 install: "user" and "global" scopes are equivalent for user presets (boo#1093851) b1876c81a rpm: remove confusing --user before --global 00ea8a214 man: updated systemd-analyze blame description for service-units with Type=simple (#8834) (bsc#1091265) a9b587e2f fileio.c: fix incorrect mtime- Add 0001-resolved-create-etc-resolv.conf-symlink-at-runtime.patch (boo#1024897) - Ship systemd-resolved (but disabled by default) (bsc#1018387)- Disable user units by default (bsc#1090785)- Slight rewrite of the previous fix- align permissions of /etc/machine-id to upstream code (bsc#1092269) world writeable machine-id is a security issue- Move 80-container-v[ez].network in systemd-container sub-package - Move 80-container-host0.network from udev to systemd- Import commit d8196805089566ecd846b7c627ff2f3c42588c50 621b247f3 device: skip deserialization of device units when udevd is not running a7da5bdbc device: make sure to always retroactively start device dependencies (bsc#1088052) 303624f6f systemd-udevd: limit children-max by available memory (#8668) (bsc#1086785 bsc#1066422) 76acf3ae9 tmpfiles: fix directory removal with force symlink (#8619)- Ship 99-sysctl.conf instead of creating it during package installation/update (bsc#1088769) Previously this symlink was created in /etc/sysctl.d during %post which made the symlink not owned and more importantly it was created only if /etc/sysctl.conf is already installed which is not always the case during the installation process it seems. So ship the symlink unconditionally and put it in /usr/lib/sysctl.d instead since it's a distro default behavior that might be overriden by sysadmin later.- Be consistent in 60-io-scheduler.rules And use "?*" when checking for the non empty string (instead of "*?").- /usr/lib/systemd/systemd-coredump was missing from systemd-coredump sub-package (boo#1088057)- Drop systemd-bash-completion sub-package Now we directly ship the completion scripts from the main package as we already do for zsh. I couldn't see any advantages in this split.- Be more accurate when specifiying the tools version we provide- Make sure rpm won't expand %autopatch even if it's commented- stat(1) as well as systemctl are not use in %post section of udev So remove stat(1) from the list of dep and move systemctl to the requirements of %postun since it's called from there.- Import commit 14b3e00c3ccb8c1c82c8a2e99a9534750880a09e e0a8285e2 pid1: when creating service directories, don't chown existing files (#8181) (boo#1085971) fb25886b1 Fix format-truncation compile failure by typecasting USB IDs (#8250) (bsc#1084638) 5a6e9c92e sysusers: make sure to reset errno before calling fget*ent() c2e1ee488 sysusers: also add support for NIS entries in /etc/shadow 51cb94fa1 sysusers: do not append entries after the NIS ones (bsc#1085062 bsc#1045092) 783f3d368 basic/macros: rename noreturn into _noreturn_ (#8456) - Drop 0001-basic-macros-rename-noreturn-into-_noreturn_.patch It's been merged in the git repo.- Rename the tarball (bsc#1087323) So it's clear that it contains some additional patches on top of the upstream version. Use the commit hash in the name so the exact version can easily be identified. Provide _service file which can be used to retrieve the tarball from the git repo (with "osc service disabledrun").- Split systemd-coredump sub-package off (bsc#1083849)- Enhance IO scheduler tweaking rules to support blk-mq as well * Set optimal blk-mq schedulers (bfq and mq-deadline for HDD and SSD respectively) * Explicitly set CFQ for rotational disks when no `elevator` is specified * Verbose comments explaining what is going on * Rename the rules file since it is not ssd-only anymore- Don't ship machines.target in systemd-container but in systemd main package machines.target is supposed to be a standard target for starting/stopping all containers. systemd-nspawn is the main user of it but other container managers could also make use of it.- Build a mini variant of systemd-container So we don't have to manually track and remove all files that should be shipped by systemd-container in the case of a bootstrap build.- Run migrate-sysconfig-i18n.sh also during package installation (bsc#1086164) This is needed when we upgrade from SLE11.- Add 0001-basic-macros-rename-noreturn-into-_noreturn_.patch This fix a build error triggered by the introduction of the new version of libgpg-error package. Patch submitted to upsream: https://github.com/systemd/systemd/pull/8456- Turn off the IP sandboxing for systemd-logind Since v235 logind run inside an IPv4/IPv6 sandbox by default. This creates incompatibilites for systems using NIS.- Restore (maybe temporarly) "pam_config --add systemd" During its installation pam-config seems to overwrite the defaults shipped by "pam" for "some" reasons (see bsc#1084924) No idea why but since pam_systemd is not part of the "pam-config" defaults, we need to restore pam_systemd in common-session manually...- Remove dropin that was used to turn delegation off for user instances Upstream now enables "memory" and "pids" controllers only which should have a very limited impact on performance compare to the "cpu" controller.- Import commit 46d6bc9c4f1c05f3b4fcfca754cc59963bd86ce3 2a79f4e78 units: delegate "memory" instead of "cpu" by default for user instances (#8320) (bsc#954765 bnc#953241 fate#320421) 88174ae85 compat-rules: fix syntax errors spotted by test/rule-syntax-check.py- Remove udev-remount-tmpfs script Complete the previous commit.- Fix hotplug memory in 80-hotplug-cpu-mem.rules When new memory was hotplugged, the rule was supposed to call an external script (udev-remount-tmpfs) to remount all tmpfs. However the script was broken since its introduction (commit rev=715, 14/07/2014) and had no effects... this makes me wonder if we shouldn't get rid of this...- Make sure /var/lib/machines is created when systemd-container is installed- BS forces us to own %{_prefix}/lib/modprobe.d This seems wrong but that's how the SUSE BS works.- Upgrade to v237 (commit 78221ca750a9c266f9f8497dda59d7ee44000a6c) Udev rules 60-ssd-scheduler.rules and 80-hotplug-cpu-mem.rules have been removed from the git repo and are now maintained at the package level. Those rules have been rejected by upstream as they seem to be written to workaround some kernel shortcomings... This includes the following bug fix: - upstream commit 3d083b2245b0b8e52f2d8ccc3e55246f41f1f544 (bsc#1102908) This also includes the following bug fixes released in v235: - upstream commit 2e64e8f46d726689a44d4084226fe3e0ea255c29 (bsc#1069239) - upstream commit 79873bc850177050baa0c5165b119adafeebb891 (bsc#1069239) - upstream commit 4bc5d27b942afa83cc3d95debd2ad48d42ac07a8 (bsc#1089376) - upstream commit e9ea4526a3a3b41eced29b8d742498cc36750424 (bsc#1089693) - upstream commit d75b31837c93dbb9b20067719026ad0fb7cdfadd (bsc#1117025) - upstream commit 0e8856d25ab71764a279c2377ae593c0f2460d8f (bsc#1117025) - upstream commit 048dd629c4590eefb2ebd6a316c7350ed3a6ff19 (bsc#1119971) - upstream commit 9b32afa9f241fe8febc0a754850f1e7331caf6e3 (bsc#1126056) - upstream commit e6dde451a51dc5aaa7f4d98d39b8fe735f73d2af (bsc#1137053) - upstream commit 0864d311766498563331f486909a0d950ba7de87 (bsc#1158336) - upstream commit d60cb656fc63c24b430421764b7d0322857d34fd (bsc#1161262) - upstream commit e2be442e791fa1150aa835c684acc6d7189de3e1 (bsc#1165011) - upstream commit 64a36ae4b1dd23474dd7ea261381ac437b24fac2 (bsc#1172072) - upstream commit b001ad61e91b6499897f0c977045c7608c233bfa (jsc#SLE-7687) - includes IP filtering feature (jsc#SLE-7743) This also includes the following bug fixes released in v236: - upstream commit b3b4ebab02395933cde554b5a5d5c363dae3920d (bsc#1083571) - upstream commit 3e3852b3c6c61506963112fd218a86b673fc61e6 (bsc#1110445) - upstream commit 4050e4797603d3644707d58edfd9742b5311c7cf (bsc#1124153) - upstream commit 8cb83266062b383cdd4a57301ef559d64b491c51 (bsc#1125604) - upstream commit 19a44dfe4525ab01caf593a9c2beada4b412910d (bsc#1156482)- add basic user space support for suspend to idle (fate#323814) add 99-wakeup-from-idle.rules Currently this only covers the power button and usb/AT keyboards as wakeup devices. It is planned to make that configurable in the future.- Don't call "pam-config --systemd" pam_systemd.so has been integrated directly in the PAM stack since bsc#812462. So there's no need to call pam-config.- Fix build errors due to the split-off of systemd-containe: found conflict of systemd-234-33.1.x86_64 with systemd-container-234-33.1.x86_64: - /usr/share/man/man5/systemd.nspawn.5.gz - /usr/share/man/man1/systemd-nspawn.1.gz found conflict of systemd-container-234-33.1.x86_64 with systemd-mini-container-234-33.1.x86_64: - /usr/bin/systemd-nspawn - /usr/lib/systemd/system/systemd-nspawn@.service - /usr/lib/tmpfiles.d/systemd-nspawn.conf- Use %license (boo#1082318)- Split systemd-container sub-package off (fate#325469) Other distros already do it and it seems a good idea to not install this stuff on new installations by default. At least /var/lib/machines subvol is not created anymore at boot even if it wasn't used at all.- Import commit 295ead0f396beb2b5199abd99a17e274c2581f95 f4f94ab2e meson: install rules/80-hotplug-cpu-mem.rules 2901aa9b9 meson: install rules/60-ssd-scheduler.rules 1293c0056 core: use id unit when retrieving unit file state (#8038) (bsc#1075801) 596b2b241 Revert "vconsole-setup: add SUSE specific settings for font/keyboard in sysconfig" 0b595da04 Revert "locale-setup: handle locale at boot time well"- Re-enable systemd-firstboot It's used by the installer and also by JeOS.- Use %systemd_post in %post- Own /usr/lib/systemd/system-environment-generators directory- More systemd rpm macro usages- Disable systemd-firstboot I don't think there's any use case for it currently.- Use systemd rpm macros in paths defined in the specfile- Stop importing i18n settings from /etc/sysconfig (fate#319454) Bits taken from SLE15.- Make systemd-timesyncd use the openSUSE NTP servers by default Previously systemd-timesyncd used the Google Public NTP servers time{1..4}.google.com- Import commit 4a6a1e4f0b02e6cedf7eba93b85a6dd968f875c7 db1d8eacd compat-rules: make path_id_compat build with meson - Drop 0001-compat-rules-make-path_id_compat-build-with-meson.patch which is now part of the git repo (see above).- Don't ship /usr/lib/systemd/system/tmp.mnt at all (bsc#1071224) The previous fix couldn't work on platforms using a RO rootfs. Therefore we don't ship /usr/lib/systemd/system/tmp.mnt but we still ship a copy in /usr/share/systemd. Users who want to use tmpfs on /tmp are supposed to add a symlink in /etc/ pointing to the copy shipped in /usr/share/systemd. To support the update path we automatically create the symlink if tmp.mount in use is located in /usr/lib/systemd.- Don't build seccomp support in the mini package- Switch to Meson build system Some rearrangement in the file list was also needed. That was probably due to the upgrade of rpm.- Import commit 0a5600eb7f8263c7c79fec0d85cc159d54aba636 2a181fc6f insserv-generator: make it build with meson 7b0401da4 build-sys: don't build networkctl if networkd is disabled- Don't build-require selinux for the mini package- Drop libgcrypt.m4 The mini package builds fine without it so it doesn't seem necessary anymore.- Import commit 846d838c37865da60eba48090e570e959291399f b1e0a348d fileio: include sys/mman.h f1fa784cb meson: update header file to detect memfd_create() 8838ba7ec meson: define _GNU_SOURCE to detect copy_file_range() (#7734) 531a00c84 Restore "restore /var/run and /var/lock bind mount if they aren't symlink"" (the 3 first commits make systemd build against glibc 2.27)- Import commit 3f421e4fbf6fcb31d74caf729435868ba8824483 7fb9ea39a Revert "restore /var/run and /var/lock bind mount if they aren't symlink" 23ce1207a meson.build: make docdir configurable (#8068)- Import commit 8ec9f58d334c76e736957812d9e57151502a6f63 07c6ee3eb compat-rules: get rid of scsi_id when generating compat symlinks for NVMe devices (bsc#1051465) 261a4ef38 compat-rules: generate compat by-id symlinks with 'nvme' prefix missing (bsc#1063249)- Drop 0001-compat-rules-get-rid-of-scsi_id-when-generating-comp.patch It's been imported in branch "compats/udev-compat-symlinks" which has been merged in branch "openSUSE-Factory" in its turn.- Import commit c516268845b0fd0683cef2e491b84077371e8f01 37da1facb core: disable session keyring per system sevice entirely for now (bnc#1045886) 8a1ae0449 strv: fix buffer size calculation in strv_join_quoted()- Drop 0001-core-disable-session-keyring-per-system-sevice-entir.patch It's been merged in branch "SUSE/v234".- Import commit 2087a80d56bb6f8c7fb74a19172259bc9d9af866 2b8971b8a tmpfiles: refuse to chown()/chmod() files which are hardlinked, unless protected_hardlinks sysctl is on (bsc#1077925 CVE-2017-18078) 8c2bcac25 tmpfiles: change ownership of symlinks too- Do not optionally remove /usr/lib/systemd/system/tmp.mnt anymore (bsc#1071224) This was done to make sure that tmpfs wouldn't be used for /tmp by defaut in case the dir layout created by the installer did not create a customized tmp.mount. But it had the bad side effect to break "rpm -V systemd" and updates of systemd via delta-RPMs. Now instead of removing tmp.mount unit file, we mask it (still only if no other tmp.mount would override the default one). It's the official way to disable tmpfs on /tmp after all. Since we cannot rely on the presence of fstab during package installations, we introduced a service which is run once on the first boot and which figures out if tmpfs would be used. If so it masks the unit. We also handle the upgrade path and make sure to preserve admin's settings (if any). Another advantage of this is that we will only need to remove the introduced service the day when tmpfs will be the default for SUSE distros.- Import commit 83067827cc891ddc90def200fdbe725917ec9fa3 3d60486f7 core/timer: Prevent timer looping when unit cannot start (bsc#1068588) 460bd0cd6 Revert "handle SYSTEMCTL_OPTIONS environment variable" (fate#323393)- Import commit cc94ce8513221061898c83f57862544b16021f0e aa3eba828 delta: don't ignore PREFIX when the given argument is PREFIX/SUFFIX b1ea0173a delta: extend skip logic to work on full directory paths (prefix+suffix) (bsc#1070428) 77c5065f9 delta: check if a prefix needs to be skipped only once db32866d1 Fix parsing of features in detect_vm_xen_dom0 (#7890) (bsc#1048510) 11d40461a sd-bus: use -- when passing arguments to ssh (#6706) 1148d99f6 tmpfiles: consider /etc uninitialized also when /etc/machine-id is present but empty (#7849) (bsc#1075179) 3a95f69bf tmpfiles: downgrade warning about duplicate line- Edit scripts-systemd-fix-machines-btrfs-subvol.sh We shouldn't be creating a /var/lib/machines subvolume if /var is already a seperate partition or subvolume. /var/lib/machines will already be excluded from snapper & similar tooling in this case.- Import commit 82dbe8a2ae56649231111eaadd4c302a2d2175ee 8c7f0c449 service: Don't stop unneeded units needed by restarted service (bsc#1066156) 869be64ce sysctl: use raw file descriptor in sysctl_write (#7753) 0c2400810 sysctl: disable buffer while writing to /proc (bsc#1071558) 9eb1f30b8 Use read_line() and LONG_LINE_MAX to read values configuration files. (bsc#1071558) 4dbea654f def: add new constant LONG_LINE_MAX 48f14cd71 fileio: add new helper call read_line() as bounded getline() replacement 861e1a222 build-sys: udevadm should have LOG_REALM=LOG_REALM_UDEV 8ed5cf3fb meson: libudev_core and udevadm should have LOG_REALM=LOG_REALM_UDEV (#7666) a9f93f1d0 virt: use XENFEAT_dom0 to detect the hardware domain (#6442, #6662) (#7581) (bsc#1048510) fe56abdf9 seccomp: arm64/x32 do not have _sysctl c9194fe37 seccomp: arm64 does not have mmap2 31d9b3c32 fs-util: small tweak in chase_symlinks() 9dd0bc7a3 meson: do not include man/meson.build if xsltproc not found 7e29e2b07 analyze: replace --no-man with --man=no in the man page (bsc#1068251)- Add missing /etc/systemd/network directory- Import commit e30f1b10e276fb18db10ea2463fbd7146ae778f6 63481b24b firstboot: do not write vconsole.conf when arg_keymap is empty (bsc#1070124)- Add 0001-compat-rules-get-rid-of-scsi_id-when-generating-comp.patch (bsc#1051465) This patch is not yet merged in the 'compats/udev-compat-symlinks' branch: we asked to upstream if it would be possible to introduce a new specifier that wouldn't strip trailing whitespaces , see https://github.com/systemd/systemd/issues/7462 Also this allows to give the patch more testing before merging it in the git repo.- Drop a useless rm(1) from the specfile- Remove requires for pwdutils, we don't need the shadow tools anymore [bsc#1069150]- Import commit 4b9afa11f918796184e1264d618b4ff5d18e481b 22dcb1d04 tmpfiles: when /etc is not fully initialized, some specifiers are expected to be unresolvable (#6860) (bsc#1055664) 216beb768 tmpfiles: Allow create symlink on directories (#6039) baf85eb79 udev: net_setup_link: don't error out when we couldn't apply link config (#7328) - Remove stderr redirection to /dev/null when calling %tmpfiles_create since it's not needed anymore due to commit 22dcb1d04. Indeed the messages are no more emitted at LOG_WARN but LOG_NOTICE.- Import commit b9a41367b6c1164318443491cc3dae0e8208e15c 86804326f systemd-firstboot: add vconsole keymap support (#7035) (bsc#1046436) 9b64225e9 resolved: fix loop on packets with pseudo dns types (bsc#1065276 CVE-2017-15908) - Drop 0001-systemd-firstboot-add-vconsole-keymap-support.patch since it's been merged upstream and backported to SUSE/v234 (see above).- Import commit e44237e76f6e133e62ff6c681d3fd06ebf12f66d a4e02c099 udev-rules: all values can contain escaped double quotes now (#6890) d2b767a76 tmpfiles: remove old ICE and X11 sockets at boot (#6979)- Add 0001-systemd-firstboot-add-vconsole-keymap-support.patch (bsc#1046436) Temporary patch until it's been merged by upstream, see https://github.com/systemd/systemd/pull/7035- Damn forgot to drop 0001-Revert-core-device-Use-JobRunningTimeoutSec-for-devi.patch in the spec file- Import commit 6dea894131d78b20b9e0482f75afa6ee4dec8627 1cdd944b0 unit: when JobTimeoutSec= is turned off, implicitly turn off JobRunningTimeoutSec= too (bsc#1004995) This make 0001-Revert-core-device-Use-JobRunningTimeoutSec-for-devi.patch not needed anymore.- Import commit 93688f8e53b4e482a55a7d4aba2d927ddedebdde c53522be3 compat-rules: allow to specify the generation number through the kernel cmdline- Import commit c1e8af7d1e8b09c2878a5b17f513bfc41ae46dc6 982754275 build-sys: make sure 61-persitent-storage-compat.rules is installed with meson 9ac2e8b9b udev: proc_cmdline_get_key() FTW! (#6925)- Import commit 9e0985dc330b1cf04bc44049962343bdf4ba851a 4fd7cd041 pam_logind: skip leading /dev/ from PAM_TTY field before passing it on dd6312828 logind: make sure we don't process the same method call twice (#6583)- Update scripts-systemd-upgrade-from-pre-210.sh script - drop dependency on awk - fallback to runlevel #3 if something goes wrong Note: I'm not sure how this is supposed to work as /etc/inittab is likely to be missing in my understanding. Indeed this file is part of the aaa_base package which might be upgraded before systemd is installed...- Drop macros.systemd.upstream as it's not used- Import commit 58ea3c819cca1639ef8c922505c573ba5e262b3d 334945091 shutdown: fix incorrect fscanf() result check (#6806) 027202892 shutdown: don't remount,ro network filesystems. (#6588) (bsc#1035386) bc77b53a5 shutdown: don't be fooled when detaching DM devices with BTRFS (boo#1055641) d9d293847 util: make get_block_device() available 421ce7382 tmpfiles: silently ignore any path that passes through autofs (#6506) (bsc#1045472) ca8f90e62 device: make sure to remove all device units sharing the same sysfs path (#6679)- Make use of "%tmpfiles_create" in %post of the logger subpackage- Add scripts-udev-convert-lib-udev-path.sh (bsc#1050152) This script takes care of converting /lib/udev into a symlink pointing to /usr/lib/udev when upgrading a distro using an old version of udev.- Make use of "%make_build" rpm macro- Renumber scripts to start at index 100- Introduce scripts-systemd-upgrade-from-pre-210.sh It collects all existing hacks done in %post to fix old/deprecated settings in systemd older than 210. This includes hacks needed to fix system that are migrating from SysV. There shouldn't be any functional changes.- Move scripts for packaging workaround/fixes in /usr/lib/systemd/scripts It also renames fix-machines-subvol-for-rollbacks.sh into scripts-systemd-fix-machines-btrfs-subvol.sh Note that the "scripts-systemd-" prefix is used for those scripts so we can gather them. Why not using a directory instead ? because osc doesn't allow that.- Add 0001-Revert-core-device-Use-JobRunningTimeoutSec-for-devi.patch (bsc#1048605) It's a temporary but urgent fix for a regression discovered in bug 1048605. The fix is still under discussion with upstream but we need to make progress here and limit the number of affected users. Consequently this fix reintroduces bsc#1004995 (the bug report has been re-opened) but this one is far less critical and a workaround was provided. The final solution will fix both bugs.- Import commit 2bed4bf99cf7f24eafda490f778ed5e109f8d7f1 7a4935268 compat-rules: drop the boggus 'import everything' rule (bsc#1046268)- %regenerate_initrd_post is suppsed to be used in %post (not %pre) section- Import commit 6887cc21f23e33ac37801a01d76176e5c16fd8ea 9dcc6c04e pid1: forward port console specificities handling for s390 arch to v234- Import commit 986e98fd5a75470ba17e21fea12d7d4e966c1ecc 4706ebc62 call chase_symlinks without the /sysroot prefix (#6411) (boo#1051172)- Remove the unneeded hack forcing systemd-crypsetup binary to be linked against the just built libudev I don't remember why it was added but it looks unnecessary: most of all systemd components are linked againt libsystemd-shared.so which includes all the just built symbols. Also I don't see why it was done only for systemd-cryptsetup since all other binaries should have had suffered from the same issue.- Import commit c5705e01800bdadd6a4fa7dc50d47b13eb697211 8ea065d44 compat-rules: don't rely on ID_SERIAL when generating 'by-id' symlinks for NVMe devices (bsc#1048679)- Import commit 06bed720274d9436405a7c27c8238d7d1aefca2b 66fffdf12 build-sys: don't hook var-lib-machined.mount to remote-fs.target when machined is disabled 96c232066 Revert "core: don't load dropin data multiple times for the same unit (#5139)"- Drop support of compression from the mini package Hence remove the relevant build-requires from the mini package.- Upgrade to v234 (commit 78af11131da1b2760778206806c0ebe8616a5284) - package /etc/systemd/system/dbus-org.freedesktop.network1.service - /usr/lib/systemd/resolv.conf is not installed if resolved is disabled- Edit pkgconfig(liblz4) dependency: liblz4 now uses 1.x *again*- Added 0001-core-disable-session-keyring-per-system-sevice-entir.patch (bnc#1045886) Temporary patch to disable the session keyring stuff as it's currently broken and may introduce some security holes.- Import commit 21827ea0875ff197e16e72003b2bfaa1c6e8daad 1ad06735f core: fail when syntactically invalid values for User=/Group= fields are detected (bsc#1047023) d563972e2 timesyncd: don't use compiled-in list if FallbackNTP has been configured explicitly f4e0c16f5 gpt-auto-generator: fix the handling of the value returned by fstab_has_fstype() in add_swap() (#6280) e1345aac5 fix add_esp() in the gpt-auto-generator.c (#6251) c591ece9a automount: don't lstat(2) upon umount request (#6086) (bsc#1040968) 643ab2eea gpt-auto-generator: disable gpt auto logic for swaps if at least one is defined in fstab f07d2022f fstab-util: introduce fstab_has_fstype() helper bf735bb35 fstab-util: don't eat up errors in fstab_is_mount_point() a4b40fbed resolved: simplify alloc size calculation (bsc#1045290 CVE-2017-9445) 8b960bec0 only check signature job error if signature job exists (#6118) (boo#1043758) 1418bfb5b job: Ensure JobRunningTimeoutSec= survives serialization (#6128) (bsc#1004995) 19b6d5f08 udev: turn off -Wformat-nonliteral for one safe case 717ace439 udev: net_id add support for platform bus (ACPI, mostly arm64) devices (#5933) a3bf2e6b5 core/mount: pass "-c" flag to /bin/umount (#6093)- Add minimal support for boot.d/* scripts in systemd-sysv-convert (boo#1046750) While at it, the handling of the symlink priorities is also removed since it doesn't appear to be used at all.- Don't try to restart networkd/resolved if they're disabled (boo#1045521) "systemctl try-restart/preset" wants the unit files exist.- Stop shipping /usr/lib/sysusers.d/basic.conf (bsc#1006978) Ok looks like the previous change was the right thing to do and we continue to follow this path by relying on the new user/group scheme Therefore the basic system user/group are now managed and created by system-sysusers and udev also relies on this for the groups it uses in its rule files. Ideally we should have listed all of the groups in the deps (with "Requires: group(disk)" but the list of the groups is rather long and the risk for those groups to be re-organized is probably low, so currently we simply use "Requires: system-group-hardware" as a shortcut.- Make sure "lock" group is created On SUSE distros, /run/lock must be owned by "lock" group (see boo#733523). This group was previously created by another package but since a recent changes it doesn't seem to be true anymore or at least this package isn't pulled in anymore when building the rescue system. For now make systemd creates the group by adding "Requires: group(lock)". I'm currently not sure why we don't use sysusers.d stuff for that purpose and if the "lock" group on /run/lock is still mandatory. This should be revisited later.- Make sure dracut (if installed) will embed the new compat rule The new compat rule must be embedded in the initramfs so make sure that the installed dracut supports it.- Upgrade to v233 (commit 330b55d5e28d17f361062dba66426e46fb7d7857) - package new systemd-umount binary - package new environment generator stuff - drop /dev/root symlink support - /etc/pam.d/systemd-user is not patched anymore but we ship a dedicated file for SUSE now. - manage compat symlink generation in a dedicated branch (bsc#1040153)- Fix systemd-sysv-convert when a package starts shipping service units (bsc#982303) The database might be missing when upgrading a package which was shipping no sysv init scripts nor unit files (at the time --save was called) but the new version start shipping unit files.- Fix indentation in systemd-sysv-convert While at it, strip trailing whitespaces. No functional changes.- Disable group shadow support (bsc#1029516) The new configure option will be imported during the next tarball update.- Ship /var/log/README Unfortunately it's not possible to also ship /etc/init.d/README because of rpm "sanity" checks that prevent executable in /etc/init.d- Drop systemd-{journalctl,loginctl} legacy symlinks.- Drop %preun section Currently the only use of this section is to remove the symlinks enabling systemd services on package removal. Those symlinks were initially installed by the systemd package installation but could have been overriden by the sysadmin later. If so the symlinks shouldn't be uninstalled. Also in a near futur disabling services will install a symlink to /dev/null.- Import commit 9e33c2ae69fbb705e8ad143536e419a231e93020 04ef0eab8 importd: support SUSE style checksums supplementary (#5800) fb601ad9a importd: support SUSE style checksums (#5206) (fate#322054) b76b27c76 hwdb: fix warning "atkbd serio0: Unknown key pressed" (#5772) (boo#1010220) cb0d991f6 loginctl: fix typo causing ignoring multiple session IDs (#5732)- Make use of %systemd_postun()- Restart a couple of systemd services on package update Those services (most notably journald) should support restarting these days. However logind still doesn't but that should be fixed pretty soon, well I hope :)- Don't buildrequire pam-config, it's not used at this step. Also drop the use of it in %postun as it can't realistically happen...- Don't call /sbin/ldconfig in %post of the main package systemd main package doesn't ship any shared libs so there's no point in calling ldconfig in %post/%postun- Silent %tmpfiles_create in %post (bsc#1034938) Due to bsc#1024740, we stopped generating /etc/machine-id during systemd package installation making the specifier '%m' unavailable in the tmpfiles.d configuration files at this time. Make it simple for now and silent %tmpfiles_create, after all that's how the macro was implemented originally.- Import commit f0325620d23a247682c629d28883a364e4a7a8c4 327814841 core: when a unit's SourcePath points to API VFS pretend we are never out-of-date (#5487) f4b9fb58e units: move Before deps for quota services to remote-fs.target (#5627) (bsc#1028263) 44b9d27f8 udev: net_id - support predictable ifnames on vio buses (#5675) (bnc#1029183) 64f4761c9 units: apply plymouth warning fix to in rescue mode as well (#5615) 77607b887 units: do not throw a warning in emergency mode if plymouth is not installed (#5528) (bsc#1025398) 336d6016c core: downgrade "Time has been changed" to debug (#4906) (bsc#1028610)- Consider chroot updates in fix-machines-subvol-for-rollbacks.sh (bsc#1030290)- Initialize /etc/machine-id during the first boot (bsc#1024740) Previously that was done at package installation but it didn't fit well for appliance builds.- Import commit 68fc0a749a83d16d4cde8471d5030bc6254ffd96 76d4d05fb udev: fix variable assignment 473df8cc4 udev-rules: perform whitespace replacement for symlink subst values (bsc#1025886) d6c3ff647 udev-event: add replace_whitespace param to udev_event_apply_format 30ad15f7c libudev-util: change util_replace_whitespace to return number of chars in dest- Import commit 103259b3226251d06f79ca627f7b0ba0bd49f4bc 0ee7890dd automount: if an automount unit is masked, don't react to activation anymore (#5445) 99865a181 core: make sure to destroy all name watching bus slots when we are kicked off the bus (#5294) (bsc#1006687) f34234c54 build-sys: add check for gperf lookup function signature (#5055) 44e39538f sd-event: "when exiting no signal event are pending" is a wrong assertion (#5271) (boo#995936 bsc#1022014) 471b26807 sd-event: when an event source fails, don't assume the type of it is still set- Don't ship systemd-resolved for now (bsc#1024897) If resolved is enabled , systemd-tmpfiles creates a wrong symlink in /etc/resolv.conf which confuses the network manager actually used.- More indentation cleanup (no functional changes)- Remove obsolete insserv requirements for udev again [bsc#999841]- Import commit cd97d5d5fef79ab9d957bf6504d085c0faca6bfc e587b6ce0 disable RestrictAddressFamilies on all architectures but x86_64 one (bsc#1023460) c8ae05632 journald: don't flush to /var/log/journal before we get asked to (bsc#1004094) 7261eaf3e sd-event: fix sd_event_source_get_priority() (#4712)- Move fix for permission set on /var/lib/systemd/linger/* (no functional changes) Move that part after the fix on timer timestamp files otherwise the comment doesn't make sense.- Import commit 028fd9b60580976dffb09b3576a2b652ee35137c cc2ca55ff build-sys: do not install ctrl-alt-del.target symlink twice ececae77a device: Avoid calling unit_free(NULL) in device setup logic (#4748)- Ship systemd-resolved but it's disabled by default (bsc#1018387) The NSS plugin will also be disabled, users need to enable it manually.- Don't ship ldconfig.service anymore This service was introduced to support stateless systems that support offline /usr updates properly. AFAIK we don't support any such system for now, so disable it. If it's wrong it's easy enough to restore it back. Related to bsc#1019470.- Be more consistent with indentation (*no* functional changes) Indentation should use 8 spaces now (no tabs).- Import commit 2559bc0c076b58f0a649056e79ca90fe5f1d556c 9c4a759ab systemctl: 'show' don't exit with a failure status if the requested property does not exist [SUSE] (bsc#1021062) f9194193b systemctl: remove duplicate entries showed by list-dependencies (#5049) (bsc#1012266) 2a6653335 rule: don't automatically online standby memory on s390x (bsc#997682)- Fix permission set on /var/lib/systemd/linger/* Those files are created by logind which run with umask(0022), so they are not world writable and shouldn't be affected by bsc#1020601. But it's cleaner to not let files forever with their setuid bit set for no good reason.- Fix permissions set on permanent timer timestamp files (bsc#1020601) (CVE-2016-10156) This change makes sure to fix the permissions of the timestamp files which could have been created by an affected version of systemd. Local unprivileged users could have run arbitrary code as root if systemd previously created world writable suid root files such as permanent timer stamp files.- Import commit 3edb876e3b80437a95502aa5d31d454606ea94bd 27b544224 core: make sure to not call device_is_bound_by_mounts() when dev is null (#5033) (bsc#1018399)- Use the %{resolved} build conditional for the nss-resolve subpackage- /usr/bin/systemd-resolve was missing from the filelist- Silent warnings emitted when udev socket units are restarted during package upgrade (bsc#1018214)- Upgrade to v232, commit de62e96da6a62ac61a7dea45cc558f5fa4342032 - a4dff165d nspawn: resolv.conf might not be created initially (#4799) - b543fe907 nspawn: fix condition for mounting resolv.conf (#4622) - 1aed89e55 core: make mount units from /proc/self/mountinfo possibly bind to a device (#4515) (boo#909418 bsc#912715 bsc#945340) - bfb54ecdc coredumpctl: let gdb handle the SIGINT signal (#4901) (bsc#1012591)- Really include legacy kbd maps in kbd-model-map (bsc#1015515) Instead of fix-machines-subvol-for-rollbacks.sh...- Enable lz4 (which becomes the default) It's much faster than xz and thus should be more appropriate to compress journals and coredumps. The LZ4 logic is now officially supported and no longer considered experimental. The new frame api was released in v125.- Good by compatlibs support There's no longer need for enabling/disabling the support for the compatlibs as it's been dropped from the source code.- Drop /usr/lib/systemd/libsystemd-shared-%{version}.so from the 32bit package This shared library is not for public use, and is neither API nor ABI stable, but is likely to change with every new released update. Only systemd binaries are supposed to link against it. This also prevents from the 32bit package to conflit with the 64bit one if this lib was installed by both packages.- Upgrade to v232, commit c5c3445825981e2a5c3ed71214127d5b1b9de802: - Dropped backported commits which has been merged - Forward-port Suse specific patches - Added --disable-lto option to ./configure - Added systemd-mount - Removed in %file /usr/lib/systemd/user/*.socket: since 798c486fbcdce3346cd86 units/systemd-bus-proxyd.socket has been removed. - Removed in %file %{_sysconfdir}/systemd/bootchart.conf since commit 232c84b2d22f2d96982b3c bootchart is not part of systemd anymore. - Backward compat libs have been disabled since it's been dropped from the source code. - Added /usr/bin/systemd-socket-activate in %file - Added --without-kill-user-processes ./configure option - Bump libseccomp build require (>= 2.3.1) as described in README - Specifiy version of libmount as required in the README- libudev-devel 32bit is needed for building 32bit wine now.- specfile: conflict systemd-bash-completion and systemd-mini-bash-completion Otherwise the build system detects that systemd-bash-completion and its mini variant are conflicting at files level even though those packages can't be installed on the same system.- specfile: clean up nss-* plugins descriptions and drop nss-myhostname-config script for now. Currently /etc/nsswitch.conf is supposed to be edited by the sysadmin to enable the modules. However for some reasons only nss-myhostname is removed from the conf file when the corresponding package is uninstalled. This is inconsistent so let's remove it. Actually I'm wondering if we shouldn't make those NSS plugins part of the main package and get rid of all those sub-packages...- specfile: remove old comments and unneeded sed command- specfile: no need to create systemd-update-utmp-runlevel.service symlinks anymore The symlinks in /usr/lib/systemd/system/.target.wants/systemd-update-utmp-runlevel.service are created in Makefile.am since commit d5d8429a12c4b1. 'reboot' and 'poweroff' targets initially had the symlinks but there's not point since the latter conflicts shutdown.target whereas the 2 targets pull it in. See: https://github.com/systemd/systemd/pull/4429- specfile: remove the following warnings: [ 256s] warning: File listed twice: /usr/lib/systemd/system/dbus.target.wants [ 256s] warning: File listed twice: /usr/lib/systemd/system/default.target.wants- Own a couple of directories even if they don't belong to systemd otherwise the build system will complain. Some directories (owned by others packages) are simply used by systemd to ship some scripts or config files to customize others * optional* components. Since thos components are not build required by systemd those directories are not owned by any packages and the BS complains...- Import commit 15ea716 journal-remote: change owner of /var/log/journal/remote and create /var/lib/systemd/journal-upload (bsc#1006372)- %sysusers_create and %tmpfiles_create must be called in %post Calling %pre is broken since the respective conf files are not yet installed.- %{_libexecdir}/{tmpfiles.d,sysusers.d}/systemd-remote.conf are part of systemd-journal-remote package (only).- systemd-journal-{gatewayd,remote,upload} units are only part of "systemd-journal-remote" package. So exclude them from the main package.- Import commit a1c145e6ad6588555dca64402f9103fb1e02b1a0 7f34037 man: explain that *KeyIgnoreInhibited only apply to a subset of locks df5798b Revert "logind: really handle *KeyIgnoreInhibited options in logind.conf" (bsc#1001790 bsc#1005404) f79fee7 Revert "kbd-model-map: add more mappings offered by Yast" 3760c10 manager: tighten incoming notification message checks d6efd71 core: only warn on short reads on signal fd 6eebd91 manager: be stricter with incomining notifications, warn properly about too large ones fdf2dc3 manager: don't ever busy loop when we get a notification message we can't process- Rename kbd-model-map-extra into kbd-model-map.legacy- Remove tcpd-devel build requirement. tcpwrap support has been removed since v212, see commit 7f8aa67131cfc03ddcbd31c0420754864fc122f0- remove all dummy "aliases" to /etc/init.d (as it was already done by factory more than 1 year ago). Even if a sysvinit script is still requiring one of those dummy symlinks this should not be an issue since this is requirement is translated into a weak dependency.- specfile: - do not own /usr/share/zsh directory - do not own /etc/dbus-1 and /etc/dbus-1/system.d dirs - do not own /usr/share/dbus-1 dir- specfile: %{_prefix}/lib/systemd/system-preset was mentioned twice in %files section.- Specfile cleanup: - use curly braces with rpm macros- Specfile cleanup: - %ghost files doesn't need (anymore) to be created in %builroot - do not own /etc/X11/xorg.conf.d and /etc/X11/xinit- Specfile cleanup: no need to protect the manpages with %bootstrap condition in nss-myhostname package since the package itself is already protected.- fix nss-resolve sub package: - add a %files section - add a package description - libnss_resolve.so.2 is now part of this subpackage - add %post and %postun sections- Specfile cleanup: - reorganize some files in %files by types - some config files were missing the "noreplace" attribute- Use %config(noreplace) for %{_sysconfdir}/pam.d/systemd-user- Rework systemd-gatewayd package: - some gateway's files were still in the main package - it now includes all progs dealing with remote journals - it can be turned off (SP2 does that currently) - it's been renamed systemd-journal-remote to reflect that- Specfile cleanup: - only specify once %{_prefix}/lib/systemd/system-shutdown in %file - no need to list the content of %{_prefix}/lib/systemd/user-generators in %file - machined is not built when %bootstrap = 1- Specfile cleanup: - There's no point in listing all generators in %file explicitly. The default is to include all of them and if for some reason one must be excluded then it should be done explicitly.- Specfile cleanup: - remove explicit call to make for building man pages. This is not needed and was maybe useful when generated doc was pre-built and shipped in the tarball.- Specfile cleanup: - break overly long and unreadable line using mkdir - gather directory creations- Stop providing udevd.8 systemd-udevd has replaced udevd for some time already and usage of udevd should be avoided. Therefore don't encourage this and stop documenting it.- Import from factory: - Thu Feb 4 11:05:37 UTC 2016 - lnussel@suse.de - curl also causes building of journal-upload. That one has rather unusal certificate usage, set it's ca root to /etc/pki/systemd instead of the built-in default /etc/ssl as journal-remote and journal-upload think they can put stuff in /etc/ssl/certs then but that directory is managed by p11-kit and doesn't serve the purpose those programs think.- Package rootsymlink-generator helper. It was forgotten when switching to the git repo but re-added back. That said this thing should be removed as it's broken as soon as there's no direct link between the root fs and its backend device node (i.e. BTRFS).- Add kbd-model-map-extra file which contains the additional legacy keymaps needed by yast. This was previously directly patched in the systemd source code.- Imported e251b8d7fb5c801fdfa3a023257ba0e4d514f3b0 - Re-add back /dev/root symlink generation (although this must be deprecated and finally removed).- Migrating to the Suse Systemd git repo: Third step: - Re-enable networkd (disabled by default in SLE12)- Migrating to the Suse Systemd git repo: Second step: - Import the specfile - Import the tarball generated from the git repo - Import lastest changes for the different scripts- Migrating to the Suse Systemd git repo: First step: drop all patches and drop the tar ball. The dropped patches are: fix-support-for-boot-prefixed-initscript-bnc-746506.patch set-and-use-default-logconsole.patch ensure-ask-password-wall-starts-after-getty-tty1.patch 0001-rules-block-add-support-for-pmem-devices-3683.patch Fix-run-lock-directories-permissions-to-follow-openSUSE-po.patch 1007-physical-hotplug-cpu-and-memory.patch 1066-udev-add-compatibility-links-for-truncated-by-id-links.patch watch_resolv.conf_for_become_changed.patch 0019-make-completion-smart-to-be-able-to-redirect.patch systemd-add-user-keep.patch 0001-core-re-sync-bus-name-list-after-deserializing-durin.patch systemd-228-nspawn-make-journal-linking-non-fatal-in-try-and-auto.diff avoid-random-hangs-on-timeouts-due-lost-cwd.patch 1037-udev-exclude-cd-dvd-from-block-device.patch 0001-add-network-device-after-NFS-mount-units.patch journald-advice-about-use-of-memory.patch 1011-64-btrfs.rules-skip-btrfs-check-if-devices-are-not-r.patch 1006-udev-always-rename-network.patch handle-numlock-value-in-etc-sysconfig-keyboard.patch use-rndaddentropy-ioctl-to-load-random-seed.patch 0001-pid1-don-t-return-any-error-in-manager_dispatch_noti.patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch 0001-pam_systemd_do_override_XDG_RUNTIME_DIR_of_the_original_user.patch 0001-bnc888612-logind-polkit-acpi.patch avoid-divide-by-zero-sigtrap.patch 1035-99-systemd.rules-Ignore-devices-with-SYSTEMD_READY-0.patch suse-sysv-bootd-support.diff ensure-shortname-is-set-as-hostname-bnc-820213.patch parse-crypttab-for-noauto-option.patch tty-ask-password-agent-on-console.patch 0001-pid1-process-zero-length-notification-messages-again.patch handle-root_uses_lang-value-in-etc-sysconfig-language.patch 0001-core-exclude-.slice-units-from-systemctl-isolate.patch vhangup-on-all-consoles.patch 0001-systemctl-pid1-do-not-warn-about-missing-install-inf.patch apply-ACL-for-nvidia-device-nodes.patch make-emergency.service-conflict-with-syslog.socket.patch 0001-journal-warn-when-we-fail-to-append-a-tag-to-a-journ.patch 1096-new-udev-root-symlink-generator.patch 1099-Add-default-rules-for-valve-steam-controller-to-work.patch 0001-journal-set-STATE_ARCHIVED-as-part-of-offlining-2740.patch systemd-install-compat_pkgconfig-always.patch 1012-Skip-persistent-device-link-creation-on-multipath-de.patch 0001-avoid-abort-due-timeout-at-user-service.patch insserv-generator.patch apply-ACL-for-nvidia-uvm-device-node.patch restore-var-run-and-var-lock-bind-mount-if-they-aren-t-sym.patch systemd-pam_config.patch systemd-dbus-system-bus-address.patch let-linker-find-libudev-for-libdevmapper.patch 1098-systemd-networkd-alias-network-service.patch 0001-let-systemctl-completion-ignore-at-names.patch boot-local-start.patch 1095-set-ssd-disk-to-use-deadline-scheduler.patch tomcat6-var-lock-subsys-legacy.patch let-vconsole-setup-get-properties-only-once-to-copy-them.patch plymouth-quit-and-wait-for-emergency-service.patch respect-nfs-bg-option.patch 0001-If-the-notification-message-length-is-0-ignore-the-m.patch 1062-rules-set-default-permissions-for-GenWQE-devices.patch rescue-emergency-target-conflicts.patch Correct_assert_on_unexpected_error_code.patch 1097-udevd-increase-maximum-number-of-children.patch 0001-core-fix-bus-name-synchronization-after-daemon-reloa.patch 1005-create-default-links-for-primary-cd_dvd-drive.patch allow-multiple-sulogin-to-be-started.patch systemd-230-cgroup2-use-new-fstype-for-unified-hierarchy.patch 0010-do-not-install-sulogin-unit-with-poweroff.patch 1003-udev-netlink-null-rules.patch 1002-rules-create-by-id-scsi-links-for-ATA-devices.patch 0001-nss-mymachines-do-not-allow-overlong-machine-names.patch shut-up-rpmlint-on-var-log-journal.patch systemd-tmp-safe-defaults.patch portmap-wants-rpcbind-socket.patch hostname-NULL.patch 0001-pid1-more-informative-error-message-for-ignored-noti.patch 0001-journal-fix-HMAC-calculation-when-appending-a-data-o.patch handle-disable_caplock-and-compose_table-and-kbd_rate.patch kbd-model-map.patch systemctl-set-default-target.patch 0014-journald-with-journaling-FS.patch 0001-On_s390_con3270_disable_ANSI_colour_esc.patch- Import a better fix from upstream for bsc#1001765 - Added: 0001-pid1-more-informative-error-message-for-ignored-noti.patch 0001-pid1-process-zero-length-notification-messages-again.patch - Updated (no code changes, only patch metadata) 0001-If-the-notification-message-length-is-0-ignore-the-m.patch 0001-pid1-don-t-return-any-error-in-manager_dispatch_noti.patch- Re add back "udev: don't require nsserv and fillup" Did this in the wrong project... it was a complicated day today ;)- Added 2 patches to fix bsc#1001765 0001-If-the-notification-message-length-is-0-ignore-the-m.patch 0001-pid1-don-t-return-any-error-in-manager_dispatch_noti.patch- Revert "udev: don't require nsserv and fillup" It's been judged too late for being part of SLE12 final release. Nevertheless it's part of Factory and will be reintroduced after the final release is out (ie through an update).- systemd-sysv-convert: make sure that /var/lib/systemd/sysv-convert/database is always initialized (bsc#982211) If "--save" command was used and the sysv init script wasn't enabled at all the database file wasn't created at all. This makes the subsequent call to "--apply" fail even though this should not considered as an error.- Added patches to fix journal with FSS protection enabled (bsc#1000435) 0001-journal-fix-HMAC-calculation-when-appending-a-data-o.patch 0001-journal-set-STATE_ARCHIVED-as-part-of-offlining-2740.patch 0001-journal-warn-when-we-fail-to-append-a-tag-to-a-journ.patch- udev: don't require nsserv and fillup (bsc#999841) udev has no LSB init scripts nor fillup templates anymore.- Build require python and python-lxml in order to generate systemd.directives man page (bsc#986952)- Add rules: block: add support for pmem devices (#3683) (bsc#988119) 0001-rules-block-add-support-for-pmem-devices-3683.patch- Fix is-enabled check in systemd-sysv-install (bsc#997268)- Only BuildRequire gnu-efi when building the 'real' systemd package.- Add a script to fix /var/lib/machines to make it suitable for rollbacks (bsc#992573)- reverted the systemctl split-off on request of Franck Bui.- Add sysusers to the new split "systemctl" subpackage- Split systemctl and tmpfiles into a separate package- Fix 1099-Add-default-rules-for-valve-steam-controller-to-work.patch to enable missing functionality of Steam Controller- Backport unified_cgroup_hierarchy fix for Linux >= 4.4. boo#989276 + systemd-230-cgroup2-use-new-fstype-for-unified-hierarchy.patch- drop 1060-udev-use-device-mapper-target-name-for-btrfs-device-ready.patch it breaks btrfs on multiple device-mapper devices (boo#984516). The problem it tried to fix is already fixed in rule shipped with btrfsprogs (see boo#912170).- fix warning about missing install info during preset (boo#970293) 0001-systemctl-pid1-do-not-warn-about-missing-install-inf.patch- Avoid bootstrap cycle with sg3_utils- Fix patch patch handle-numlock-value-in-etc-sysconfig-keyboard.patch that is do not close a file descriptor twice (boo#973907)- Add two patches which address logind/networkd disappearing from dbus (and busctl) even while the units and processes continue running. 0001-core-fix-bus-name-synchronization-after-daemon-reloa.patch 0001-core-re-sync-bus-name-list-after-deserializing-durin.patch- drop all compiler/linker option customizations: - -pipe option is used by default since day 0 - get rid of cflags() function which is not needed - --hash-size has no impact specially in runtime IOW, use the default options for the compiler and the linker, there's no point in making systemd different from other package in this regards.- use %make_build instead of 'make %{?_smp_mflags}'- be more strict on own lib version requirements- systemd should require udev with the exact same version- Modify patch handle-numlock-value-in-etc-sysconfig-keyboard.patch to allow that open, seek, and read of /dev/mem may fail e.g. on XEN based virtual guests (bsc#961120)- Add upstream patch 0001-core-exclude-.slice-units-from-systemctl-isolate.patch this fixes forced logouts on isolate target aka changing runlevel (boo#966535)- require curl and bzip2 to build importd - curl also causes building of journal-upload. That one has rather unusal certificate usage, set it's ca root to /etc/pki/systemd instead of the built-in default /etc/ssl as journal-remote and journal-upload think they kan put stuff in /etc/ssl/certs then but that directory is managed by p11-kit and doesn't serve the purpose those programs think. - /var/lib/systemd/random-seed is a file - own /var/lib/machines - add systemd-228-nspawn-make-journal-linking-non-fatal-in-try-and-auto.diff- systemd-sysv-install: Fix chkconfig argument for disable op- Create groups adm,input,tape in fixed order (boo#944660)- Make sure we don't use tmpfs on /tmp by default (bsc#940522)- Avoid enabling readahead services; they have been removed. - In %install, only process kbd-model-map.xkb-generated if it exists. Resolves a build failure in 13.2/42.1.- spec: update minimum kernel version to 3.11 - Update minimum util-linux version to 2.27.1- Add patch to enable working steam controller: * 1099-Add-default-rules-for-valve-steam-controller-to-work.patch- fix CVE-2015-7510: Stack overflow in nss-mymachines (boo#956712) Add 0001-nss-mymachines-do-not-allow-overlong-machine-names.patch- Update to new upstream release 228 * The various memory-related resource limit settings (such as LimitAS=) now understand the usual K, M, G, ... suffixes to the base of 1024 (IEC). Similar, the time-related settings understand the usual min, h, day, ... suffixes now. * CPUAffinity= now takes CPU index ranges in addition to just individual indexes. * A number of properties previously only settable in unit files are now also available as properties to set when creating transient units programmatically via the bus. - Remove 0001-Make-sure-the-mount-units-pulled-by-RequiresMountsFo.patch (merged upstream)- Update to 227. - Rebase systemd-pam_config.patch, handle-root_uses_lang-value-in-etc-sysconfig-language.patch, 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch, 0001-On_s390_con3270_disable_ANSI_colour_esc.patch, 0014-journald-with-journaling-FS.patch, 0019-make-completion-smart-to-be-able-to-redirect.patch, avoid-divide-by-zero-sigtrap.patch, systemd-add-user-keep.patch, set-and-use-default-logconsole.patch, tty-ask-password-agent-on-console.patch, 0001-bnc888612-logind-polkit-acpi.patch, watch_resolv.conf_for_become_changed.patch, 1097-udevd-increase-maximum-number-of-children.patch. - Remove 0002-units-enable-waiting-for-unit-termination-in-certain.patch, 1001-re-enable-by_path-links-for-ata-devices.patch, rules-add-lid-switch-of-ARM-based-Chromebook-as-a-power-sw.patch: fixed upstream.- Modify patch handle-root_uses_lang-value-in-etc-sysconfig-language.patch to handle locale at boot time well (boo#927250) - Be able to use build service environments several times- 1096-new-udev-root-symlink-generator.patch: fix substitution in ExecStart value- enable seccomp for aarch64 (fate#318444)- Fix again UEFI for mini package- Drop one more undesirable Obsoletes/Provides. This should have been a Conflicts. (There was already a Conflicts, and since Conflicts go both ways, we won't need a second one.)- No UEFI for systemd-mini- Add 2 upstream patches to fix boo#949574 and bsc#932284 0001-Make-sure-the-mount-units-pulled-by-RequiresMountsFo.patch 0002-units-enable-waiting-for-unit-termination-in-certain.patch- Disable systemd-boot on aarch64 since it fails to build. Error while compiling src/boot/efi/util.o is: usr/include/efi/aarch64/efibind.h:2:20: fatal error: stdint.h: No such file or directory- Fix UEFI detection logic: basically we let configure.ac figure out if UEFI is supported by the current build environment. No need to clutter the spec file with a new conditionnal %has_efi. - Provide systemd-bootx64.efi (aka gummiboot)- Modify patch tty-ask-password-agent-on-console.patch to reflect the changes done for pull request 1432- Undo Obsoletes/Provides (from Aug 11), creates too big a cycle. - Provide systemd-sysv-install program/link [bnc#948353]- Fix patch tty-ask-password-agent-on-console.patch not to crash away but enable it to ask on all devices of /dev/console- Avoid "file not found /etc/udev/rules.d/70-persistent-net.rules" waring occurring in %post- Add patch let-vconsole-setup-get-properties-only-once-to-copy-them.patch to avoid broken virtual console mapping due stressed ioctl API for the virtual consoles (boo#904214)- Fix last change that is use the new name for udev packages in %pretrans.- restore usage of LUA in %pretrans.- Try to generate the systemd users and groups always in same order to avoid republish other packages (boo#944660)- cleanup specfile by removing commands that were dealing with systemd pre-generated files: we're now using systemd tarball generated directly from the git repo which doesn't contain any of these files. - there's no point in using LUA in %pretrans- Drop 0009-make-xsltproc-use-correct-ROFF-links.patch This patch was initialy added to workaround bsc#842844. But it appears that man(1) was fixed (included since 13.2 at least) to handle manual pages that consist only of a .so directive such as '.so '.- Change use-rndaddentropy-ioctl-to-load-random-seed.patch to make it work on big endian- Use Obsolete/Provides strategy from windows:mingw:mingw64/mingw64-cross-gcc to do the bootstrap cycle and kick out -mini afterwards.- Update to new upstream release 224 * systemd-networkd gained a number of new configuration options for DHCP, tunnels and bridges * systemd-efi-boot-generator functionality was merged into systemd-gpt-auto-generator.- /usr/share/systemd/kbd-model-map: added entries for xkeyboard-config converted keymaps; mappings, which already exist in original systemd mapping table are being ignored though, i.e. not overwritten; needs kbd in buildrequires (FATE#318426)- hostname-NULL.patch: Work around a crash on XEN hosts in OBS. /etc/hostname is not present and systemd then does strchr(hostname,soemthing) with hostname NULL.- Add Correct_assert_on_unexpected_error_code.patch to work around a problem of an assert on ENODEV for closing fd on an input event device (boo#939571)- Remove udev-generate-rules.sh, apparently not used by anything in the systemd nor udev-persistent-ifnames package.- Systemd v222, bugfix release. - Drop upstream patches 0006-pam_systemd-Properly-check-kdbus-availability.patch 0023-core-fix-reversed-dependency-check-in-unit_check_unn.patch 0031-install-fix-bad-memory-access.patch 1032-ata_id-unbotch-format-specifier.patch - Drop SUSE patch 1013-no-runtime-PM-for-IBM-consoles.patch udev does no longer enable USB HID power management at all. - The udev accelerometer helper was removed, obsoleted by iio-sensor-proxy package. - networkd gained a new configuration option IPv6PrivacyExtensions. - udev does not longer support the WAIT_FOR_SYSFS= key in udev rules. There are no known issues with current sysfs, and udev does not need or should be used to work around such bugs.- Avoid restarting logind [bnc#934901] - Do not suppress errors in any case, even if they are ignored- Fix devel package requires (both mini and real required real libsystemd0)- Rework patch tty-ask-password-agent-on-console.patch to fit the requisition of https://bugs.freedesktop.org/show_bug.cgi?id=82004- Rework "-mini" package logic to not conflict with itself and then add libsystemd0 to mini.- remove SysVStartPriority= from after-local.service, unsupported since v218. Note that this option was only parsed and that's it. the logic to give "start priority" was never implemented.- change the default fallback ntp servers to the opensuse pool.ntp.org vendor zone. - We still need to run systemd-sysctl.service after local-fs.target otherwise it works only when /boot is in the root filesystem but not when it is a separate partition.- Obsolete pm-utils and suspend (boo#925873). - Remove pm-utils support (remove Forward-suspend-hibernate-calls-to-pm-utils.patch).- remove patch sysctl-handle-boot-sysctl.conf-kernel_release.patch from the filelist.- libpcre, glib2 and libusb are not used by systemd, remove from buildrequires.- 1032-ata_id-unbotch-format-specifier.patch: fix udev ata_id output. - 0023-core-fix-reversed-dependency-check-in-unit_check_unn.patch fix StopWhenUnneeded=true in combination with a Requisite= dependency. - 0031-install-fix-bad-memory-access.patch: Fix Bad memory access - 0006-pam_systemd-Properly-check-kdbus-availability.patch: if kdbus is enabled (i.e boot with kdbus=1) DBUS_SESSION_BUS_ADDRESS must not be exported. - spec: add a min_kernel_version macro to ensure the package conflicts with kernel versions in which systemd cannot run.- sysctl-handle-boot-sysctl.conf-kernel_release.patch dropped, replaced by a tmpfiles.d snippet "current-kernel-sysctl.conf" (feature implemented in v220 just for our usecase)- fix build when resolved is enabled - remove fsck -l test in spec file, systemd requires util-linux 2.26 or later where this feature is already available.- Fix bootstrap build by guarding filelists (man pages don't get built in bootstrap mode) - Drop commented sections from baselibs.conf, allows format_spec_file to have a successful run- Install 50-coredump.conf as coredumpctl is now installed by default and does not use journal anymore as default storage- Update to new upstream release 221 * From 220: * libgudev was moved into a package of its own * Runlevels 2, 3 and 4 are no longer distinct, they all map to multi-user.target. * The EFI System Partition mounted to /boot will be unmounted 2 minutes after boot. * systemd does not support direct live-upgrades (via `systemctl daemon-reexec`) from versions older than v44 anymore. * systemd-nspawn may now be called as part of a shell pipeline. * systemd-shutdownd has been removed. This service was previously responsible for implementing scheduled shutdowns as exposed in /usr/bin/shutdown's time parameter. This functionality has now been moved into systemd-logind and is accessible via a bus interface. * udev will no longer call blkid and create symlinks for all block devices, but merely those from a whitelist (cf. 60-persistent-storage.rules). * /usr/lib/os-release gained a new optional field VARIANT= * Details at http://lists.freedesktop.org/archives/systemd-devel/2015-May/032147.html * From 221: * New sd-bus and sd-event APIs in libsystemd * If there is both a systemd unit and a SysV init script for the same service name, and `systemctl enable` or other operation is run, both will now be enabled (or execute the related operation on both), not just the unit. - Split libsystemd0 to support systemd-less nspawn containers - Redo manpage file lists without %exclude, tends to hide unpackaged files. - hwdb belongs to udev - Resolve memory leak and add missing _cleanup_free_ to 0001-On_s390_con3270_disable_ANSI_colour_esc.patch - Remove systemd-powerd-initctl-support.patch (no longer builds because shutdownd is gone) - Remove quilt-patches/0001-core-rework-device-state-logic.patch, 0001-Let-some-boolean-survive-a-daemon-reload.patch (merged upstream), 0001-Let-some-boolean-survive-a-daemon-reload.patch (obsolete)- Remove libudev0 from baselibs.conf- Drop 1055-let-9719859c07aa13539ed2cd4b31972cd30f678543-apply.patch as now upstream code - Add 0001-Let-some-boolean-survive-a-daemon-reload.patch to fix bsc#933365 and boo#934077- Add 1098-systemd-networkd-alias-network-service.patch to alias network.service the same way NetworkManager and wicked does. This is needed by yast2 and other parts of the system. boo#933092- Modify patch 1021-udev-re-add-persistent-net-rules.patch to use the new return values of proc_cmdline() in enable_name_policy() this should fix boo#931165- Drop 1021-udev-re-add-persistent-net-rules.patch, 1036-rules-disable-usage-of-dev_id-in-persistent-rules.patch, 1040-re-enable-dev_id-conditionally-in-persistent-rules.patch, 1046-fix-duplicated-rules-with-layer3-interfaces.patch, 1050-only-rename-SRIOV-VF-devices-when-name-starts-with-eth.patch, 1051-check-if-NAME-has-a-value.patch, 1053-better-checks-in-write_net_rules.patch, 1088-drop-renaming-of-virtual-interfaces-in-guest.patch. 1021 originally broke parsing of net.ifnames=0 [bnc#931165], and given that neither the kernel command line needs to be touched nor the source be patched to reach the unpredictable naming setup for SLE, all these parts are moved to a separate package.- Add upstream patch 0001-core-don-t-change-removed-devices-to-state-tentative.patch to fix the fix of the last backport (bsc#921898)- Reenable networkd which was silently disabled on Feb 18- Add 0001-core-rework-device-state-logic.patch to fix spurious automated umount after mount.- mark more subpackages as !bootstrap for systemd-mini usage.- spec : remove --with-firmware-path, firmware loader was removed in v217 - spec: remove --disable-multi-seat-x, gone.(fixed in xorg) - spec: Do not enable systemd-readahead-collect.service and systemd-readahead-replay.service as these do not exist anymore. - spec: drop timedate-add-support-for-openSUSE-version-of-etc-sysconfig.patch Yast was fixed to write all timezone changes exactly how timedated expects things to be done. - spec: remove handle-etc-HOSTNAME.patch, since late 2014 the netcfg package handles the migration from /etc/HOSTNAME to /etc/hostname and owns both files. -spec: remove boot.udev and systemd-journald.init as they currently serve no purpose. - suse-sysv-bootd-support.diff: Remove HAVE_SYSVINIT conditions, we are in sysvcompat-only codepath, also remove the code targetting other distributions, never compiled as the TARGET_$DISTRO macros are never defined. - systemd-powerd-initctl-support.patch guard with HAVE_SYSV_COMPAT - set-and-use-default-logconsole.patch: fix HAVE_SYSV_COMPAT guards - insserv-generator.patch: Only build when sysvcompat is enabled - vhangup-on-all-consoles.patch add a comment indicating this is a workaround for a kernel bug. - spec: Add option to allow disabling sysvinit compat at build time. - spec: Add option to enable resolved at build time. - spec: Remove all %ifs for !factory products, current systemd releases can neither be built nor installed in older products without upgrading several components of the base system. (removed: 1008-add-msft-compability-rules.patch was only for =< 13.1) - spec: remove all dummy "aliases" to /etc/init.d, that made sense only when those init scripts still existed. (dummy localfs.service source: gone) - systemd-sleep-grub: moved to the grub2 package where it belongs as a suspend/resume hook (SR#286533) (drops prepare-suspend-to-disk.patch) - remove LFS_CFLAGS from CFLAGS, never needed in systemd as it force feds config.h everywhere in the preprocessor cmdline.- Update to new upstream release 219 * systemd units can now be "unsupported" (like, for example, .device in a containers), similar to the "skipped" state in SUSE's prior sysvinit scripts. * tmpfiles gained the 'v' type for creating btrfs subvolumes. * tmpfiles gained the 'a' type for setting ACLs. * systemd-nspawn gained new switches: --ephemeral, --template * The /var/lib/containers location is deprecated and replaced by /var/lib/machines. * machinectl gained the copy-from and copy-to commands. * machinectl now knows a "bind" command (for use with nspawn) * new "systemd-importd" daemon to download container images and run them as nspawn containers. * networkd collects LLDP network announcements, if available, and so shown in networkctl. * The fallback terminal type was changed from "vt102" to "vt220", allowing PgUp/PgDn keys to work. * Pressing Ctrl-Alt-Del 7x in 2 seconds forces a umount+reboot now, useful should the regular shutdown hang. * Removing storage will cause systemd to unmount the associated mountpoints so that they don't linger around.- Add suse-sysv-bootd-support.diff (reinstate old Revert-service-drop-support-for-SysV-scripts-for-the-early.patch)- Update to systemd v218-1050-g38ab096 - Remove patches use-usr-sbin-sulogin-for-emergency-service.patch (upstream fixed it) - Reinstate and improve (remove huge indents from) tty-ask-password-agent-on-console.patch, 0014-journald-with-journaling-FS.patch, rootsymlink_generator.- disable systemd-resolved for now as it interacts not well with our methods and security has concerns regarding spoofing. bsc#917781- Add patch kbd-model-map.patch to add missed keyboard layouts which are offered by YaST2 (bsc#910643 and boo#897803)- Update to new upstream release 218 * New utilities: systemd-timesyncd (SNTP client), systemd-resolved, systemd-networkd, networkctl, systemd-sysusers * machinectl gained a "poweroff" command for clean container shutdown * The udev hwdb now contains DPI information for mice. * Userspace firmware loading support has been removed and the minimum supported kernel version is thus bumped to 3.7. - Remove patches: G=gone locally, is upstream; D=dropped: no longer needed; N=no longer applies to source nor is it deemed needed; K=killed: no longer applicable and too complex to resolve: - --- G 0002-rfkill-rework-how-we-generate-file-names-from-rfkill.patch G avoid-assertion-if-invalid-address-familily-is-passed-to-g.patch K service-flags-sysv-service-with-detected-pid-as-RemainAfte.patch K remain_after_exit-initscript-heuristic-and-add-new-LSB-hea.patch K handle-SYSTEMCTL_OPTIONS-environment-variable.patch K 0018-Make-LSB-Skripts-know-about-Required-and-Should.patch K log-target-null-instead-kmsg.patch K tty-ask-password-agent-on-console.patch K 513-nspawn-veth.patch K 1087-infinit-timeout-for-kmod-loaded-modules.patch D module-load-handle-SUSE-etc-sysconfig-kernel-module-list.patch D avoid-leaking-socket-descriptors.patch D 0001-make-fortify-happy-with-ppoll.patch N fix-owner-of-var-log-btmp.patch N disable-nss-myhostname-warning-bnc-783841.patch N Revert-service-drop-support-for-SysV-scripts-for-the-early.patch N 0001-make-209-working-on-older-dist.patch N 0001-Don-t-snprintf-a-potentially-NULL-pointer.patch N tmpfiles-do-not-clean-for-mandb-index-files.patch G 0001-sd-bus-don-t-look-for-a-64bit-value-when-we-only-hav.patch G avoid-assertion-if-invalid-address-familily-is-passed-to-g.patc G optionally-warn-if-nss-myhostname-is-called.patch G 0001-units-systemd-sysctl.service.in-run-after-load-modul.patch G 0004-getty-generator-properly-escape-instance-names.patch G rules-add-lid-switch-of-ARM-based-Chromebook-as-a-power-sw.patch G 0008-Reset-signal-mask-on-re-exec-to-init.patch G 0001-login-fix-pos-array-allocation.patch G 0002-login-set-pos-slot-to-fallback-on-pos-eviction.patch G 0003-login-Allow-calling-org.freedesktop.login1.Seat.Swit.patch G 0004-fix-typo-in-iDRAC-network-interface-name-irdac-idrac.patch G 0005-Replace-var-run-with-run-in-remaining-places.patch G 0006-Revert-back-to-var-run-at-a-couple-of-problems.patch G 0007-README-document-that-var-run-must-be-a-symlink-run.patch G 0008-Use-var-run-dbus-system_bus_socket-for-the-D-Bus-soc.patch G 0009-mount-don-t-send-out-PropertiesChanged-message-if-ac.patch G 0010-mount-don-t-fire-PropertiesChanged-signals-for-mount.patch G 0011-logs-show-fix-corrupt-output-with-empty-messages.patch G 0012-journalctl-refuse-extra-arguments-with-verify-and-si.patch G 0014-nspawn-fix-detection-of-missing-proc-self-loginuid.patch G 0001-Fix-systemd-stdio-bridge-symlink.patch G 0002-execute-free-directory-path-if-we-fail-to-remove-it-.patch G 0003-Do-not-print-invalid-UTF-8-in-error-messages.patch G 0004-man-document-missing-options-of-systemd-run.patch G 0005-systemd-run-add-some-extra-safety-checks.patch G 0006-journal-assume-that-next-entry-is-after-previous-ent.patch G 0007-journal-forget-file-after-encountering-an-error.patch G 0008-core-correctly-unregister-PIDs-from-PID-hashtables.patch G 0009-logind-fix-reference-to-systemd-user-sessions.servic.patch G 0010-man-update-link-to-LSB.patch G 0011-man-systemd-bootchart-fix-spacing-in-command.patch G 0012-man-add-missing-comma.patch G 0013-units-Do-not-unescape-instance-name-in-systemd-backl.patch G 0001-core-busname-add-lookup-string-for-BUSNAME_FAILURE_S.patch G 0002-manager-flush-memory-stream-before-using-the-buffer.patch G 0003-busname-don-t-drop-service-from-the-result-string.patch G 0004-fix-off-by-one-error-in-array-index-assertion.patch G 0005-logind-fix-policykit-checks.patch G 0006-rules-mark-loop-device-as-SYSTEMD_READY-0-if-no-file.patch G 0008-man-multiple-sleep-modes-are-to-be-separated-by-whit.patch G 0001-gpt-auto-generator-don-t-return-OOM-on-parentless-de.patch G 0002-bus-fix-memory-leak-when-kdbus-is-not-enabled.patch G 0006-Do-not-return-1-EINVAL-on-allocation-error.patch G 0007-networkd-fix-typo.patch G 0008-sd-bus-don-t-access-invalid-memory-if-a-signal-match.patch G 0009-sd-bus-don-t-choke-if-somebody-sends-us-a-message-wi.patch G 0012-journald-remove-stray-reset-of-error-return-value.patch G 0013-core-libsystemd-systemd-timedate-udev-spelling-fixes.patch G 0001-cgroup-it-s-not-OK-to-invoke-alloca-in-loops.patch G 0002-machined-fix-Kill-bus-call-on-machine-objects-when-w.patch G 0003-sd-bus-don-t-use-assert_return-to-check-for-disconne.patch G 0004-core-don-t-try-to-relabel-mounts-before-we-loaded-th.patch G 0005-sd-daemon-fix-incorrect-variable-access.patch G 0006-sd-event-initialization-perturbation-value-right-bef.patch G 0007-sd-event-don-t-accidentally-turn-of-watchdog-timer-e.patch G 0008-systemctl-kill-mode-is-long-long-gone-don-t-mention-.patch G 0009-ask-password-when-the-user-types-a-overly-long-passw.patch G 0001-journal-fix-export-of-messages-containing-newlines.patch G 0002-systemctl-update-NAME-to-PATTERN-in-help.patch G 0003-tty-ask-password-agent-return-negative-errno.patch G 0004-systemd-python-use-.hex-instead-of-.get_hex.patch G 0005-systemd-python-fix-failing-assert.patch G 0007-dbus-suppress-duplicate-and-misleading-messages.patch G 0001-reduce-the-amount-of-messages-logged-to-dev-kmsg-whe.patch G 0001-bash-completion-fix-__get_startable_units.patch G 0002-sysctl-replaces-some-slashes-with-dots.patch G 0003-delta-do-not-use-unicode-chars-in-C-locale.patch G 0004-implement-a-union-to-pad-out-file_handle.patch G shut-up-annoying-assertion-monotonic-clock-message.patch G 0001-sd-rtnl-message-append-fix-uninitialized-memory.patch G 0001-tmpfiles-fix-permissions-on-new-journal-files.patch G 0001-errno-make-sure-to-handle-the-3-errnos-that-are-alia.patch G 0003-analyze-fix-plot-with-bad-y-size.patch G 0004-job-add-waiting-jobs-to-run-queue-in-unit_coldplug.patch G 0005-job-always-add-waiting-jobs-to-run-queue-during-cold.patch G 0001-backlight-Avoid-restoring-brightness-to-an-unreadabl.patch G 0002-backlight-do-nothing-if-max_brightness-is-0.patch G 0003-backlight-unify-error-messages.patch G 0004-backlight-warn-if-kernel-exposes-backlight-device-wi.patch G 0005-backlight-handle-saved-brightness-exceeding-max-brig.patch G 0001-replace-more-dup-by-F_DUPFD_CLOEXEC.patch G 0002-pam_systemd-use-F_DUPFD_CLOEXEC-when-dupping-session.patch G 0001-core-close-socket-fds-asynchronously.patch G 0002-logind-bring-polkit-policy-for-hibernate-in-line-wit.patch G 0003-core-make-sure-to-serialize-jobs-for-all-units.patch G 0001-logind-ignore-lid-switch-if-more-than-1-display-is-c.patch G 0002-logind-fix-printf-format.patch G 0003-logind-ignore-lid-switch-events-for-30s-after-each-s.patch G 0004-logind-Do-not-fail-display-count-if-a-device-has-no-.patch G 0005-logind-move-lid-switch-handling-from-logind-main-to-.patch G 0006-man-clarify-that-the-ExecReload-command-should-be-sy.patch G 0007-man-readahead-fix-cmdline-switch-inconsistency-betwe.patch G 0008-man-update-journald-rate-limit-defaults.patch G 0009-nspawn-properly-format-container_uuid-in-UUID-format.patch G 0010-logind-allow-suspending-if-there-are-no-displays.patch G 0001-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0002-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0003-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0004-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0005-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-conf-parser-silently-ignore-sections-starting-with-X.patch G 0002-man-note-that-entire-sections-can-now-be-ignored.patch G 0004-machined-make-sure-GetMachineAddresses-is-available-.patch G 0005-core-Filter-by-state-behind-the-D-Bus-API-not-in-the.patch G 0006-login-add-mir-to-the-list-of-session-types.patch G 0007-logind-fix-Display-property-of-user-objects.patch G 0001-hwdb-update.patch G 0002-hwdb-update.patch G 0003-hwdb-PCI-include-primary-model-string-in-subsystem-m.patch G 0004-hwdb-update.patch G 0005-hwdb-update.patch G 0001-journal-cleanup-up-error-handling-in-update_catalog.patch G 0002-journal-properly-detect-language-specified-in-line.patch G 0003-man-mention-XDG_CONFIG_HOME-in-systemd.unit.patch G 0001-keymap-Add-Lenovo-Enhanced-USB-Keyboard.patch G 0002-keymap-Asus-EeePC-touchpad-toggle-key.patch G 0001-nspawn-allow-to-bind-mount-journal-on-top-of-a-non-e.patch G 0002-nspawn-restore-journal-directory-is-empty-check.patch G 0003-core-never-consider-failure-when-reading-drop-ins-fa.patch G 0004-socket-properly-handle-if-our-service-vanished-durin.patch G 0001-Do-not-unescape-unit-names-in-Install-section.patch G 0002-analyze-run-use-bus_open_transport_systemd-instead-o.patch G 0001-virt-rework-container-detection-logic.patch G 0002-fsck-include-device-name-in-the-message-about-missin.patch G 0003-units-use-KillMode-mixed-for-systemd-nspawn-.service.patch G 0004-util-ignore_file-should-not-allow-files-ending-with.patch G 0006-tty-ask-password-agent-Do-tell-what-directory-we-fai.patch G 0007-keyboard-add-Plantronics-.Audio-mute-button.patch G 0001-build-sys-use-glibc-s-xattr-support-instead-of-requi.patch G 0001-hwdb-fix-case-sensitive-match.patch G 0001-sd-event-restore-correct-timeout-behaviour.patch G 0002-bus-make-use-of-sd_bus_try_close-in-exit-on-idle-ser.patch G 0001-umount-modernizations.patch G 0002-namespace-when-setting-up-an-inaccessible-mount-poin.patch G 0003-core-allow-transient-mount-units.patch G 0004-systemd-detect-virt-only-discover-Xen-domU.patch G 0005-backlight-Do-not-clamp-brightness-for-LEDs.patch G 0006-log-honour-the-kernel-s-quiet-cmdline-argument.patch G 0001-core-fix-invalid-free-in-killall.patch G 0003-install-fix-invalid-free-in-unit_file_mask.patch G 0001-systemd-detect-virt-detect-s390-virtualization.patch G 0001-core-sysvcompat-network-should-be-equivalent-to-netw.patch G 0002-units-add-missing-caps-so-that-GetAddresses-can-work.patch G 0003-units-order-systemd-tmpfiles-clean.service-after-tim.patch G 0005-po-add-Greek-translation.patch G 0006-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0007-po-add-German-translation.patch G 0009-core-clean-up-signal-reset-logic-when-reexec.patch G 0010-util-treat-fuse.sshfs-as-a-network-filesystem.patch G 0011-build-sys-add-pthread-flag-for-libsystemd-shared.patch G 0012-core-transaction-avoid-misleading-error-message-when.patch G 0001-vconsole-also-copy-character-maps-not-just-fonts-fro.patch G 0002-core-make-sure-Environment-fields-passed-in-for-tran.patch G 0003-core-You-can-not-put-the-cached-result-of-use_smack-.patch G 0004-cryptsetup-don-t-add-unit-dependency-on-dev-null-dev.patch G 0005-man-fix-path-in-crypttab-5.patch G 0001-units-order-network-online.target-after-network.targ.patch G 0001-core-use-correct-format-string-for-UIDs.patch G 0002-core-transaction-fix-cycle-break-attempts-outside-tr.patch G 0003-fsck-consider-a-fsck-implementation-linked-to-bin-tr.patch G 0001-main-uid_to_name-might-fail-due-to-OOM-protect-again.patch G 0002-journald-make-MaxFileSec-really-default-to-1month.patch G 0003-units-remove-RefuseManualStart-from-units-which-are-.patch G 0004-util-refuse-considering-UID-0xFFFF-and-0xFFFFFFFF-va.patch G 0005-nspawn-block-open_by_handle_at-and-others-via-seccom.patch G 0006-tmpfiles-don-t-do-automatic-cleanup-in-XDG_RUNTIME_D.patch G 0007-units-skip-mounting-tmp-if-it-is-a-symlink.patch G 0001-parse_uid-return-ENXIO-for-1-uids.patch G 0002-util-when-unescaping-strings-don-t-allow-smuggling-i.patch G 0003-localed-consider-an-unset-model-as-a-wildcard.patch G 0004-sd-bus-when-an-event-loop-terminates-explicitly-clos.patch G 0005-bus-close-a-bus-that-failed-to-connect.patch G 0006-hwdb-update.patch G 0007-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-architecture-Add-tilegx.patch G 0002-architecture-Add-cris.patch G 0003-arch-add-crisv32-to-uname-check.patch G 0004-architecture-remove-cris-from-uname-list.patch G 0003-namespace-make-sure-tmp-var-tmp-and-dev-are-writable.patch G 0002-namespace-fix-uninitialized-memory-access.patch G 0001-machine-don-t-return-uninitialized-variable.patch G 0002-vconsole-setup-run-setfont-before-loadkeys.patch G 0001-util-consider-0x7F-a-control-chracter-which-it-is-DE.patch G 0002-util-don-t-consider-tabs-special-in-string_has_cc-an.patch G 0003-architecture-add-string-table-entries-for-mips-le-ar.patch G 0004-core-Added-support-for-ERRNO-NOTIFY_SOCKET-message-p.patch G 0005-service-don-t-accept-negative-ERRNO-notification-mes.patch G 0006-systemctl-show-StatusErrno-value-in-systemctl-status.patch G 0007-service-flush-status-text-and-errno-values-each-time.patch G 0001-journal-compress-return-early-in-uncompress_startswi.patch G 0002-journal-compress-improve-xz-compression-performance.patch G 0001-logind-allow-switching-to-unused-VTs-via-SwitchTo.patch G 0002-hostnamed-add-a-new-chassis-type-for-watches.patch G 0001-units-make-ExecStopPost-action-part-of-ExecStart.patch G 0001-event-pull-in-sd-event.h-from-event-util.h.patch G 0002-util-fix-has-cc-check-and-add-test.patch G 0003-sd-event-always-call-epoll_ctl-on-mask-updates-if-ed.patch G 0004-fileio-quote-more-shell-characters-in-envfiles.patch G 0001-Clear-up-confusion-wrt.-ENTRY_SIZE_MAX-and-DATA_SIZE.patch G 0002-units-serial-getty-.service-use-the-default-RestartS.patch G 0001-po-add-Ukrainian-translation.patch G 0002-man-document-yearly-and-annually-in-systemd.time-7.patch G 0003-core-nicer-message-when-inotify-watches-are-exhauste.patch G 0001-detect-virt-Fix-Xen-domU-discovery.patch G 0002-Be-more-verbose-when-bind-or-listen-fails.patch G 0003-Add-quotes-to-warning-message.patch G 0004-systemd-return-the-first-error-from-manager_startup.patch G 0001-bash-completion-p-option-for-journalctl.patch G 0002-journalctl-man-allow-only-between-terms.patch G 0003-systemd-use-pager-for-test-and-help.patch G 0001-bus-proxyd-fix-incorrect-comparison.patch G 0002-shell-completion-prevent-mangling-unit-names.patch G 0003-Always-check-asprintf-return-code.patch G 0004-bash-completion-use-list-unit-files-to-get-all-units.patch G 0005-core-only-set-the-kernel-s-timezone-when-the-RTC-run.patch G 0006-parse_boolean-require-exact-matches.patch G 0007-drop_duplicates-copy-full-BindMount-struct.patch G 0008-shell-completion-prevent-mangling-unit-names-bash.patch G 0009-journald-always-add-syslog-facility-for-messages-com.patch G 0001-sysv-order-initscripts-which-provide-network-before-.patch G 0002-keymap-Add-microphone-mute-keymap-for-Dell-Latitude.patch G 0003-keymap-Annotate-all-micmute-workarounds.patch G 0007-hwdb-update.patch G 0001-nspawn-fix-truncation-of-machine-names-in-interface-.patch G 0002-switch-root-umount-the-old-root-correctly.patch G 0003-bootchart-it-s-not-OK-to-return-1-from-a-main-progra.patch G 0004-login-set_controller-should-fail-if-prepare_vt-fails.patch G 0005-sd-resolve-fix-allocation-if-query-ids-never-reuse-t.patch G 0006-login-share-VT-signal-handler-between-sessions.patch G 0007-journald-also-increase-the-SendBuffer-of-dev-log-to-.patch G 0008-mount-setup-fix-counting-of-early-mounts-without-SMA.patch G 0009-journald-Fix-off-by-one-error-in-Missed-X-kernel-mes.patch G 0010-machine_kill-Don-t-kill-the-unit-when-killing-the-le.patch G 0011-units-fix-BindsTo-logic-when-applied-relative-to-ser.patch G 0012-util-try-to-be-a-bit-more-NFS-compatible-when-checki.patch G 0001-hwdb-keymaps-for-Samsung-900X3E-900X3F.patch G 0002-Add-hwdb-entry-for-Samsung-Series-7-Ultra.patch G 0003-keymap-Fix-HP-Pavillon-DV7.patch G 0004-hwdb-update-format-description-and-document-reloadin.patch G 0008-hwdb-update.patch G 0001-systemctl-Correct-error-message-printed-when-bus_pro.patch G 0002-units-order-systemd-fsck-.service-after-local-fs-pre.patch G 0003-keymap-Adjust-for-more-Samsung-900X4-series.patch G 0001-login-fix-memory-leak-on-DropController.patch G 0002-util-fix-minimal-race-where-we-might-miss-SIGTERMs-w.patch G 0003-sd-journal-properly-convert-object-size-on-big-endia.patch G 0004-sd-journal-verify-that-object-start-with-the-field-n.patch G 0001-nspawn-fix-network-interface.patch G 0001-completion-filter-templates-from-restartable-units.patch G 0002-systemd-fix-error-message.patch G 0003-Quote-unit-names-in-suggested-systemctl-commandlines.patch G 0004-config-parser-fix-mem-leak.patch G 0005-login-fix-mem-leak.patch G 0001-login-simplify-controller-handling.patch G 0001-initrd-parse-etc.service-ignore-return-code-of-daemo.patch G 0008-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0009-hwdb-update.patch G 0001-systemctl-allow-to-change-the-default-target-without.patch G 0001-activate-fix-fd-leak-in-do_accept.patch G 0002-analyze-avoid-a-null-dereference.patch G 0003-analyze-fix-mem-leak.patch G 0004-backlight-Avoid-error-when-state-restore-is-disabled.patch G 0005-bus-avoid-using-m-kdbus-after-freeing-it.patch G 0006-bus-unref-buscreds-on-failure.patch G 0007-core-fix-a-potential-mem-leak.patch G 0008-core-smack-setup-Actually-allow-for-succesfully-load.patch G 0009-journal-do-not-leak-mmaps-on-OOM.patch G 0010-manager-use-correct-cleanup-function.patch G 0001-core-fix-resource-leak-in-manager_environment_add.patch G 0002-util-remove-a-unnecessary-check.patch G 0003-udev-event-explicitly-don-t-read-from-invalid-fd.patch G 0004-shared-conf-parser.patch G 0005-logind-fix-typo.patch G 0006-systemctl-fix-resource-leak-CID-1237747.patch G 0007-libudev-monitor-warn-if-we-fail-to-request-SO_PASSCR.patch G 0008-shared-conf-parser-don-t-leak-memory-on-error-in-DEF.patch G 0009-bus-fix-bus_print_property-to-use-int-for-booleans.patch G 0001-journal-Do-not-count-on-the-compiler-initializing-fo.patch G 0002-include-fcntl.h-rather-than-sys-fcntl.h.patch G 0003-mount-order-options-before-other-arguments-to-mount.patch G 0004-shared-wtmp-utmp-don-t-clear-store_wtmp-in-utmp_put_.patch G 0005-shared-label.h-add-missing-stdio.h-include.patch G 0006-shared-sparse-endian.h-add-missing-byteswap.h-includ.patch G 0001-login-pause-devices-before-acknowledging-VT-switches.patch G 0001-nspawn-don-t-try-to-create-veth-link-with-too-long-i.patch G 0001-socket-introduce-SELinuxContextFromNet-option.patch G 0002-util-avoid-non-portable-__WORDSIZE.patch G 0001-Fix-warning-about-unused-variable-with-SELINUX.patch G 0002-bus-remove-unused-check.patch G 0001-systemd-tmpfiles-Fix-IGNORE_DIRECTORY_PATH-age-handl.patch G 0001-logind-add-support-for-Triton2-Power-Button.patch G 0002-logind-add-support-for-TPS65217-Power-Button.patch G 0001-shutdownd-clean-up-initialization-of-struct.patch G 0003-bootchart-parse-userinput-with-safe_atoi.patch G 0004-bootchart-check-return-of-strftime.patch G 0005-bootchart-Do-not-try-to-access-data-for-non-existing.patch G 0001-journalctl-do-not-output-reboot-markers-when-running.patch G 0002-udev-hwdb-New-Entry-for-Dell-XPS12-9Q33-keyboard.patch G 0001-core-swap-only-make-configured-units-part-of-swap.ta.patch G 0009-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-virt-detect-that-we-are-running-inside-the-docker-co.patch G 0002-bootchart-use-n-a-if-PRETTY_NAME-is-not-found.patch G 0003-fileio-label-return-error-when-writing-fails.patch G 0001-sd-event-don-t-require-a-signal-event-source-to-be-e.patch G 0004-sd-event-check-the-value-of-received-signal.patch G 0005-sd-id128-do-stricter-checking-of-random-boot-id.patch G 0001-keymap-Fix-touchpad-toggle-on-Toshiba-Satellite-P75-.patch G 0001-units-introduce-network-pre.target-as-place-to-hook-.patch G 0002-keymap-Fix-touchpad-toggle-key-on-Asus-laptops.patch G 0003-sd-bus-check-return-value-of-vasprintf.patch G 0004-core-map-the-rescue-argument-to-rescue.target.patch G 0005-util-avoid-double-close-of-fd.patch G 0001-systemctl-when-mangle-unit-names-for-the-isolate-suf.patch G 0001-tmpfiles-compare-return-against-correct-errno.patch G 0001-shell-completion-fix-completion-of-inactive-units.patch G 0002-shell-completion-propose-templates-for-disable-re-en.patch G 0003-man-we-don-t-have-Wanted-dependency.patch G 0004-selinux-fix-potential-double-free-crash-in-child-pro.patch G 0001-systemd-continue-switch-root-even-if-umount-fails.patch G 0002-systemd-try-harder-to-bind-to-notify-socket.patch G 0001-strv-add-an-additional-overflow-check-when-enlarging.patch G 0002-hwdb-Add-mapping-for-special-keys-on-compaq-ku-0133-.patch G 0003-journald-add-CAP_MAC_OVERRIDE-in-journald-for-SMACK-.patch G 0004-journal-do-server_vacuum-for-sigusr1.patch G 0005-cryptsetup-fix-an-OOM-check.patch G 0002-shutdown-pass-own-argv-to-run-initramfs-shutdown.patch G 0001-manager-Linux-on-hppa-has-fewer-rtsigs-hence-avoid-u.patch G 0002-time-also-support-infinity-syntax-in-parse_nsec.patch G 0003-time-earlier-exit-from-format_timestamp_relative-on-.patch G 0004-sd-bus-if-we-don-t-manage-to-properly-allocate-the-e.patch G 0005-journalctl-correct-help-text-for-until.patch G 0006-calendarspec-fix-typo-in-annually.patch G 0007-systemctl-do-not-ignore-errors-in-symlink-removal.patch G 0008-util-introduce-sethostname_idempotent.patch G 0009-util-fix-copy-paste-error-and-actually-set-the-new-h.patch G 0010-shutdown-do-final-unmounting-only-if-not-running-ins.patch G 0011-selinux-make-sure-we-do-not-try-to-print-missing-fie.patch G 0012-manager-do-not-print-anything-while-passwords-are-be.patch G 0001-sd-bus-properly-handle-removals-of-non-existing-matc.patch G 0002-keymap-Ignore-brightness-keys-on-Dell-Inspiron-1520-.patch G 0001-core-don-t-allow-enabling-if-unit-is-masked.patch G 0002-snapshot-return-error-when-snapshot-exists.patch G 0003-shared-install-avoid-prematurely-rejecting-missing-u.patch G 0004-Raise-level-of-Found-dependency.-lines.patch G 0005-units-order-sd-journal-flush-after-sd-remount-fs.patch G 0006-journald-fix-minor-memory-leak.patch G 0007-journald-also-check-journal-file-size-to-deduce-if-i.patch G 0008-journald-fix-memory-leak-on-error-path.patch G 0009-units-make-systemd-journald.service-Type-notify.patch G 0010-hwdb-Update-database-of-Bluetooth-company-identifier.patch G 0001-login-rerun-vconsole-setup-when-switching-from-vgaco.patch G 0002-shutdown-fix-arguments-to-run-initramfs-shutdown.patch G 0003-utf8-when-looking-at-the-next-unichar-honour-the-siz.patch G 0001-keymap-Add-support-for-IBM-ThinkPad-X41-Tablet.patch G 0002-keymap-Fix-special-keys-on-ThinkPad-X60-X61-Tablet.patch G 0001-systemctl-let-list-units-unit-files-honour-type.patch G 0002-systemctl-obey-state-in-list-unit-files.patch G 0002-core-watchdog-bus-properties-cannot-be-both-writable.patch G 0003-sd-bus-refuse-properties-that-claim-to-be-both-writa.patch G 0001-units-make-sure-rfkill-service-is-bount-to-the-actua.patch G 0001-selinux-access-fix-broken-ternary-operator.patch G 0002-systemctl-show-BindsTo-BoundBy-in-list-dependencies.patch G 0003-cryptsetup-default-to-no-hash-when-keyfile-is-specif.patch G 0004-core-fix-transaction-destructiveness-check-once-more.patch G 0001-units-tmpfiles-setup-dev-allow-unsafe-file-creation-.patch G 0002-man-tmpfiles.d-recommend-using-b-and-c.patch G 1009-cdrom_id-use-the-old-MMC-fallback.patch G 1010-udev-increase-result-size-for-programs.patch G 1014-udev-update-net_id-comments.patch G 1015-udev-persistent-naming-we-cannot-use-virtio-numbers-.patch G 1016-udev-warn-when-name_to_handle_at-is-not-implemented.patch G 1017-udev-serialize-synchronize-block-device-event-handli.patch G 1018-udev-do-not-skip-the-execution-of-RUN-when-renaming-.patch G 1019-udev-avoid-use-of-uninitialized-err.patch G 1020-udev-keyboard-also-hook-into-change-events.patch G 1022-udev-remove-seqnum-API-and-all-assumptions-about-seq.patch G 1023-udev-builtin-keyboard-do-tell-on-which-device-EVIOCS.patch G 1024-udev-always-close-lock-file-descriptor.patch G 1025-udev-exclude-device-mapper-from-block-device-ownersh.patch G 1026-udevd-inotify-modernizations.patch G 1027-udev-synthesize-change-events-for-partitions-when-to.patch G 1028-udev-link-config-fix-mem-leak.patch G 1029-udev-try-first-re-reading-the-partition-table.patch G 1030-udev-guard-REREADP-logic-with-open-O_ECXL.patch G 1031-udev-make-sure-we-always-get-change-for-the-disk.patch G 1032-udev-guard-REREADPT-by-exclusive-lock-instead-of-O_E.patch G 1033-udev-really-exclude-device-mapper-from-block-device.patch G 1034-udev-check-the-return-value-from-udev_enumerate_scan.patch G 1038-udev-fix-invalid-free-in-enable_name_policy.patch G 1039-udevadm-settle-fixed-return-code-for-empty-queue.patch G 1041-libudev-fix-udev_queue_get_queue_is_empty-logic.patch G 1042-libudev-queue-provide-file-descriptor-to-watch-busy-.patch G 1043-libudev-queue-watch-entire-directory-to-allow-the-re.patch G 1044-rules-update-qemu-hid-rules.patch G 1045-rules-don-t-enable-usb-pm-for-Avocent-devices.patch G 1047-udev-net_setup_link-builtin-should-print-the-reason-.patch G 1048-udev-net_setup_link-add-a-bit-more-logging.patch G 1049-udev-link_config-ignore-errors-due-to-missing-MAC-ad.patch G 1052-rules-uaccess-add-ID_SOFTWARE_RADIO.patch G 1054-udev-exclude-MD-from-block-device-ownership-event-lo.patch G 1056-udevd-add-event-timeout-commandline-option.patch G 1057-udev-unify-event-timeout-handling.patch G 1058-udev-unify-event-timeout-handling.patch G 1059-udev-fixup-commit-dd5eddd28a74a49607a8fffcaf960040db.patch G 1061-rules-allow-systemd-to-manage-loop-device-partitions.patch G 1063-udev-path_id-suppress-ID_PATH-for-devices-with-an-un.patch G 1064-udev-hwdb-do-not-look-at-usb_device-parents.patch G 1065-udev-bump-event-timeout-to-60-seconds.patch G 1067-udev-always-resolve-correctly-database-names-on-chan.patch G 1068-udev-net_setup_link-export-the-.link-filename-applie.patch G 1069-rules-net-setup-link-preserve-ID_NET_LINK_FILE-and-I.patch G 1070-rules-net-setup-link-remove-stray-linebreak.patch G 1071-udev-import-the-full-db-on-MOVE-events-for-devices-w.patch G 1072-udev-netif_rename-don-t-log-to-kmsg.patch G 1073-udev-drop-print_kmsg.patch G 1074-udev-fix-copy-paste-error-in-log-message.patch G 1075-udev-timeout-increase-timeout.patch G 1076-udev-timeout-warn-after-a-third-of-the-timeout-befor.patch G 1077-udev-timeout-warn-after-a-third-of-the-timeout-befor.patch G 1078-udev-remove-userspace-firmware-loading-support.patch G 1079-udev-remove-userspace-firmware-loading-support.patch G 1080-udevd-parse_argv-warn-if-argumens-are-invalid.patch G 1081-udevd-check-return-of-various-functions.patch G 1082-udevadm-hwdb-check-return-value-of-fseeko.patch G 1083-udev-node-warn-if-chmod-chown-fails.patch G 1084-udev-ctrl-log-if-setting-SO_PASSCRED-fails.patch G 1085-udev-fix-typos.patch G 1086-udevd-don-t-fail-if-run-udev-exists.patch G 1089-fix-cgroup-device-controller.patch G 1090-udev-path_id-set-supported_parent-for-well-known-SCS.patch G 1091-udev-path_id-update-comments.patch G 1092-libudev-do-not-accept-invalid-log-levels.patch G 1093-udev-Fix-parsing-of-udev.event-timeout-kernel-parame.patch G 1094-udev-avoid-magic-constants-in-kernel-cmdline-parsers.patch G 1098-udev-link_setup-respect-kernel-name-assign-policy.patch- update set-and-use-default-logconsole.patch - fix comparison of console log facility that caused journald to skip output to console (boo#912030)- Use Robert's latest patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch which drops NAMEPOLICY_KERNEL as this breaks all on current systems out there- remove 0022-systemd-tmpfiles-ownerkeep.patch since this is now implemented into the systemd-tmpfiles binary - add user based ignore statements in tmpfiles removal directives (bnc#903009) add systemd-add-user-keep.patch- use --boot option in systemd-tmpfiles-setup-dev.service (bnc#908476) add upstream patches: 0001-units-tmpfiles-setup-dev-allow-unsafe-file-creation-.patch 0002-man-tmpfiles.d-recommend-using-b-and-c.patch (adapted)- Update patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch to Robert's version- Add upstream patches 0001-selinux-access-fix-broken-ternary-operator.patch 0002-systemctl-show-BindsTo-BoundBy-in-list-dependencies.patch 0003-cryptsetup-default-to-no-hash-when-keyfile-is-specif.patch 0004-core-fix-transaction-destructiveness-check-once-more.patch - Avoid old net devices naming scheme on openSUSE 13.2 and less maybe caused by patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch- fix systemd-nspawn network-veth support (bnc#906709) add 513-nspawn-veth.patch- Add upstream patch 1098-udev-link_setup-respect-kernel-name-assign-policy.patch which may solve bsc#907318- Add upstream patches 0001-units-make-sure-rfkill-service-is-bount-to-the-actua.patch 0002-rfkill-rework-how-we-generate-file-names-from-rfkill.patch- Change the maximum number of children from CPU_COUNT * 256 to CPU_COUNT * 64. Update 1097-udevd-increase-maximum-number-of-children.patch- Increase number of children/workers to CPU_COUNT * 256 to avoid 'maximum number of children reached' (bnc#907393). Add 1097-udevd-increase-maximum-number-of-children.patch- Fix error return in rootsymlink_generator.c Update 1096-new-udev-root-symlink-generator.patch- Remove upstream patch 0001-systemd-logind.service-set-Type-notify.patch as systemd-logind.service is already from DBus type, compare with upstream commit eab459bc0639b81b32735f36d3e929e4bfa2cb4b- Add upstream patches 0001-systemd-logind.service-set-Type-notify.patch 0002-core-watchdog-bus-properties-cannot-be-both-writable.patch 0003-sd-bus-refuse-properties-that-claim-to-be-both-writa.patch- Re-add directory /usr/lib/systemd/system/basic.target.wants- remove pm-utils-hooks-compat.sh again, pm-utils built-in hooks partially duplicate hooks run by systemd which may potentially lead to problems, instead temporarily re-enable Forward-suspend-hibernate-calls-to-pm-utils.patch until boo#904828 can be addressed properly- fix bashisms in write_net_rules script - update patches: * 1053-better-checks-in-write_net_rules.patch- Add upstream patches 0001-systemctl-let-list-units-unit-files-honour-type.patch 0002-systemctl-obey-state-in-list-unit-files.patch which allows to use --type in the systemctl command list-units and list-unit-files.- Add upstream patches 0001-keymap-Add-support-for-IBM-ThinkPad-X41-Tablet.patch 0002-keymap-Fix-special-keys-on-ThinkPad-X60-X61-Tablet.patch- New root symlink rule generator Add 1096-new-udev-root-symlink-generator.patch - Remove write_dev_root_rule and systemd-udev-root-symlink- Change patch 0001-add-hdflush-for-reboot-or-hddown-for-poweroff.patch to skip hdflush as well as hddown but only use halt as fallback for poweroff as well as synch in systemctl before any reboot command (compare with commit 4a3ad39957399c4a30fc472a804e72907ecaa4f9)- Create rule to set I/O scheduler to deadline if device attribute 'rotational' equals 0, usually SSDs (bnc#904517). Add 1095-set-ssd-disk-to-use-deadline-scheduler.patch- fix systemd-fstab-generator crypttab parsing (bnc#903963)- Add pm-utils-hooks-compat.sh in order to run pm-utils sleep hooks from systemd (boo#904828)- Add upstream patches 0001-login-rerun-vconsole-setup-when-switching-from-vgaco.patch 0002-shutdown-fix-arguments-to-run-initramfs-shutdown.patch 0003-utf8-when-looking-at-the-next-unichar-honour-the-siz.patch- Add upstream patches 0001-core-don-t-allow-enabling-if-unit-is-masked.patch 0002-snapshot-return-error-when-snapshot-exists.patch 0003-shared-install-avoid-prematurely-rejecting-missing-u.patch 0004-Raise-level-of-Found-dependency.-lines.patch 0005-units-order-sd-journal-flush-after-sd-remount-fs.patch 0006-journald-fix-minor-memory-leak.patch 0007-journald-also-check-journal-file-size-to-deduce-if-i.patch 0008-journald-fix-memory-leak-on-error-path.patch 0009-units-make-systemd-journald.service-Type-notify.patch 0010-hwdb-Update-database-of-Bluetooth-company-identifier.patch- Add upstream patches 1092-libudev-do-not-accept-invalid-log-levels.patch 1093-udev-Fix-parsing-of-udev.event-timeout-kernel-parame.patch 1094-udev-avoid-magic-constants-in-kernel-cmdline-parsers.patch- Add patch watch_resolv.conf_for_become_changed.patch to add an inotify watch on /etc/resolv.conf which enables the reload of a changed resolver configuration on the fly (bsc#902901) - Do not apply patch 0022-systemd-tmpfiles-ownerkeep.patch in case if the script /usr/bin/systemd-tmpfiles-keep is missed- Add upstream patches 0001-sd-bus-properly-handle-removals-of-non-existing-matc.patch 0002-keymap-Ignore-brightness-keys-on-Dell-Inspiron-1520-.patch- Add upstream patches 1090-udev-path_id-set-supported_parent-for-well-known-SCS.patch 1091-udev-path_id-update-comments.patch which will be applied if patch 1090-udev-path_id-set-supported_parent-for-well-known-SCS.patch is applied a this may fix the trouble with iSCSI (bnc#898233)- Add upstream patches 0001-manager-Linux-on-hppa-has-fewer-rtsigs-hence-avoid-u.patch 0002-time-also-support-infinity-syntax-in-parse_nsec.patch 0003-time-earlier-exit-from-format_timestamp_relative-on-.patch 0004-sd-bus-if-we-don-t-manage-to-properly-allocate-the-e.patch 0005-journalctl-correct-help-text-for-until.patch 0006-calendarspec-fix-typo-in-annually.patch 0007-systemctl-do-not-ignore-errors-in-symlink-removal.patch 0008-util-introduce-sethostname_idempotent.patch 0009-util-fix-copy-paste-error-and-actually-set-the-new-h.patch 0010-shutdown-do-final-unmounting-only-if-not-running-ins.patch 0011-selinux-make-sure-we-do-not-try-to-print-missing-fie.patch - Replace patch keep-crypt-password-prompt.patch as this with upstream patch 0012-manager-do-not-print-anything-while-passwords-are-be.patch- Add upstream patch 0002-shutdown-pass-own-argv-to-run-initramfs-shutdown.patch - Add patch journald-advice-about-use-of-memory.patch to use mmap() flags as well as madvise(2) for journal files.- Add upstream patches 0001-strv-add-an-additional-overflow-check-when-enlarging.patch 0002-hwdb-Add-mapping-for-special-keys-on-compaq-ku-0133-.patch 0003-journald-add-CAP_MAC_OVERRIDE-in-journald-for-SMACK-.patch 0004-journal-do-server_vacuum-for-sigusr1.patch 0005-cryptsetup-fix-an-OOM-check.patch- Add upstream patch 1089-fix-cgroup-device-controller.patch to avoid trouble on existing /dev/console with nspawn (bsc#902240)- Modify patch avoid-leaking-socket-descriptors.patch to close file descriptors for incomming connections in pam module in case of short memory.- Add upstream patches 0001-systemd-continue-switch-root-even-if-umount-fails.patch 0002-systemd-try-harder-to-bind-to-notify-socket.patch - Add patch avoid-leaking-socket-descriptors.patch to close file descriptors if an incomming connection can not be handled due e.g. short memory. Could be related to bsc #901481- Add upstream patches 0001-shell-completion-fix-completion-of-inactive-units.patch 0002-shell-completion-propose-templates-for-disable-re-en.patch 0003-man-we-don-t-have-Wanted-dependency.patch 0004-selinux-fix-potential-double-free-crash-in-child-pro.patch- Adapt patch rules-add-lid-switch-of-ARM-based-Chromebook-as-a-power-sw.patch to make it work even with patch #438 and #439- Add upstream patches 0001-systemctl-when-mangle-unit-names-for-the-isolate-suf.patch 0001-tmpfiles-compare-return-against-correct-errno.patch- Add upstream patches 0001-keymap-Fix-touchpad-toggle-on-Toshiba-Satellite-P75-.patch 0001-units-introduce-network-pre.target-as-place-to-hook-.patch 0002-keymap-Fix-touchpad-toggle-key-on-Asus-laptops.patch 0003-sd-bus-check-return-value-of-vasprintf.patch 0004-core-map-the-rescue-argument-to-rescue.target.patch 0005-util-avoid-double-close-of-fd.patch- Add upstream patches 0001-virt-detect-that-we-are-running-inside-the-docker-co.patch 0002-bootchart-use-n-a-if-PRETTY_NAME-is-not-found.patch 0003-fileio-label-return-error-when-writing-fails.patch 0001-sd-event-don-t-require-a-signal-event-source-to-be-e.patch 0004-sd-event-check-the-value-of-received-signal.patch 0005-sd-id128-do-stricter-checking-of-random-boot-id.patch- Add upstream patches 0001-core-swap-only-make-configured-units-part-of-swap.ta.patch 0009-hwdb-Update-database-of-Bluetooth-company-identifier.patch- Add upstream patches 0001-journalctl-do-not-output-reboot-markers-when-running.patch 0002-udev-hwdb-New-Entry-for-Dell-XPS12-9Q33-keyboard.patch- Add upstream patches 0001-logind-add-support-for-Triton2-Power-Button.patch 0002-logind-add-support-for-TPS65217-Power-Button.patch - Add upstream patches 0001-shutdownd-clean-up-initialization-of-struct.patch 0003-bootchart-parse-userinput-with-safe_atoi.patch 0004-bootchart-check-return-of-strftime.patch 0005-bootchart-Do-not-try-to-access-data-for-non-existing.patch/bin/sh/bin/sh/bin/shpm-utilssuspendsystemd-analyzesystemd-bash-completionmourvedre 1625819937  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abefghijklmnopqrstuvwxyz{|}~246.13-7.5.1246246.13-7.5.1246.13-7.5.1246.13-7.5.1246.13-7.5.1246.13-7.5.1 1.4.11.0201    !"#$$%%%%%%%%%%%%%%%%%%&'''''''(((()*++++++++++++++++++++),-,......,//////0111111111111)2334)566666)777)89999999999999999999999:;;<;;systemctlxinitxinitrc.d50-systemd-user.shxorg.conf.d00-keyboard.confbinfmt.dlocale.confmachine-idmachine-infomodules-load.dsystemd-usersysctl.dsystemdjournald.conflogind.confnetworksleep.confsystemsystem.conftimesyncd.confuseruser.conftmpfiles.dvconsole.confsystemduserpam_systemd.sobootctlbusctlhostnamectljournalctlkernel-installlocalectlloginctlsystemctlsystemd-analyzesystemd-ask-passwordsystemd-catsystemd-cglssystemd-cgtopsystemd-deltasystemd-detect-virtsystemd-escapesystemd-firstbootsystemd-id128systemd-inhibitsystemd-machine-id-setupsystemd-mountsystemd-notifysystemd-pathsystemd-runsystemd-socket-activatesystemd-stdio-bridgesystemd-sysuserssystemd-tmpfilessystemd-tty-ask-password-agentsystemd-umounttimedatectlbinfmt.denvironment.d99-environment.confkernelinstall.d00-entry-directory.install50-depmod.install90-loaderentry.installmodprobe.dsystemd.confmodules-load.dsysctl.d99-sysctl.confsystemdcatalogsystemd.be.catalogsystemd.be@latin.catalogsystemd.bg.catalogsystemd.catalogsystemd.de.catalogsystemd.fr.catalogsystemd.it.catalogsystemd.pl.catalogsystemd.pt_BR.catalogsystemd.ru.catalogsystemd.zh_CN.catalogsystemd.zh_TW.cataloglibsystemd-shared-246.sonetworkntp-units.d80-systemd-timesync.listscriptsmigrate-sysconfig-i18n.shupgrade-from-pre-210.shsystemsystem-environment-generatorssystem-generatorslogind-compat-tasks-max-generatorsystemd-bless-boot-generatorsystemd-debug-generatorsystemd-fstab-generatorsystemd-getty-generatorsystemd-gpt-auto-generatorsystemd-hibernate-resume-generatorsystemd-run-generatorsystemd-system-update-generatorsystem-preset99-default.presetsystem-shutdownsystem-sleepafter-local.serviceautovt@.servicebasic.targetbasic.target.wantsblockdev@.targetbluetooth.targetboot-complete.targetconsole-getty.servicecontainer-getty@.servicectrl-alt-del.targetdbus-org.freedesktop.hostname1.servicedbus-org.freedesktop.locale1.servicedbus-org.freedesktop.login1.servicedbus-org.freedesktop.timedate1.servicedbus.target.wantsdebug-shell.servicedefault.targetdefault.target.wantsdetect-part-label-duplicates.servicedev-hugepages.mountdev-mqueue.mountemergency.serviceemergency.targetexit.targetfinal.targetgetty-pre.targetgetty.targetgetty@.servicegraphical.targethalt.targethalt.target.wantshibernate.targethybrid-sleep.targetinitrd-cleanup.serviceinitrd-fs.targetinitrd-parse-etc.serviceinitrd-root-device.targetinitrd-root-fs.targetinitrd-switch-root.serviceinitrd-switch-root.targetinitrd.targetkexec.targetkexec.target.wantskmod-static-nodes.servicelocal-fs-pre.targetlocal-fs.targetlocal-fs.target.wantsmodprobe@.servicemulti-user.targetmulti-user.target.wantsafter-local.servicegetty.targetsystemd-logind.servicesystemd-user-sessions.servicenetwork-online.targetnetwork-pre.targetnetwork.targetnss-lookup.targetnss-user-lookup.targetpaths.targetpoweroff.targetpoweroff.target.wantsprinter.targetproc-sys-fs-binfmt_misc.automountproc-sys-fs-binfmt_misc.mountquotaon.servicereboot.targetreboot.target.wantsremote-fs-pre.targetremote-fs.targetrescue.servicerescue.targetrpcbind.targetserial-getty@.serviceshutdown.targetshutdown.target.wantssigpwr.targetsleep.targetslices.targetsmartcard.targetsockets.targetsockets.target.wantssystemd-journald-dev-log.socketsystemd-journald.socketsound.targetsuspend-then-hibernate.targetsuspend.targetswap.targetsys-fs-fuse-connections.mountsys-kernel-config.mountsys-kernel-debug.mountsys-kernel-tracing.mountsysinit.targetsysinit.target.wantsdetect-part-label-duplicates.servicedev-hugepages.mountdev-mqueue.mountkmod-static-nodes.serviceproc-sys-fs-binfmt_misc.automountsys-fs-fuse-connections.mountsys-kernel-config.mountsys-kernel-debug.mountsys-kernel-tracing.mountsystemd-ask-password-console.pathsystemd-binfmt.servicesystemd-boot-system-token.servicesystemd-firstboot.servicesystemd-hwdb-update.servicesystemd-journal-catalog-update.servicesystemd-journal-flush.servicesystemd-journald.servicesystemd-machine-id-commit.servicesystemd-modules-load.servicesystemd-random-seed.servicesystemd-sysctl.servicesystemd-sysusers.servicesystemd-tmpfiles-setup-dev.servicesystemd-tmpfiles-setup.servicesystemd-update-done.servicesystemd-update-utmp.servicesyslog.socketsystem-update-cleanup.servicesystem-update-pre.targetsystem-update.targetsystemd-ask-password-console.pathsystemd-ask-password-console.servicesystemd-ask-password-wall.pathsystemd-ask-password-wall.servicesystemd-backlight@.servicesystemd-binfmt.servicesystemd-bless-boot.servicesystemd-boot-check-no-failures.servicesystemd-boot-system-token.servicesystemd-exit.servicesystemd-firstboot.servicesystemd-fsck-root.servicesystemd-fsck@.servicesystemd-halt.servicesystemd-hibernate-resume@.servicesystemd-hibernate.servicesystemd-hostnamed.servicesystemd-hwdb-update.servicesystemd-hybrid-sleep.servicesystemd-journal-catalog-update.servicesystemd-journal-flush.servicesystemd-journald-dev-log.socketsystemd-journald-varlink@.socketsystemd-journald.servicesystemd-journald.socketsystemd-journald@.servicesystemd-journald@.socketsystemd-kexec.servicesystemd-localed.servicesystemd-logind.servicesystemd-machine-id-commit.servicesystemd-modules-load.servicesystemd-poweroff.servicesystemd-quotacheck.servicesystemd-random-seed.servicesystemd-reboot.servicesystemd-remount-fs.servicesystemd-rfkill.servicesystemd-rfkill.socketsystemd-suspend-then-hibernate.servicesystemd-suspend.servicesystemd-sysctl.servicesystemd-sysusers.servicesystemd-time-wait-sync.servicesystemd-timedated.servicesystemd-timesyncd.servicesystemd-tmpfiles-clean.servicesystemd-tmpfiles-clean.timersystemd-tmpfiles-setup-dev.servicesystemd-tmpfiles-setup.servicesystemd-update-done.servicesystemd-update-utmp.servicesystemd-user-sessions.servicesystemd-vconsole-setup.servicesystemd-volatile-root.servicetime-set.targettime-sync.targettimers.targettimers.target.wantssystemd-tmpfiles-clean.timerumount.targetusb-gadget.targetuser-.slice.d10-defaults.confuser-runtime-dir@.serviceuser.sliceuser@.servicesystemdsystemd-ac-powersystemd-backlightsystemd-binfmtsystemd-bless-bootsystemd-boot-check-no-failuressystemd-cgroups-agentsystemd-dissectsystemd-fscksystemd-growfssystemd-hibernate-resumesystemd-hostnamedsystemd-journaldsystemd-localedsystemd-logindsystemd-makefssystemd-modules-loadsystemd-quotachecksystemd-random-seedsystemd-remount-fssystemd-reply-passwordsystemd-rfkillsystemd-shutdownsystemd-sleepsystemd-socket-proxydsystemd-sulogin-shellsystemd-sysctlsystemd-time-wait-syncsystemd-timedatedsystemd-timesyncdsystemd-update-donesystemd-update-utmpsystemd-user-runtime-dirsystemd-user-sessionssystemd-vconsole-setupsystemd-volatile-rootsystemd-xdg-autostart-conditionuseruser-environment-generators30-systemd-environment-d-generatoruser-generatorssystemd-xdg-autostart-generatoruser-preset90-systemd.preset99-default.presetbasic.targetbluetooth.targetdefault.targetexit.targetgraphical-session-pre.targetgraphical-session.targetpaths.targetprinter.targetshutdown.targetsmartcard.targetsockets.targetsound.targetsystemd-exit.servicesystemd-tmpfiles-clean.servicesystemd-tmpfiles-clean.timersystemd-tmpfiles-setup.servicetimers.targetxdg-desktop-autostart.targetsysusers.dsystemd.conftmpfiles.djournal-nocow.confstatic-nodes-permissions.confsuse.confsystemd-nologin.confsystemd-tmp.confsystemd.confx11.conf70-uaccess.rules71-seat.rules73-seat-late.rules99-systemd.rulesbash-completioncompletionsbootctlbusctlhostnamectljournalctlkernel-installlocalectlloginctlsystemctlsystemd-analyzesystemd-catsystemd-cglssystemd-cgtopsystemd-deltasystemd-detect-virtsystemd-id128systemd-nspawnsystemd-pathsystemd-runtimedatectludevadmdbus-1servicesorg.freedesktop.systemd1.servicesystem-servicesorg.freedesktop.hostname1.serviceorg.freedesktop.locale1.serviceorg.freedesktop.login1.serviceorg.freedesktop.systemd1.serviceorg.freedesktop.timedate1.serviceorg.freedesktop.timesync1.servicesystem.dorg.freedesktop.hostname1.conforg.freedesktop.locale1.conforg.freedesktop.login1.conforg.freedesktop.systemd1.conforg.freedesktop.timedate1.conforg.freedesktop.timesync1.confsystemdCODING_STYLE.mdDISTRO_PORTING.mdENVIRONMENT.mdGVARIANT-SERIALIZATIONHACKING.mdLICENSE.GPL2LICENSE.LGPL2.1NEWSREADMETRANSIENT-SETTINGS.mdTRANSLATORS.mdUIDS-GIDS.mdfactorysystemd-miniLICENSE.GPL2LICENSE.LGPL2.1systemd.pcpolkit-1actionsorg.freedesktop.hostname1.policyorg.freedesktop.locale1.policyorg.freedesktop.login1.policyorg.freedesktop.systemd1.policyorg.freedesktop.timedate1.policysystemdkbd-model-maplanguage-fallback-maptmp.mountzshsite-functions_bootctl_busctl_hostnamectl_journalctl_kernel-install_localectl_loginctl_sd_hosts_or_user_at_host_sd_machines_sd_outputmodes_sd_unit_files_systemctl_systemd_systemd-analyze_systemd-delta_systemd-inhibit_systemd-nspawn_systemd-path_systemd-run_systemd-tmpfiles_timedatectl_udevadmsystemdbacklightcatalogdatabasei18n-migratedrandom-seed/bin//etc/X11//etc/X11/xinit//etc/X11/xinit/xinitrc.d//etc/X11/xorg.conf.d//etc//etc//etc//etc//etc//etc/pam.d//etc/systemd//etc/xdg//etc/xdg/systemd//lib64/security//usr/bin//usr/lib//usr/lib/environment.d//usr/lib/kernel//usr/lib/kernel/install.d//usr/lib/modprobe.d//usr/lib/sysctl.d//usr/lib/systemd//usr/lib/systemd/catalog//usr/lib/systemd/ntp-units.d//usr/lib/systemd/scripts//usr/lib/systemd/system-generators//usr/lib/systemd/system-preset//usr/lib/systemd/system//usr/lib/systemd/system/multi-user.target.wants//usr/lib/systemd/system/sockets.target.wants//usr/lib/systemd/system/sysinit.target.wants//usr/lib/systemd/system/timers.target.wants//usr/lib/systemd/system/user-.slice.d//usr/lib/systemd/user-environment-generators//usr/lib/systemd/user-generators//usr/lib/systemd/user-preset//usr/lib/systemd/user//usr/lib/sysusers.d//usr/lib/tmpfiles.d//usr/lib/udev/rules.d//usr/share//usr/share/bash-completion//usr/share/bash-completion/completions//usr/share/dbus-1//usr/share/dbus-1/services//usr/share/dbus-1/system-services//usr/share/dbus-1/system.d//usr/share/doc/packages//usr/share/doc/packages/systemd//usr/share/licenses//usr/share/licenses/systemd-mini//usr/share/pkgconfig//usr/share/polkit-1//usr/share/polkit-1/actions//usr/share/systemd//usr/share/zsh//usr/share/zsh/site-functions//var/lib//var/lib/systemd//var/lib/systemd/catalog/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:19976/SUSE_SLE-15-SP3_Update/2d926bfe0d2aaf201cc77dde2193b994-systemd-mini.SUSE_SLE-15-SP3_Updatedrpmxz5ppc64le-suse-linux  !"#$ %%%%%%%%%%%%& '()*+,-./%0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUV%%%%%%%%WWWWWW%%%%%%XWWWWWYdirectoryPOSIX shell script, ASCII text executableemptycannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-246.13-7.5.1.ppc64le/etc/machine-id' (No such file or directory)ASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=37a20b6a3bdea281a51f137e933481c80a0b5349, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=5e1f45bef9619d3e7a13ac7e0e42abd688c7b0c4, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=24b5cc6a121f55cb5149bcfee84c7f3657575e70, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=b136d564e6bc9e9a6819fd53ff9bfdcba94fabbe, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=45cf642e4a64df3b9e66647e4eedd6cb5cf5e886, for GNU/Linux 3.10.0, strippedBourne-Again shell script, ASCII text executableELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=99eda1d12de905499b7171a13558233afc74a475, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=89d0a9e05ba357b8799979e3ced1ed9871284838, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=6316259697fe094a13d3b38b9dcfa07d8e44600f, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=01b35fab225213091be786131295dcb081de5367, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a79479936773fefa5258f117221aaa792d31119c, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=b1330f13d9f66b6c22751231b8fae5a56ea72bb8, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=4fb08bfa71263e1d92a3caf4b3a0f4e6cedaa602, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d8f8a3a42c01bf0bbdf6ae214e957be343552338, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=e823965e8846208e22f3cc006687dcdbebde5579, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=78ba2f6a25974335e478304c3ecaeab486631328, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d3a13c74e5275c538494c47393e9b4724e9b47e5, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a670ff651495f67bbd6dd9b6ad0489b4cfa42cb6, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=bf0b89c3356b910bedfc345f02d02fbb3915699f, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=57ccd34a16d064498153360072e9f639c11f970c, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=11e294f8f72a5a461ebd430e9ebe7d91b9a5fde7, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=7697bcc63f01eccfbb3b27448d62ae444878bc87, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=17443d447dc0cba9b0a2d5d8fe2bcad1d06bf230, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=68681f799d753400390bfbb7b2ad5313ae125bfd, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=972d0eead4d8c442b70859346f2d78c88963fe55, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=bc2f348983b4e96ca73b57cf13a3866c77c60fa3, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=cdc947facdc6f4ca367285868c766b339b99567a, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=63eed5537268448793634706761c99a2577d76c1, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=fdd4884edf84bae5cfa195c830154900882a8f12, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=050631344a82fd5c655c28dc2dfb8c09e136326f, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=e8221183aaeb417f701e1e83362dfbb1b470fb01, for GNU/Linux 3.10.0, strippedUTF-8 Unicode textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=de7cfe6da65cc3b897599207a98a03993da2b6b0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d89966fcbd62feb9b88d01408ff897e98a1bd548, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=5f184dc1df1e0d231346f5678b3c7942629bb15f, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=1757394361e54244ae9be674a8b1e6af32c3ccbe, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a73420b174d2e034d68896548673da9b1003da03, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a9be097a9e2226fea104afa905596443e5346eae, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=fd2b82746739a2040457c3f72dbce09dc7a9879e, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=33621f5cfe5761e2cab31fbfcc064c10fd3da321, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=73c2d05a243f9ccdfd6fde49f2bf34f5343d33bd, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=f4cca98aa692665ba093e8c9470bba095b8f6c0e, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=80d166fa325b1eae71b3521640180d27840a016f, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=cd08463e1c4fd2a1325df04f73812d869c2385c6, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=c0f8d189b4407970a1dfaf518b0a7c247bc75352, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=af862b90f96b26274d899d348449b3b8f2dcd472, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=656366d661fb89ee0a2948a8191f3294a554c43e, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=f00eab059658a1536b4fedfb0098bab46c45e9b1, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=dd220805f33464f358d097d06f6af62bd4767e2b, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=7b7efd8066380d510a4022a4111debce979c9147, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=50087c97e9a3553227f4a6bc331942bffd0a3876, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=587b95947125292a7b7e09870f057c8571d7d257, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=bd74e1f1d724cb8dd4c376de9931e3328339c22e, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=7b80b51418aeb242a6b30d9fcd9d15569b4ee548, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=af50bc0a48aff4a08039f5631ff10f527d09656f, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=5123b7564365eda2fc3c9367954aed32dec66f97, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=5d2fa53e771f14dc45b0aac182d7d7773dad55e8, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=3317ea30037f373cfd04ca96fe8e95d0cbad7e03, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=e99fd60c98ab700d8bc8ede8a4211039b5973d0c, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=2f54955cef4ae69efdc8ca1dd78aece37d2686e2, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=c4f8b2c07d1186e4182f1947e02be8f69057cd03, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=5b25a3fcc0a7d3b8089f9e17017e0a98e316b44c, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=75654d8c7a5c83b4f1056ecc84dc8b7aecd86957, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=94745b532de31479bdebf3b9c45289821ecbdc77, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=0c8b1d4aafc511fc71dca9346da37b8c88ca1a8d, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d76afb8ed16eb595bc9913c0f8601fdce9494d7a, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=c04324d1038759aa26f638510858b0a852e9790b, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=e2912b6d54091f052e8c76364f9a2385d41d5474, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=7b0f645148d8ebabfcabca8911f90e0264707eeb, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=dc115988edba7494958fdbbc0f51c41de265faa0, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a325ac240464e5c6f9bcc2f1168365e366f8514a, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=c5c5d6c74bb30f57bc6cdc2221479b7118c937d4, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=8220f03b758a1b0f82cde1578723c12fff35a1ba, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=df3fb8e14d42a020036983e85e6d31f20e957845, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=efff4fd72f7fedacae71425eacf4cdaaa44bd1c8, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=ed816d5587660fc69859ced251b6d0c99da51468, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d356825f65260901a7812e799cd48c4b020d379f, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a161dc0a1eb43007058beed4894f87b85b235d34, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=07ea9e3c4a3b51c44399699b8a5dc77a2b740353, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=781b850e6b6836356f987ed4211aaf09f47fe601, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=dd58e9ea87eab2791e5afd981f414cd2a2c0caa4, for GNU/Linux 3.10.0, strippedXML 1.0 document, ASCII textpkgconfig filecannot open `/home/abuild/rpmbuild/BUILDROOT/systemd-mini-246.13-7.5.1.ppc64le/var/lib/systemd/random-seed' (No such file or directory)!%,-17=NRY]aeimtx}#'+/37;?CJNX\bfkotx& RR-R R!RR+R*R/RRRRRR)R,R0RR2R RRR.RRRRR4R3RRR4R3RR4RR3RR/RRR4R3R.RRR4RR3RR/RR4R3R.RR/RR4R3R.RR1R$R%R(R/R*R4RRRR3R0R2R#R)R.RR4RR3RR/R4RRR3R.RR4RR3RRR4R3RRR4R3RR4RR3RR4RR3RRRRR4R3RRRR4R3RR4RRR3RRR4R3RR$RR4R3R#RR4RR3RR4RR3RRRR4R3RR/RR4R3R.RRR4R3RRR4R3RR RR4R3R RR4RRR3RR"RR4R3R RRRRPPR R!RRR1R+R*RR RR/R$RRR RRRRRRRR R RRRR#R)R0R2R RR.RRRRRR4R3R RRR4RR3RRR4R3RRR4R3RR4RR3RRR4R3RRR4R3RRR4R3RR4RR3RR1R$R%R(R/R*RR4RRRR3R0R2R#R)RR.RR4RR3RR4RR3RRR4R3RRR4R3RRR4R3RR4RR3RRR4R3RR4RR3RRR4R3RR4RR3RRR4R3RR/RR4R3R2R.RRR4R3RR R/R RR4R3R R.RRR4RR3RRR4RR3RRR4RR3RRRR4R3RR4RR3RR4RRR3RRR4R3RR&R'R$R4RR3R#RRR4R3RR/R4RRR3R.RR4RR3RRR4R3RRR4R3RR4RR3RR/R"R4RR3R R.RR4RR3RRR4R3RRR4R3RR4RR3RR4RR3RRR4R3RRR4R3RRR4R3RRR4R3RPR sX"/cutf-85e903fe1f2fca87eafaccf9f85c082939b859f177c9596ab5cbe18a3719db2d7?`7zXZ !t/E$ ]"k%jzNl͗(U;Aŋx.ZU˧}eߧ=W|_v,,t.Ő^iПJQ@Ū /u5GPFͯZg׎CV"(,@!u\d"p[Oxfy{F\tFӊVEa/X{ ziSPtHS8E/ a5d ALȽBĦ#CF|)DR TZͪhef\%F5D씻o/T] o`1ˌ滑s6 {omJ"ͬIda&glMCaaw-h}9V=4B:wtxKO ,-u3hwm|T:v+8SǸǼw?rl2KVh'gCQ3= 6j{_MopM^ t:Y (\&"pT3ۘ_,@JMNb; nCaSl}a"C4]E9ҦeqV͜'1xo~3ILncfwU=e㱉EShFIE[*SɘK?3ny,Za#*5Q7՗)5_+ngd#4q {8A\0*68tzfzZ2d+"Wֵ&y\>%?]`_?81q>Cޙ!e׭X$jӸO8%xMBu65b+ ʱn6Оɩ'*'?"6_.TVyNqɥ:\3,^"&lP69'#Iz=B&CFeimU3*Xȿ9US5Z8/{~rw;k(YAj?/v>YoNogD6`nfGC5(;{C]yyCL50:,1&1P1 c3/I H[2ｻ>6=`^05(3Ax>5R|!i suX54F٫So+7J!$m7+ksˆ8x\0>LZDeauwdž(&XBvOL)tEB,;MNrax _- \U]H 1d(Ζ $ 9AWq`ى j;PIn/Obu£yNbP?k)nFww 1Ѥ<-Ǹ=Mv+o~ nůĒ& az&JqgF? K?PE;: gv:ZʼnWhLrUbPݤ@da [TVueiwA<" RfVCZ(0<`e-d j@:/<{}/7_o욈Rx)O{aP2aӆ$NI? dp!4ֹ&%j϶~kk%(l?鸗,8ޥW!AIIJ ƧoR\$eZrvV`t0iqn dtQsiu0n\ bo'pN)6Dٲ橅P6n +TCͪA l5,G> 8lS8EYb<;RxqA7~r\馁RloxS_i \Ͽ;ccLcJs! LtǷ6˯:j=M)gũ塞iBha` | n#vt2 s0֋ܘ"UXE\,|'}Y\2I}BC-6Z}Hn'D$FxRByاm ;l_wU*O~idD2G/LJ-nvxJwYH:b}Hp] F_ɱ'{ W1-,/p^ABWY)#@B'="Q넉HZU=я;zZq(qr5 0+f1O܏VOk,HM@AJ,gyPed] 8!A/7۪ 3s#MVvE)Qo-=n[ 7U7]ͫ a֡'d_[KI9v g[!qW0>kndxE psUE+–]֠ Xٔc%OcC|*nLfoV+R 'bTC%,j67'ݠVq;t@x̌O$Csݿ'פ'k8{MSkLOrA!BTj}{,N$7ֿhx=hц%=`g4IKi+kv VJhqYM(kwFls'gL,u%|ύ\ژ&aÊgO˖68zi vál_QcF%']|l>J9 %\=/1.2hf<4\L DFc=u: %0VM:y+#9!t/kT,ыږFF"~$I]T2>$4u- ]BŵUp\}'(cM0xXTJk{j7Eo)%CqE>ˆ_MrFT3=NEc.TnoMWZ2EK,8Uimp$QFn ӥ }21YT$XX2] Z˜JzU?0 }caݿ!]Ĝ]M&SU[=*Dk,/R,tlB{eV.:+DkUcz {##eQ<)D1iQ6cY8ћdsc󣿋⚒Ϟ̱RQ..&ε3? _H3OWeז}9}myg@m L2qEi[M@tԙ\X9U0Iݠ.Zrgm|jʴ)WWʺK= ΕI4*dJǽ(9a)NB+ JGKؕ[d?Eâߧ_52$az4 PR|BØ1u{/_@H FQ!S~iOwig2h @F%SlTil 3JD f"91 OWWx8O2P#kpW 1u. t1yӹHM칏IS%ޞ[lmzBwqO]lKIB,p}°ܲ:x+˄zD 覺4ƌ` ]TMlt塉UxEA9!*5J/9i`Sj#H]nD |s#xMjhv _kljS~imM1 $C++FS%#uBrV. P0/q7yʅS7Tn6frm&,*шi2|F.! fq㖩埗c8T{FjW:Gb ŧ=pyWHOו>]W:uzߒotNn)l7 9T޲?'[|ҵZ3M#\%_Bs2h8F5_6xL^mxA.JlӿZ#\Ɉ_$@eJ;ՅSAŕhca)ܲ2QՃ"GT Wl:rmV6j]34 evr vҮRIm%&(m/P qεk8AqYӿK&{,( foٳ ! YMr5_[%6VC #YSq3O=;)%,HyhNxh|F >˳R.D hjL'97ưCOJ?ukAKZǸYʕ#9׷λ@uB_.!֥F 7 ui0x5b?Q@XDr6* ̙8<Jfd/-WBŶ]lFpMNs[&^ccބQ84HWK=E&::8;q^c LvE塋(]qEы&|oy7JjcasVS;hm@Fy4KN`4q> ?Z!:FIS0P ̓c|P%h˷q2WUC{W`s3.#CTʜrxR^LC5 N V]pBӎFB%x2F%@ 9: NqǺc{sDX֞so"BҰNӑ +J L`qļhyu%H{:j[_ش[d;>RFX##kl=9!(PxᢏBYP0p OuE~~@nyϻ|<);^kMHK&)}Xvw8䋲'EAK&C.UUcA6_ky[zՌ @]}:[@+J\Vb)QFVQw׭B"kuˇ ~`@t;&k&4jh35۝ ̪ #";瀌n醴䲧Ȏo+RߒF @ ȸ;q-vH"T]n -gD= 7CY`[p4_D3>Q+i EXZS!_%Ғ0psVgުo +)^zS8;a$Ŭ;k+0e$YHwy;#m@ښ6ǐץ;=d3,Lz0lΗbπ< o ӻ nHid43a<0м5Mk-n7jscA9:d/xoAuMbYH>+ld4y~Ǟ]DŽt4 $>.RnC&)FaKc;d2$D?,a mhl< !{LdSFf=#w]-rz|Vy~]&1I{cGˇsdr۲!{B#2/sB;1તd#jvMe7T_ [T`q/bzjDy=Mj7tgf'tE.U,@0ma>T?-^e|m_.ȹwH$ x!=1 Q ~y(gdOwW qU(]8,鼺v;'cK>Tkyh1@ RTЫ}!]nTR.$xao7uݺ 0\sphL4rz0\xUMG&:Bmaѣv@Jl-.'%m?zs]5=Pa'Ee[k&F `XG ٘Krt0`g2Waۓ/