gpg2-2.2.5-lp152.9.3.1<>,⸉`://=„DKFu!.Yy;ϞY5c\ͪ֡Bz !GL´72(̰hBI%![%מ?,['ŵ (n#84${xَۖ, M"8-aiM0eh܂^;d{SjS`+ڧNg/}G\^JArSV˪eE,Jn8w#}B8جT8}W2({B-)>"F^W@r$x>HH?8d   bHLTXkt} xy\y Ny @y  $y #y $y%y(Yy**y,-6-616(2B82LA93PA:8A>Π?ΨBΰFμGyHдyIҘyXY4ZӀ[ӈ\Ӕy]xy^Kbܫcidefluyvw$yxyyvz4Cgpg22.2.5lp152.9.3.1File encryption, decryption, signature creation and verification utilityGnuPG is a hybrid-encryption software program; it uses a combination of symmetric-key and public-key cryptography to encrypt/decrypt messages and/or to sign and verify them. gpg2 provides GPGSM, gpg-agent, and a keybox library.`:/build78|XopenSUSE Leap 15.2openSUSEGPL-3.0+http://bugs.opensuse.orgProductivity/Networking/Securityhttp://www.gnupg.org/aegypten2/linuxi586 ALL_ARGS=(--info-dir=/usr/share/info /usr/share/info/gnupg.info.gz) if test -x /sbin/install-info ; then /sbin/install-info "${ALL_ARGS[@]}" || : fi ; test -n "$FIRST_ARG" || FIRST_ARG=$1 if test -x /sbin/install-info ; then if [ "$FIRST_ARG" = 0 ]; then /sbin/install-info --quiet --delete --info-dir=/usr/share/info /usr/share/info/gnupg.info.gz || : fi ; fi ; 0Y}j w[4fPƄX?06LX;T 0B h)4F;6*4  & #5  @u o 55 oEG 2l Fg )_6w ?%.G vA큤A큤A큤A큤A큤A큤`:'`:'`:*`:*`:*`:*`:'`:*`:*`:*`:'`:*`:*`:*`:*`:*`:*`:'`:*`:*`:*`:*`:*`:*`:*`:*`:&`:&`:*`:+ZZ~`:'`:'Y`:'`:'ZӸ`:'`:'YY`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:'`:+`:&`:'`:+`:+`:+`:'`:+`:+`:'`:+`:'`:'`:+`:'`:'`:'`:'`:+`:'`:'`:'`:'`:'`:'`:+`:'`:'`:'`:'`:&`:'`:'`:'`:+YYYYYY`:'`:'`:'`:'`:'`:'`:+`:'`:'`:'`:'`:'`:+`:'`:'`:'`:'`:'`:'`:'`:'7ef8e2439b8b51bc5612c44a5f0572f7684b1185abe3b306343d83b708ff48e18c866f0f9274a46bc89eb647745a0591a14f283e353e72c0d589e1b8a5c8bef5f8e54dc2e14a74781fd3572063a4c26dc4a1201bb5513a467a8a3f90a38e937026509f099207929d0a2f8dbfd2b80cbbe53bae7835589b6b9a63ce74ee7ddbf8438f29abbd042696edc6a36a7e990b76091a07ae46e85730f8e65510bd37286a186fb5a03f1a10aee81a75380827a00c4cd20ac9f6c1193aa5eae56f3ce49ebfe602c8a14e932d310a6fd881b7663cac2fe098775f43a8396d4ac29f78b3ee6c22db851fa918299a45b9954f6c028752af9ecd4f37a7d14106f0938be7a7172c6a0ff3e92d297766311281400c84e37f332be6f5707dae57ef5e0229bf9310b86492c34ea4c446a785e2a25ed78d55445d3e29f20281d710f8ba0d0a5e2d2090bcd478f4279e39dce871e475df7a42274643c995da9bbd9228be0296c87665db61c01c83e9c657afc26f088fa852f5dc403db5726e4bde3d5ddc90e39d7cea2a8ddb1528e3cc2771207909da31b778114c5aa0b7450d8d7485f8d52ee2e2fabe00f3361e81eaa6f9719a435cf30c21141d1ec3b449fd0c468e58d04a0bd2a0fadb696f38695262da5fcc247ee1599fa4913c91c21951a9d5ca09ef6077e9d78a8f7ba8003e2e321b521d4dd8f55e50b4f0f9eb6514c675d02fe2d8137805730ef8d5b9bee0779c5f0da827d73c26a3dda82369500345b32cdea29b170865d9fcc4ab70df5e4419a9da2003156ce11de11bcf03d51d430c1f95fbb449ea19578776516103c502ae8b37de42f2b288587d877539b74a381f49685cf1eb4f5a70b415b53900711d905ee406e8fc4574d5dd5a4cad2bc84975fea9613b7c62571bfdaa357ea1f27403d4968afd42d3677ddeaccf338b706dcfef4a08cd56ac29296f2c0638d9dbea7a11e7b2d2790cdfb7d8240c15170878c00a9285a31e8465fb476e1ac357785d0ad5af833e7575457c181c264cacd60302245da63ae0a2072910950f180008a1e62a16f8ceda0f6e3e9d7ed4489bffb1bf436dfdd497e3a91c0cfd3dd5e998504628720e5047af75f2af198f016bc75ee5f8f6eabd735972cfe20356d2872bd7125079bb77c8d9c466de8159eb788dd574d635f346fe2a05962a7fb9f9f3eabdf27d082b97e58f25138c1e0ee78fb5ef6ed485442482223c7199ed93925fc2d6daf95987c3b537c10987d9a9ad03ad214b594e102c62997bc7cc51dfd51b4c955304ed6e2e7dc0c1973ef07ba2d38d6a3bd1308dbaefce249e364bd0b1d78fffa2a1e2df2b092d791d8b344b6baf81185149937773f03d846f7a3b5367b76118c5ca94a566f3dcbddf0672dc729251e7829f8e2f683f562f3e6b4c3a7d8d243e8f1026036228b13888c3075d12f23a4cc9d8eba48a1def49f8c32a196c18e82ef9c6e5b36c9f2290dbdaf5499e7d01aca6ef111d7f5c333e5d33b719bbb11dea1a8a8c1cd6249452cb14d79a23d654abc37305d3c537e96b48f8e83d5a52e0dd8d1c9690751c88056f28fffbbc004f2fea7b28bf4cea8471cf045819986e5f52cd93b0bc836e0b24c422c34f9cc3a4320a586dd84304509e40ceea4762bca1c48e8cf3ff515d27b81a61e9083dc78a96ae0d27febe071ed40e9454385c2f6a5e8eefc5b89c42c85481f6faa27c975124ed315fcc522d614a945fdaa215a26149058730f3b4872176b993aaac3d4a3f3b71505de12cb048d1ca062b271f0903675bd8a86b9387c1318b3d5e613fba42bd462039f81bab9417d9d871abb857cdf892ae49b77f7332acf232962d148cc729e9f264c4a3c2792669f089e6ecc40a426a016be845f8c450bab6edb45a070dd8451d10a5a8638a52b74120d82de3dbb976a1f2f3a42bfab5136874a32508f55a4a2ebf2f462197f564e1ea441cf584f22765926aa3619387bd730fd2a5d7937ec3413372950c6bd43d8580a3a80f9f1f337da555a6838483e1baca44cde8a8a3d8c4ba7743626304b981ecf24112b56a505e2bf90bcefe07d5582a3804213218ff49a38fe0a3345c7e3b894cfb7aaa5e75092ad738cd6b3cb1b2ac05c6082ae89071ef38d25558ba289ecea4b6b204d6b6701407c67ae1a1a8452e11593ea7f1e9805272f6c31c72521397fc8122e45a2cac3f1a7708ac30cf4256cd0f19258fa56a292c206e817881268ea489a57edb0db9394bf2d6c0ec62205f881bb54efb919e4870209c7db01aa75ed1ff1e351db978cfa581c6e11278e685099a8195cbe68a7754a4165a169985267092aca5a090b4f4b824f856b07be5f8fa96fc4d5c1d9e0e4f6f93bc780ab8fd45e5bca8515c6f6c98b2e4bcca9e7623ca14d608c18970512bc7c863878e738948f10369646847016a5f49035cc14c106572e218800de588338564e9a669e305cdf5a33891882a1b96e007c0ac8dc9f99592f3667f79d83904a38e38e8bbe2bf3782730db603ef4bddba546330d7d69b211c22213adc6d3791e2a8802f35fedb9a70fce6bed52532b856323f4d4a6a47b7def90f83d145e5757c2ebf2c36ad8d89ec6367705a10152ba4f82a0e623851beeb031d097dd47e731f692bc03574abad0bbc97849bf71917ca59f579db0a7caea436f523ab592294b4ce80826c4b3eeea50fdd123a14d07b0df485cf390facfc1954b0ea82c8ae0d2c175393dff9d8b7ecd6463697591c771a71aaccdc3daac5c90325990fd491b2967396287895d75e4557580c0f681a5507ac7b3c0e64365f8ce6d5b37dc6221964631ac69c8a563af5e649fbe9eddc91461543dce1a2376c019afb2a8f78fc7e7d3e6e3b04531c44b176a46cc16b4fbd200b42c6f9d93c054fec1ec9bb3750b3e44e0d464ef5cbc2f41b6550d1c933158caac917a3fb8b967c0a6cd10af534ad31c3b0a4f87c2f941a1b6e5b5172fddc4ac62a112cb3d7981dbcbcc5de3f706084210e35d2659a2898d1358e4faef974ceb3c515b214fb63e1e30c9fc75d18b4dec1e6fb13506fba5ee88300f8599c18bacb0b5bbf6518c16c03b536e8ee12b832fe7bc72686bb6d9916028dd5a14e6ef45d5724ceac4906b1ed5275b6d49e9460006435afbc9c51e8863bee4699fff0bce77ff5aad420daee802b30d92633705f509a933502a83cde33912331f7d68cd1074997e95ce3c57c27185424cdb84d98d460a9e2dc7bc19422e1c5031a034042ea6e6b8d5ec81857ff9ee4605e505a40105227f90e1b745d2293bdfa5154ce1278236ac258f442caee7d328317c7e475880c261edb0666ee848e03a48f3ea7bb008dbe9d63dfde280af82fb4412a04bf4e24cab36b8c4766c86066c286d491f898f2b4453678c5943586025189c169455cac4440fe5fed1c3451c69024b683ee336d436b30c1caced0af8e2f4899f984407ecb270980a385499b97ce88cac4049937a276e1f7f6e2a92773fe89930de4ece678b9d5bc2d6664f6276fa0a72d57633b3ae68dc7dcb677b71018bf08c8e93e509f1357ec4a7d97de212428cd53e09e0524616f0f584528e0698203fb4d71d6c55b48c58177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643d31a714a7ab67eb95ccae12b701e74fe307d771682f8792af7ed4e1ba33074a6b40f7806e14dd7aad5e0254c04c61bf1212de37296f1cd5782ffbc9e98cbee87cee0fc6755d8dce46f5a2a2f4e3f37a94a64fd294ea58965b1f20246c9f07a6b70eaa5a319f9da27bab961c424682ba0c17098d53c1202778171bfa48ad876206b71462dbf7b3905d7d17261d15cfaa7f2efde12e26710ee39ab28e9a1da8f8b762c5756bedc816e92677a8433ff9b96752aec6858fef1258feefcc8e8cd8c11a1a03d61de74748999242990c36684280ab8aa1c7cacc04a69f630d302325101ae92f9dfab90a11ccbbe340693a185457f55146428aaabf8aef767ffddbb312fc09172a085c07e68451221d6383e191bfd1ac8e03ae418c594b2f0b5216fe4eac2110ad3d38ec00ec1c5a776398f790296834c9f94c8682ecb9cbbd605aab682241abd9a99305be94efae7713b0204157ca9a6104eea7d5b8c41d7fb3767dd7692906ee9c04d53aca20ee498b368d786e2c898d3ce24e785f6a70ba661617986bffad136933b4edf7a27cd358a8a7953b17f6ad68f5536fafc5c2318c40ae925fc67961cc5af74226c3f7ce405597461d063a9d78b189f032d4e9118d4e58b7c377fbd5c3093c7a0a00f52f3f079eae3f6ffe178861f13e1e3411ec026affefe7e193afdd10bfe13d1f6d267de28e7b71deabdb0d6266778e831d0c0ac16fa2dd308b28c4d8e9b7265061408841611a803507af6f919134fa710568710c4d0a0db648436fcbb031069b317553bfa6e93b57f8b8ad33e984484a576551e74881669758e765114d1baf08cea22171782e35886f0bec9220130a0589c657af3d14f73177b5d0c9d8f55823d75107a911cb35604ade6882db5a892e2c320b92328317a96b9d5ec7b45835a0d7968eedb0c6e88d468e9bb7af5d090957b842a02a84f1ae15150f4eb4d65446a05de6600e93c4deb7ef644ac73bdf3969a293ba30d2dgpg2gpgv2help.be.txthelp.be.txthelp.be.txthelp.be.txthelp.be.txthelp.be.txthelp.be.txthelp.be.txthelp.be.txtgpg2.1.gzgpgv2.1.gzrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgpg2-2.2.5-lp152.9.3.1.src.rpmconfig(gpg2)dirmngrgnupggpggpg2gpg2(x86-32)gpg2_signd_supportnewpg @@@ @@@@@@@@@@@@@@@@@@ @@@@ @@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/shconfig(gpg2)infolibassuan.so.0libassuan.so.0(LIBASSUAN_1.0)libassuan0libbz2.so.1libc.so.6libc.so.6(GLIBC_2.0)libc.so.6(GLIBC_2.1)libc.so.6(GLIBC_2.1.3)libc.so.6(GLIBC_2.15)libc.so.6(GLIBC_2.17)libc.so.6(GLIBC_2.2)libc.so.6(GLIBC_2.3)libc.so.6(GLIBC_2.3.3)libc.so.6(GLIBC_2.3.4)libc.so.6(GLIBC_2.4)libc.so.6(GLIBC_2.7)libdl.so.2libdl.so.2(GLIBC_2.0)libdl.so.2(GLIBC_2.1)libgcrypt.so.20libgcrypt.so.20(GCRYPT_1.6)libgcrypt20libgnutls.so.30libgnutls.so.30(GNUTLS_3_4)libgpg-error.so.0libgpg-error.so.0(GPG_ERROR_1.0)libksbalibksba.so.8libksba.so.8(KSBA_0.9)liblber-2.4.so.2libldap_r-2.4.so.2libnpth.so.0libnpth.so.0(NPTH_1.0)libpthread.so.0libpthread.so.0(GLIBC_2.0)libpthread.so.0(GLIBC_2.1)libpthread.so.0(GLIBC_2.2)libreadline.so.7libresolv.so.2libresolv.so.2(GLIBC_2.0)libresolv.so.2(GLIBC_2.2)libsqlite3.so.0libusb-1.0.so.0libz.so.1pinentryrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)2.2.5-lp152.9.3.12.4.31.7.01.3.43.0.4-14.6.0-14.0-15.2-14.14.1^m@]@]5@\@\,[oZZ@ZZ;@Z@Z@YYYY{'@Y@Y@XX@XX @XAXs{@X_XY@X0>W@W@WWW]@W.@WWbWPW)@VV_V%@Vd#@Va@VTQ@VO @VU@U5@U'U@UU~@Uyx@UXUQ@U) U@U @TgTD@TMT@T~@TuTa@T[bPedro Monreal Gonzalez Pedro Monreal Gonzalez Pedro Monreal Gonzalez Pedro Monreal Gonzalez Pedro Monreal Gonzalez kbabioch@suse.comkbabioch@suse.comastieger@suse.comfvogt@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.commarco.strigl@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comjengelh@inai.deastieger@suse.comtchvatal@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comtchvatal@suse.comastieger@suse.comastieger@suse.compjanouch@suse.deastieger@suse.comastieger@suse.comastieger@suse.comvcizek@suse.comp.drouand@gmail.comastieger@suse.comvcizek@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comschwab@linux-m68k.orgastieger@suse.comastieger@suse.commeissner@suse.comastieger@suse.comastieger@suse.comidonmez@suse.comastieger@suse.comastieger@suse.comastieger@suse.comandreas.stieger@gmx.dedev@stellardeath.organdreas.stieger@gmx.deandreas.stieger@gmx.devcizek@suse.comvcizek@suse.com- Fix warning: agent returned different signature type ssh-rsa * The gpg-agent's ssh-agent does not handle flags in signing requests properly [bsc#1161268, bsc#1172308] * Add gnupg-gpg-agent-ssh-agent.patch- Remove self-buildrequire [bsc#1152755]- Security fix: [bsc#1141093, CVE-2019-13050] * Denial of service attacks via big keys * Added patches: - gnupg-CVE-2019-13050_0_of_5.patch - gnupg-CVE-2019-13050_1_of_5.patch - gnupg-CVE-2019-13050_2_of_5.patch - gnupg-CVE-2019-13050_3_of_5.patch - gnupg-CVE-2019-13050_4_of_5.patch - gnupg-CVE-2019-13050_5_of_5.patch- Allow coredumps in X11 desktop sessions (bsc#1124847) * Added gnupg-gpg-agent-ulimit.patch- Security fix: [bsc#1120346, CVE-2018-1000858] * Cross Site Request Forgery (CSRF) vulnerability in dirmngr that can result in Attacker controlled CSRF. * Added patches: - gnupg-CRL-fetching-via-https.patch - gnupg-Allow-redirection-from-https-to-http-for-CRLs.patch - gnupg-CVE-2018-1000858.patch- Added gnupg-CVE-2018-12020.patch: Sanitize the diagnostic output of the original file name in verbose mode (bsc#1096745, CVE-2018-12020).- Added gnupg-CVE-2018-9234.patch: Enforce that key certification can only be done with the master key, and not a signing subkey. (bnc#1088255 CVE-2018-9234)- GnuPG 2.2.5: * gpg: Allow the use of the "cv25519" and "ed25519" short names in addition to the canonical curve names in --batch --gen-key * gpg: Make sure to print all secret keys with option --list-only and --decrypt * gpg: Fix the use of future-default with --quick-add-key for signing keys * gpg: Select a secret key by checking availability under gpg-agent * gpg: Fix reversed prompt texts for --only-sign-text-ids * gpg,gpgsm: Fix detection of bogus keybox blobs on 32 bit systems * gpgsm: Fix regression since 2.1 in --export-secret-key-raw which got $d mod (q-1)$ wrong * scd: Support the KDF Data Object of the OpenPGP card 3.3 * scd: Fix a regression in the internal CCID driver for certain card readers * dirmngr: Improve returned error description on failure of DNS resolving * wks: Implement command --install-key for gpg-wks-server.- Use %license (boo#1082318)- GnuPG 2.2.4: * gpg: Change default preferences to prefer SHA512. * gpg: Print a warning when more than 150 MiB are encrypted using a cipher with 64 bit block size. * gpg: Print a warning if the MDC feature has not been used for a message. * gpg: Fix regular expression of domain addresses in trust signatures * agent: New option --auto-expand-secmem to help with high numbers of concurrent connections. Requires libgcrypt 1.8.2 for having an effect. * dirmngr: Cache responses of WKD queries. * gpgconf: Add option --status-fd. * wks: Add commands --check and --remove-key to gpg-wks-server * Increase the backlog parameter of the daemons to 64 and add option --listen-backlog. - Not enabled features: * New configure option --enable-run-gnupg-user-socket to first try a socket directory which is not removed by systemd at session end.- GnuPG 2.2.3: * dirmngr: Fix crash in case of a CRL loading error * gpgtar: Fix wrong behaviour of --set-filename * gpg: Silence AKL retrieval messages * agent: Use clock or clock_gettime for calibration * agent: Improve robustness of the shutdown pending state- GnuPG 2.2.2: * gpg: Avoid duplicate key imports by concurrently running gpg processes * gpg: Fix creating on-disk subkey with on-card primary key * gpg: Fix validity retrieval for multiple keyrings * gpg: Fix --dry-run and import option show-only for secret keys * gpg: Print "sec" or "sbb" for secret keys with import option import-show * gpg: Make import less verbose * gpg: Add alias "Key-Grip" for parameter "Keygrip" and new parameter "Subkey-Grip" to unattended key generation * gpg: Improve "factory-reset" command for OpenPGP cards * gpg: Ease switching Gnuk tokens into ECC mode by using the magic keysize value 25519 * gpgsm: Fix --with-colon listing in crt records for fields > 12. * gpgsm: Do not expect X.509 keyids to be unique * agent: Fix stucked Pinentry when using --max-passphrase-days * agent: New option --s2k-count * dirmngr: Do not follow https-to-http redirects * dirmngr: Reduce default LDAP timeout from 100 to 15 seconds * gpgconf: Ignore non-installed components for commands - -apply-profile and --apply-defaults * Add configure option --enable-werror- GnuPG 2.2.1: * gpg: Fix formatting of the user id in batch mode key generation if only "name-email" is given. * gpgv: Fix annoying "not suitable for" warnings. * wks: Convey only the newest user id to the provider. This is the case if different names are used with the same addr-spec. * wks: Create a complying user id for provider policy mailbox-only. * wks: Add workaround for posteo.de. * scd: Fix the use of large ECC keys with an OpenPGP card. * dirmngr: Use system provided root certificates if no specific HKP certificates are configured. If bu- GnuPG 2.2.0: * New long term stable branch, replacing the 2.0.x series * gpg: Reverted change in 2.1.23 so that --no-auto-key-retrieve is again the default boo#1054088 * Fixed a few minor bugs- GnuPG 2.1.23: * gpg: Options --auto-key-retrieve and --auto-key-locate "local,wkd" are now used by default. Note: this enables keyserver and Web Key Directory operators to notice when a signature from a locally non-available key is being verified for the first time or when you intend to encrypt to a mail address without having the key locally. This new behaviour will eventually make key discovery much easier and mostly automatic. Disable this by adding no-auto-key-retrieve auto-key-locate local to your gpg.conf. * agent: Option --no-grab is now the default. The new option --grab allows to revert this. * gpg: New import option "show-only". * gpg: New option --disable-dirmngr to entirely disable network access for gpg. * gpg,gpgsm: Tweaked DE-VS compliance behaviour. * New configure flag --enable-all-tests to run more extensive tests during "make check". * gpgsm: The keygrip is now always printed in colon mode as documented in the man page.- GnuPG 2.1.22: * gpg: Extend command --quick-set-expire to allow for setting the expiration time of subkeys. * gpg: By default try to repair keys during import. New sub-option no-repair-keys for --import-options. * gpg,gpgsm: Improved checking and reporting of DE-VS compliance. * gpg: New options --key-origin and --with-key-origin. Store the time of the last key update from keyservers, WKD, or DANE. * agent: New option --ssh-fingerprint-digest. * dimngr: Lower timeouts on keyserver connection attempts and made it configurable. * dirmngr: Tor will now automatically be detected and used. The option --no-use-tor disables Tor detection. * dirmngr: Now detects a changed /etc/resolv.conf. * agent,dirmngr: Initiate shutdown on removal of the GnuPG home directory. * gpg: Avoid caching passphrase for failed symmetric encryption. * agent: Support for unprotected ssh keys. * dirmngr: Fixed name resolving on systems using only v6 nameservers. * dirmngr: Allow the use of TLS over http proxies. * wks: New man pages for client and server.- GnuPG 2.1.21: * modified gnupg-2.0.18-files-are-digests.patch to work with obs-sign again bsc#1039899- GnuPG 2.1.21: * gpg,gpgsm: Fix corruption of old style keyring.gpg files, regression in 2.1.20 * gpg,dirmngr: Removed the skeleton config file support New installations no longer generate a configuration file. In the absence of a file, SHA-2 family hashes are used. Existing configurations are not touched. drop gnupg-2.1.19-stronger-defaults.patch FATE#323084 * gpg: Fixed import filter property match bug. * scd: Removed Linux support for Cardman 4040 PCMCIA reader. * scd: Fixed some corner case bugs in resume/suspend handling. * Many minor bug fixes and code cleanup.- GnuPG 2.1.20: * gpg: New properties 'expired', 'revoked', and 'disabled' for the import and export filters. * gpg: New command --quick-set-primary-uid. * gpg: New compliance field for the --with-colon key listing. * gpg: Changed the key parser to generalize the processing of local meta data packets. * gpg: Fixed assertion failure in the TOFU trust model. * gpg: Fixed exporting of zero length user ID packets. * scd: Improved support for multiple readers. * scd: Fixed timeout handling for key generation. * agent: New option --enable-extended-key-format. * dirmngr: Do not add a keyserver to a new dirmngr.conf. Dirmngr uses a default keyserver. * dimngr: Do not treat TLS warning alerts as severe error when building with GNUTLS. * dirmngr: Actually take /etc/hosts in account. * wks: Fixed client problems on Windows. Published keys are now set to world-readable. * tests: Fixed creation of temporary directories. * A socket directory for a non standard GNUGHOME is now created on the fly under /run/user. Thus "gpgconf --create-socketdir" is now optional. The use of "gpgconf --remove-socketdir" to clean up obsolete socket directories is however recommended to avoid cluttering /run/user with useless directories. * Fixed build problems on some platforms.- Use stronger defaults for new users, using SHA-2 digest family for certificates and message signatures - FATE#323084 adding gnupg-2.1.19-stronger-defaults.patch- GnuPG 2.1.19: * gpg: Print a warning if Tor mode is requested but the Tor daemon is not running. * gpg: New status code DECRYPTION_KEY to print the actual private key used for decryption. * gpgv: New options --log-file and --debug. * gpg-agent: Revamp the prompts to ask for card PINs. * scd: Support for multiple card readers. * scd: Removed option --debug-disable-ticker. Ticker is used only when it is required to watch removal of device/card. * scd: Improved detection of card inserting and removal. * dirmngr: New option --disable-ipv4. * dirmngr: New option --no-use-tor to explicitly disable the use of Tor. * dirmngr: The option --allow-version-check is now required even if the option --use-tor is also used. * dirmngr: Handle a missing nsswitch.conf gracefully. * dirmngr: Avoid PTR lookups for keyserver pools. The are only done for the debug command "keyserver --hosttable". * dirmngr: Rework the internal certificate cache to support classes of certificates. Load system provided certificates on startup. * Add options --tls, --no-crl, and --systrust to the "VALIDATE" command. * dirmngr: Add support for the ntbtls library. * wks: Create mails with a "WKS-Phase" header. Fix detection of Draft-2 mode. * Many other bug fixes and new regression tests. - dirmngr: use system certificate store- Rewrite descriptions- GnuPG 2.1.18: * gpg: Remove bogus subkey signature while cleaning a key (with export-clean, import-clean, or --edit-key's sub-command clean) * gpg: Allow freezing the clock with --faked-system-time. * gpg: New --export-option flag "backup", new --import-option flag "restore". * gpg-agent: Fixed long delay due to a regression in the progress callback code. * scd: Lots of code cleanup and internal changes. * scd: Improved the internal CCID driver. * dirmngr: Fixed problem with the DNS glue code (removal of the trailing dot in domain names). * dirmngr: Make sure that Tor is actually enabled after changing the conf file and sending SIGHUP or "gpgconf --reload dirmngr". * dirmngr: Fixed Tor access to IPv6 addresses. Note that current versions of Tor may require that the flag "IPv6Traffic" is used with the option "SocksPort" in torrc to actually allow IPv6 traffic. * dirmngr: Fixed HKP for literally given IPv6 addresses. * dirmngr: Enabled reverse DNS lookups via Tor. * dirmngr: Added experimental SRV record lookup for WKD. See commit 88dc3af3d4ae1afe1d5e136bc4c38bc4e7d4cd10 for details. * dirmngr: For HKP use "pgpkey-hkps" and "pgpkey-hkp" in SRV record lookups. Avoid SRV record lookup when a port is explicitly specified. This fixes a regression from the 1.4 and 2.0 behavior. * dirmngr: Gracefully handle a missing /etc/nsswitch.conf. Ignore negation terms (e.g. "[!UNAVAIL=return]" instead of bailing out. * dirmngr: Better debug output for flags "dns" and "network". * dirmngr: On reload mark all known HKP servers alive. * gpgconf: Allow keyword "all" for --launch, --kill, and --reload. * tools: gpg-wks-client now ignores a missing policy file on the server. * Avoid unnecessary ambiguity error message in the option parsing. * Further improvements of the regression test suite. * Fixed building with --disable-libdns configure option. * Fixed a crash running the tests on 32 bit architectures. * Fixed spurious failures on BSD system in the spawn functions. This affected for example gpg-wks-client and gpgconf.- Remove the fixme, condition around fdupes- add runtime dependency to match runtime version check for libksba- GnuPG 2.1.17: * gpg: By default new keys expire after 2 years. * gpg: New command --quick-set-expire to conveniently change the expiration date of keys. * gpg: Option and command names have been changed for easier comprehension. The old names are still available as aliases. * gpg: Improved the TOFU trust model. * gpg: New option --default-new-key-algo. * scd: Support OpenPGP card V3 for RSA. * dirmngr: Support for the ADNS library has been removed. Now using bundled libdns, enabling Tor support on all platforms. New option --standard-resolver can be used to disable this code at runtime. * dirmngr: Lazily launch ldap reaper thread. * tools: New options --check and --status-fd for gpg-wks-client. * The UTF-8 byte order mark is now skipped when reading conf files. * Fixed many bugs and regressions. * Major improvements to the test suite. For example it is possible to run the external test suite of GPGME.- GnuPG 2.1.16: * gpg: New algorithm for selecting the best ranked public key when using a mail address with -r, -R, or --locate-key. * gpg: New option --with-tofu-info to print a new "tfs" record in colon formatted key listings. * gpg: New option --compliance as an alternative way to specify options like --rfc2440, --rfc4880, et al. * gpg: Many changes to the TOFU implementation. * gpg: Improve usability of --quick-gen-key. * gpg: In --verbose mode print a diagnostic when a pinentry is launched. * gpg: Remove code which warns for old versions of gnome-keyring. * gpg: New option --override-session-key-fd. * gpg: Option --output does now work with --verify. * gpgv: New option --output to allow saving the verified data. * gpgv: New option --enable-special-filenames. * agent, dirmngr: New --supervised mode for use by systemd and alike. * agent: By default listen on all available sockets using standard names. * agent: Invoke scdaemon with --homedir. * dirmngr: On Linux now detects the removal of its own socket and terminates. * scd: Support ECC key generation. * scd: Support more card readers. * dirmngr: New option --allow-version-check to download a software version database in the background. * dirmngr: Use system provided CAs if no --hkp-cacert is given. * dirmngr: Use a default keyserver if none is explicitly set * gpgconf: New command --query-swdb to check software versions against an copy of an online database. * gpgconf: Print the socket directory with --list-dirs. * tools: The WKS tools now support draft version -02. * tools: Always build gpg-wks-client and install under libexec. * tools: New option --supported for gpg-wks-client. * The log-file option now accepts a value "socket://" to log to the socket named "S.log" in the standard socket directory. * Provide fake pinentries for use by tests cases of downstream developers. * Fixed many bugs and regressions. * Many changes and improvements for the test suite. - drop upstreamed patches: * 0001-common-Follow-up-to-14479e2-fix-void-return-in-non-v.patch * gnupg-2.1.15-bsc993324-status-output.patch- avoid mixing up status and colon line output - bsc#993324 add gnupg-2.1.15-bsc993324-status-output.patch- enable web key discovery tools- Add an explicit runtime dependency on libgcrypt >= 1.7.0 to match runtime version check- GnuPG 2.1.15: * gpg: Remove the --tofu-db-format option and support for the split TOFU database. * gpg: Add option --sender to prepare for coming features. * gpg: Add option --input-size-hint to help progress indicators. * gpg: Extend the PROGRESS status line with the counted unit. * gpg: Avoid publishing the GnuPG version by default with --armor. * gpg: Properly ignore legacy keys in the keyring cache. * gpg: Always print fingerprint records in --with-colons mode. * gpg: Make sure that keygrips are printed for each subkey in - -with-colons mode. * gpg: New import filter "drop-sig". * gpgsm: Fix a bug in the machine-readable key listing. * gpg,gpgsm: Block signals during keyring updates to limits the effects of a Ctrl-C at the wrong time. * g13: Add command --umount and other fixes for dm-crypt. * agent: Fix regression in SIGTERM handling. * agent: Cleanup of the ssh-agent code. * agent: Allow import of overly long keys. * scd: Fix problems with card removal. * dirmngr: Remove all code for running as a system service. * tools: Make gpg-wks-client conforming to the specs. * tests: Improve the output of the new regression test tool. * tests: Distribute the standalone test runner. * tests: Run each test in a clean environment. * Spelling and grammar fixes. - fix build error, adding 0001-common-Follow-up-to-14479e2-fix-void-return-in-non-v.patch- GnuPG 2.1.14: * gpg: Removed options --print-dane-records and --print-pka-records. The new export options "export-pka" and "export-dane" can instead be used with the export command. * gpg: New options --import-filter and --export-filter. * gpg: New import options "import-show" and "import-export". * gpg: New option --no-keyring. * gpg: New command --quick-revuid. * gpg: New options -f/--recipient-file and -F/--hidden-recipient-file to directly specify encryption keys. * gpg: New option --mimemode to indicate that the content is a MIME part. Does only enable --textmode right now. * gpg: New option --rfc4880bis to allow experiments with proposed changes to the current OpenPGP specs. * gpg: Fix regression in the "fetch" sub-command of --card-edit. * gpg: Fix regression since 2.1 in option --try-all-secrets. * gpgv: Change default options for extra security. * gpgsm: No more root certificates are installed by default. * agent: "updatestartuptty" does now affect more environment variables. * scd: The option --homedir does now work with scdaemon. * scd: Support some more GEMPlus card readers. * gpgtar: Fix handling of '-' as file name. * gpgtar: New commands --create and --extract. * gpgconf: Tweak for --list-dirs to better support shell scripts. * tools: Add programs gpg-wks-client and gpg-wks-server to implement a Web Key Service. The configure option --enable-wks-tools is required to build them; they should be considered Beta software. * tests: Complete rework of the openpgp part of the test suite. The test scripts have been changed from Bourne shell scripts to Scheme programs. A customized scheme interpreter (gpgscm) is included. This change was triggered by the need to run the test suite on non-Unix platforms. * The rendering of the man pages has been improved. - drop upstream gnupg-make_--try-all-secrets_work.patch- Fix date call as the curlified parameter for sure are not parsed correctly by escaping it with %- Fix upstream bug 1985: --try-all-secrets doesn't work when decrypting messages encrypted with --hidden-recipient, fixes unit tests of the duplicity package. Adding gnupg-make_--try-all-secrets_work.patch - record the fact that gpg-error 1.21 is required- GnuPG 2.1.13: * gpg: New command --quick-addkey. Extend the --quick-gen-key command. * gpg: New --keyid-format "none" which is now also the default. * gpg: New option --with-subkey-fingerprint. * gpg: Include Signer's UID subpacket in signatures if the secret key has been specified using a mail address and the new option - -disable-signer-uid is not used. * gpg: Allow unattended deletion of a secret key. * gpg: Allow export of non-passphrase protected secret keys. * gpg: New status lines KEY_CONSIDERED and NOTATION_FLAGS. * gpg: Change status line TOFU_STATS_LONG to use '~' as a non-breaking-space character. * gpg: Speedup key listings in Tofu mode. * gpg: Make sure that the current and total values of a PROGRESS status line are small enough. * gpgsm: Allow the use of AES192 and SERPENT ciphers. * dirmngr: Adjust WKD lookup to current specs. * dirmngr: Fallback to LDAP v3 if v2 is is not supported. * gpgconf: New commands --create-socketdir and --remove-socketdir, new option --homedir. * If a /run/user/$UID directory exists, that directory is now used for IPC sockets instead of the GNUPGHOME directory. This fixes problems with NFS and too long socket names and thus avoids the need for redirection files. * Speedup fd closing after a fork. - drop upstreamed gnupg-fix-signature-checking.patch- add gnupg-fix-signature-checking.patch (bsc#981020) https://bugs.gnupg.org/gnupg/issue2351- GnuPG 2.1.12: * gpg: New --edit-key sub-command "change-usage" for testing purposes. * gpg: Out of order key-signatures are now systematically detected and fixed by --edit-key. * gpg: Improved detection of non-armored messages. * gpg: Removed the extra prompt needed to create Curve25519 keys. * gpg: Improved user ID selection for --quick-sign-key. * gpg: Use the root CAs provided by the system with --fetch-key. * gpg: Add support for the experimental Web Key Directory key location service. * gpg: Improve formatting of Tofu messages and emit new Tofu specific status lines. * gpgsm: Add option --pinentry-mode to support a loopback pinentry. * gpgsm: A new pubring.kbx is now created with the header blob so that gpg can detect that the keybox format needs to be used. * agent: Add read support for the new private key protection format openpgp-s2k-ocb-aes. * agent: Add read support for the new extended private key format. * agent: Default to --allow-loopback-pinentry and add option - -no-allow-loopback-pinentry. * scd: Changed to use the new libusb 1.0 API for the internal CCID driver. * dirmngr: The dirmngr-client does now auto-detect the PEM format. * g13: Add experimental support for dm-crypt. * The man pages for gpg and gpgv are now installed under the correct name (gpg2 or gpg - depending on a configure option).- GnuPG 2.1.11: * gpg: New command --export-ssh-key to replace the gpgkey2ssh tool. * gpg: Allow to generate mail address only keys with --gen-key. * gpg: "--list-options show-usage" is now the default. * gpg: Make lookup of DNS CERT records holding an URL work. * gpg: Emit PROGRESS status lines during key generation. * gpg: Don't check for ambigious or non-matching key specification in the config file or given to --encrypt-to. This feature will return in 2.3.x. * gpg: Lock keybox files while updating them. * gpg: Fix possible keyring corruption. (bug#2193) * gpg: Fix regression of "bkuptocard" sub-command in --edit-key and remove "checkbkupkey" sub-command introduced with 2.1. (bug#2169) * gpg: Fix internal error in gpgv when using default keyid-format. * gpg: Fix --auto-key-retrieve to work with dirmngr.conf configured keyservers. (bug#2147). * agent: New option --pinentry-timeout. * scd: Fix regression for generating RSA keys on card. * dirmmgr: All configured keyservers are now searched. * dirmngr: Install CA certificate for hkps.pool.sks-keyservers.net. Use this certiticate even if --hkp-cacert is not used. * gpgtar: Add actual encryption code. gpgtar does now fully replace gpg-zip. * gpgtar: Fix filename encoding problem on Windows. * Print a warning if a GnuPG component is using an older version of gpg-agent, dirmngr, or scdaemon. - disable running test which no longer work - remove 0001-gpg-Improve-the-keyblock-cache-s-transparency.patch is now upstream - the PIE options are implemented in the upstream build, and spec code broke the build. The only remaining broken executable was gpgsplit, which was removed from the package- add g13, an experimental tool for accessing encrypted storage with with GnuPG (cards)- fix fingerprint ambiguity (bsc#958891) * https://bugs.gnupg.org/gnupg/issue2198 * add 0001-gpg-Improve-the-keyblock-cache-s-transparency.patch- Move to pkgconfig() packaging style- GnuPG 2.1.10 adds TOFU (Trust-On-First-USe) and anonymous key retrival via Tor. * gpg: New trust models "tofu" and "tofu+pgp". * gpg: New command --tofu-policy. New options --tofu-default-policy and --tofu-db-format. * gpg: New option --weak-digest to specify hash algorithms which should be considered weak. * gpg: Allow the use of multiple --default-key options; take the last available key. * gpg: New option --encrypt-to-default-key. * gpg: New option --unwrap to only strip the encryption layer. * gpg: New option --only-sign-text-ids to exclude photo IDs from key signing. * gpg: Check for ambigious or non-matching key specification in the config file or given to --encrypt-to. * gpg: Show the used card reader with --card-status. * gpg: Print export statistics and an EXPORTED status line. * gpg: Allow selecting subkeys by keyid in --edit-key. * gpg: Allow updating the expiration time of multiple subkeys at once. * dirmngr: New option --use-tor. For full support this requires libassuan version 2.4.2 and a patched version of libadns (e.g. adns-1.4-g10-7 as used by the standard Windows installer). * dirmngr: New option --nameserver to specify the nameserver used in Tor mode. * dirmngr: Keyservers may again be specified by IP address. * dirmngr: Fixed problems in resolving keyserver pools. * dirmngr: Fixed handling of premature termination of TLS streams so that large numbers of keys can be refreshed via hkps. * gpg: Fixed a regression in --locate-key [since 2.1.9]. * gpg: Fixed another bug for keyrings with legacy keys. * gpgsm: Allow combinations of usage flags in --gen-key. * Make tilde expansion work with most options. * Many other cleanups and bug fixes.- enable tests for PPC64 again, the problem from bsc#935887 went away- Improve upgrade to gpg2 from security:privacy w.r.t. libassuan run-time dependencies (boo#955982)- GnuPG 2.1.9: * gpg: Allow fetching keys via OpenPGP DANE (--auto-key-locate).\ New option --print-dane-records. * gpg: Fix for a problem with PGP-2 keys in a keyring. * gpg: Fail with an error instead of a warning if a modern cipher algorithm is used without a MDC. * agent: New option --pinentry-invisible-char. * agent: Always do a RSA signature verification after creation. * agent: Fix a regression in ssh-add-ing Ed25519 keys. * agent: Fix ssh fingerprint computation for nistp384 and EdDSA. * agent: Fix crash during passprase entry on some platforms. * scd: Change timeout to fix problems with some 2.1 cards. * dirmngr: Displayed name is now Key Acquirer. * dirmngr: Add option --keyserver. Deprecate that option for gpg. Install a dirmngr.conf file from a skeleton for new installations. - update gnupg-add_legacy_FIPS_mode_option.patch for context change- GnuPG 2.1.8: * gpg: Sending very large keys to the keyservers works again. * gpg: Validity strings in key listings are now again translatable. * gpg: Emit FAILURE status lines to help GPGME. * gpg: Does not anymore link to Libksba to reduce dependencies. * gpgsm: Export of secret keys via Assuan is now possible. * agent: Raise the maximum passphrase length from 100 to 255 bytes. * agent: Fix regression using EdDSA keys with ssh. * Does not anymore use a build timestamp by default. * The fallback encoding for broken locale settings changed from Latin-1 to UTF-8. * Many code cleanups and improved internal documentation. * Various minor bug fixes.- GnuPG 2.1.7: * gpg: Support encryption with Curve25519 if Libgcrypt 1.7 is used. * gpg: In the --edit-key menu: Removed the need for "toggle", changed how secret keys are indicated, new commands "fpr *" and "grip". * gpg: More fixes related to legacy keys in a keyring. * gpgv: Does now also work with a "trustedkeys.kbx" file. * scd: Support some feature from the OpenPGP card 3.0 specs. * scd: Improved ECC support * agent: New option --force for the DELETE_KEY command. * Dropped deprecated gpgsm-gencert.sh * Various other bug fixes.- do not run checks on ppc64 for now- GnuPG 2.1.6: * agent: New option --verify for the PASSWD command. * gpgsm: Add command option "offline" as an alternative to - -disable-dirmngr. * gpg: Do not prompt multiple times for a password in pinentry loopback mode. * Allow the use of debug category names with --debug. * Using gpg-agent and gpg/gpgsm with different locales will now show the correct translations in Pinentry. * gpg: Improve speed of --list-sigs and --check-sigs. * gpg: Make --list-options show-sig-subpackets work again. * gpg: Fix an export problem for old keyrings with PGP-2 keys. * scd: Support PIN-pads on more readers. * dirmngr: Properly cleanup zombie LDAP helper processes and avoid hangs on dirmngr shutdown. * Various other bug fixes. - remove documentation make workaround, fixed upstream- Enable workaround for missing dependencies everywhere- fix build with openSUSE 13.2 and earlier, call make to compensate for incorrect documentation dependencies.- GnuPG 2.1.5: * Support for an external passphrase cache. * Support for the forthcoming version 3 OpenPGP smartcard. * Manuals now show the actual used file names. * Prepared for improved integration with Emacs. * Code cleanups and minor bug fixes.- info deinstall needs to be in %preun- update to 2.1.4: * gpg: Add command --quick-adduid to non-interacitivly add a new user id to an existing key. * gpg: Do no enable honor-keyserver-url by default. Make it work if enabled. * gpg: Display the serial number in the --card-staus output again. * agent: Support for external password managers. Add option --no-allow-external-cache. * scdaemon: Improved handling of extended APDUs. * Make HTTP proxies work again. * All network access including DNS as been moved to Dirmngr. * Allow building without LDAP support. * Fixed lots of smaller bugs.- update to 2.1.3: * gpg: LDAP keyservers are now supported by 2.1. * gpg: New option --with-icao-spelling. * gpg: New option --print-pka-records. Changed the PKA method to use CERT records and hashed names. * gpg: New command --list-gcrypt-config. New parameter "curve" for --list-config. * gpg: Print a NEWSIG status line like gpgsm always did. * gpg: Print MPI values with --list-packets and --verbose. * gpg: Write correct MPI lengths with ECC keys. * gpg: Skip legacy PGP-2 keys while searching. (drop 0001-gpg-Skip-legacy-keys-while-searching-keyrings.patch now upstream) * gpg: Improved searching for mail addresses when using a keybox. * gpgsm: Changed default algos to AES-128 and SHA-256. * gpgtar: Fixed extracting files with sizes of a multiple of 512. * dirmngr: Fixed SNI handling for hkps pools. (drop hkps-fix-host-name-verification-when-using-pools.patch now upstream) * dirmngr: extra-certs and trusted-certs are now always loaded from the sysconfig dir instead of the homedir. * Fixed possible problems due to compiler optimization, two minor regressions, and other bugs. - refreshed for context changes: * gnupg-2.0.18-files-are-digests.patch * gnupg-add_legacy_FIPS_mode_option.patch- Add hkps-fix-host-name-verification-when-using-pools.patch to fix hkps support w/ pools. Upstream commit dc10d46.- Ensure secure memory can be used with default 64k memlock limit Fixes [boo#915931], removes gnupg-large_keys.patch - Removed gnupg-remove_development_version_warning.patch, obsolete - Removed gnupg-2.0.4-install_tools.diff, replaced by spec install - Removed autoconf requirement and autoreconf calls thus obsoleted- Fix invalid packet read error when reading keyrings [boo#914625] add 0001-gpg-Skip-legacy-keys-while-searching-keyrings.patch- update to 2.1.2: * gpg: The parameter 'Passphrase' for batch key generation works again. * gpg: Using a passphrase option in batch mode now has the expected effect on --quick-gen-key. * gpg: Improved reporting of unsupported PGP-2 keys. * gpg: Added support for algo names when generating keys using - -command-fd. * gpg: Fixed DoS based on bogus and overlong key packets. * agent: When setting --default-cache-ttl the value for --max-cache-ttl is adjusted to be not lower than the former. * agent: Fixed problems with the new --extra-socket. * agent: Made --allow-loopback-pinentry changeable with gpgconf. * agent: Fixed importing of unprotected openpgp keys. * agent: Now tries to use a fallback pinentry if the standard pinentry is not installed. * scd: Added support for ECDH. * Fixed several bugs related to bogus keyrings and improved some other code. - in gnupg-2.0.18-files-are-digests.patch, change buffer_to_u32 to buf32_to_u32 from host2net.h to match upstream changes - now requires automake 1.14- update to 2.1.1: * gpg: Detect faulty use of --verify on detached signatures. * gpg: New import option "keep-ownertrust". * gpg: New sub-command "factory-reset" for --card-edit. * gpg: A stub key for smartcards is now created by --card-status. * gpg: Fixed regression in --refresh-keys. * gpg: Fixed regresion in %g and %p codes for --sig-notation. * gpg: Fixed best matching hash algo detection for ECDSA and EdDSA. * gpg: Improved perceived speed of secret key listisngs. * gpg: Print number of skipped PGP-2 keys on import. * gpg: Removed the option aliases --throw-keyid and --notation-data; use --throw-keyids and --set-notation instead. * gpg: New import option "keep-ownertrust". * gpg: Skip too large keys during import. * gpg,gpgsm: New option --no-autostart to avoid starting gpg-agent or dirmngr. * gpg-agent: New option --extra-socket to provide a restricted command set for use with remote clients. * gpgconf --kill does not anymore start a service only to kill it. * gpg-pconnect-agent: Add convenience option --uiserver. * More translations (but most of them are not complete). * To support remotely mounted home directories, the IPC sockets may now be redirected. This feature requires Libassuan 2.2.0. * Improved portability and the usual bunch of bug fixes. - removed patch not part of upstream release: gnupg-2.1.0-boo-907198-openpgp_oid_to_str-buffer-overflow.patch - refresh for context changes: gnupg-2.0.18-files-are-digests.patch gnupg-2.0.4-install_tools.diff - refresh for upstream code changes: gnupg-add_legacy_FIPS_mode_option.patch gnupg-detect_FIPS_mode.patch (MD5 removed)- Support for large RSA keys This involves compiling with --enable-large-rsa and - -enable-large-secmem, as well as patching the number of secmem bytes and IPC bytes to slightly larger values. See https://bugs.debian.org/cgi-bin/bugreport.cgi?bug=739424 * added gnupg-large_keys.patch- update build requirement versions that changed with 2.1.0- fix buffer overflow in OID to string conversion function [boo#907198], adding gnupg-2.1.0-boo-907198-openpgp_oid_to_str-buffer-overflow.patch- obsolete dirmngr (shipped with gpg since 2.1.0) - spec cleanup after previous update - get rid of "THIS IS A DEVELOPMENT VERSION" warning http://lists.gnupg.org/pipermail/gnupg-devel/2014-November/029065.html * added gnupg-remove_development_version_warning.patch- upgrade to 2.1.0 (modern) - The file "secring.gpg" is not anymore used to store the secret keys. Merging of secret keys is now supported. - All support for PGP-2 keys has been removed for security reasons. - The standard key generation interface is now much leaner. This will help a new user to quickly generate a suitable key. - Support for Elliptic Curve Cryptography (ECC) is now available. - Commands to create and sign keys from the command line without any extra prompts are now available. - The Pinentry may now show the new passphrase entry and the passphrase confirmation entry in one dialog. - There is no more need to manually start the gpg-agent. It is now started by any part of GnuPG as needed. - Problems with importing keys with the same long key id have been addressed. - The Dirmngr is now part of GnuPG proper and also takes care of accessing keyserver. - Keyserver pools are now handled in a smarter way. - A new format for locally storing the public keys is now used. This considerable speeds up operations on large keyrings. - Revocation certificates are now created by default. - Card support has been updated, new readers and token types are supported. - The format of the key listing has been changed to better identify the properties of a key. - The gpg-agent may now be used on Windows as a Pageant replacement for Putty in the same way it is used for years on Unix as ssh-agent replacement. - Creation of X.509 certificates has been improved. It is now also possible to export them directly in PKCS#8 and PEM format for use on TLS servers. - dropped patches: * gnupg-2.0.20-automake113.diff * gnupg-2.0.18-tmpdir.diff (socket is created in homedir now) - refresh most of the remaining patches - added new BuildRequires: gnutls-devel, pkg-config, npth-devel/bin/sh/bin/shdirmngrgpgbuild78 1623341615  !"#$&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{2.2.5-lp152.9.3.12.2.52.2.51.4.92.2.5-lp152.9.3.12.2.5-lp152.9.3.12.1.01.4.9 gnupggpgconf.confdirmngrdirmngr-clientdirmngr_ldapg13gpggpg-agentgpg-connect-agentgpg-wks-servergpg-zipgpg2gpgconfgpgparsemailgpgscmgpgsmgpgtargpgvgpgv2kbxutilscdaemonwatchgnupggpg-check-patterngpg-preset-passphrasegpg-protect-toolgpg-wks-clientaddgnupghomeapplygnupgdefaultsg13-syshelpgpg2AUTHORSChangeLogDCODETAILSFAQHACKINGKEYSERVERNEWSOpenPGPREADMETHANKSTODOTRANSLATEexamplesREADMEdebug.prfpwpattern.listscd-eventsystemd-userREADMEdirmngr.servicedirmngr.socketgpg-agent-browser.socketgpg-agent-extra.socketgpg-agent-ssh.socketgpg-agent.servicegpg-agent.sockettrustlist.txtvsnfd.prfgnupgdistsigkey.gpghelp.be.txthelp.ca.txthelp.cs.txthelp.da.txthelp.de.txthelp.el.txthelp.eo.txthelp.es.txthelp.et.txthelp.fi.txthelp.fr.txthelp.gl.txthelp.hu.txthelp.id.txthelp.it.txthelp.ja.txthelp.nb.txthelp.pl.txthelp.pt.txthelp.pt_BR.txthelp.ro.txthelp.ru.txthelp.sk.txthelp.sv.txthelp.tr.txthelp.txthelp.zh_CN.txthelp.zh_TW.txtsks-keyservers.netCA.pemgnupg.info-1.gzgnupg.info-2.gzgnupg.info.gzgpg2COPYINGCOPYING.CC0COPYING.GPL2COPYING.LGPL21COPYING.LGPL3COPYING.otherdirmngr-client.1.gzgpg-agent.1.gzgpg-connect-agent.1.gzgpg-preset-passphrase.1.gzgpg-wks-client.1.gzgpg-wks-server.1.gzgpg.1.gzgpg2.1.gzgpgconf.1.gzgpgparsemail.1.gzgpgsm.1.gzgpgtar.1.gzgpgv.1.gzgpgv2.1.gzscdaemon.1.gzsymcryptrun.1.gzwatchgnupg.1.gzgnupg.7.gzaddgnupghome.8.gzapplygnupgdefaults.8.gzdirmngr.8.gz/etc//etc/gnupg//usr/bin//usr/lib//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/gpg2//usr/share/doc/packages/gpg2/examples//usr/share/doc/packages/gpg2/examples/systemd-user//usr/share//usr/share/gnupg//usr/share/info//usr/share/licenses//usr/share/licenses/gpg2//usr/share/man/man1//usr/share/man/man7//usr/share/man/man8/-fomit-frame-pointer -fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:16498/openSUSE_Leap_15.2_Update/9e3bdfc4c025d359a19d228e0c94be79-gpg2.openSUSE_Leap_15.2_Updatedrpmxz5i586-suse-linux   directoryASCII textELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=27879ba8437fab7e8572dbdaf17e564a3afedb1e, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=e7a11f38d81fc1d99f095b4e96e73a7fe780e2c9, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=1a07ce57ac6f21ba84d0be3ee9220743dda46fd1, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=02d2922cd78aa0892d98d2631142714932971e62, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=8118376a4bba1d39c88f93648519182195ca62bf, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=c2827fffca967a5307fa97adc601b5038d43d9bd, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=9ef066cc56db7846275650383d1f67f630bf9d6e, for GNU/Linux 3.2.0, strippedPOSIX shell script, ASCII text executableELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=254b4136ec6b8d7b63d678cab366576f5a784c11, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=573f5ceb6e673ee148d9ca1d79ce6560a3a9aca0, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=1b4cb73d5c16071575a93413e0c5e1a08232a914, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=26eaa253243023b4078d8b64eed9491f275fc441, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=f45356b05e832f2b11a948064771d659278e9d55, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=858d5f8507042792dd50385948bea8797936249a, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=78a9d0d08fc5cf780192276033ffa90fe43989d1, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=3b2f089729a0aebbc7fa6cb7e80c8d9903fcae28, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=4096cd11c0785fc8a6826a2899ee663c4070ffc0, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=570d47b2113f1bf49472b3629319b8acf8a4f7ee, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=61293b90a963daab22ac871f7040e6eeb6557712, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=37a81968c03492c01f6e4b9faf822e0891e3e2b1, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=2ad6ca07c2072f1a662787c1798f2aa952bffc57, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=59769525e70e0aa499ed937aac32220dce1f0b0a, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, Intel 80386, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux.so.2, BuildID[sha1]=55ae735a616273d8a3775854ce798b8561b66c64, for GNU/Linux 3.2.0, strippedUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)/>Tl}!'4CTdef R,R-R%RRRR!RR)R(R'RR RRR RRRR R R+RRRR R$R&RR#R RRRR RRRR RR RRRRRR RRRRRRRR R R RRR#R"R RR)R(R'RR%RR RRR RRR RRRRRR$R&R RR%RR)R(R'RR R RRR RRRR RRRRRR$R&R RRRR RRRR RR RRRRRR*R RRR RRRR RR RRRRR RRRRRRRRR RRR R R0RR.RRR*RR RRR RRRR RR RRRRR R RR RR R RRR RRRR RR RRR*RRR RRRR RRRR RR RR!RRRR RR*R RRR RRRR RR RRRRR RRR RRRR RR RRR0RRRR R!RRR RRRR RR RRR RRR RRRR%R!RR)R(R'RR R RRR RRR RRRRRR RR$R&R/R R R RRR R RR RRRR RR RRRRR RRR RRRR RR RRRRRR RRRR RRRRR RR RRRRRR RRRR RRRR RR RRRRRR RRRRRR RRRR RR RRRRRR '#?׻gpg2-lang2.2.5utf-8237946ae2f0a1f2ad68f6f77662d0b67c31f8b1d87b442eb930e0d3849a5e3b3?7zXZ !t/]"k%]@g,#뛯c2Qv0st?2<;=K>pI-f7A[:HgK1{^we0]ۙ~ \GO(Pڏ8{v1C#?mr#{',Α2rd,%JѤ,zh*2mJmլT jR*nf'$I<؅yW/"Qd}@Y38d=;7Gnh ߂tP!uۃa C/2V&5A"w oeuD_t~X'l M])f3ЀϏD4'w;Kgl/lCQ%|6&j7/ky/DK"ug/BȰ0AV jC*SO/PhL@Y #[0͍!,o6=P)8U%׫uKxapIN@d n{Z'~ -k >KW=Dz<+~#Y+AEPNC&#b; CrU u]6fHo8jͲMʜ3ŖK 60㫐7d=$©`o 9s=Ui,Μrc4G"V]ӔDЉFAuHbplW vnS\=3W,Їmx+:Qm$dJ;N=[Qc&) пx* VegҬeĦ)"|f^o qJBڻ[5+zI=t$ÈnY_،Ca23ޜO!Ҍh( S$Kb8pcڱ.zƿ\3% w܎Ӄr!ml압Xr[ Ye2&ƽvm.*>hcMs}gdN0I0E}U_ xi\^xy1g7?\EH$gQ8 ǘCSwF<6=%_  5Cq6_$vHBY?#B5.|,w{ koӔ&wWs(# KFAY%c*9XN87bC+H;`J:^VUKɤisihj`9 {?"n"s'eEb$?|/)d=´(1U܄6a\n3Q::+Xv"n}xq>;}NF@0 N3Lv2ir$v!2}v|DȀ%,G_ 5-x2Jѷyet } G]9t&y`c^ojnJNT[xiDMDaƪ W^t8@ųa pY{X=a " -*{@rFh.mDȁ{V-# @u3F׉y(<m/JcA x~Ipٚ ]aՆ[8dUӯ~g&PyF)Y$}^5}tdY@JC"O|Ώ4,"mEPg-=BY8at:Z#_'})r~.1ŮNc+/$JzK>[YmTte1Ӏ[if*cŽvՐAE1YX{qb-25onO':Y+4siU4^*߀֭k_ y"e~9ѩ9.jW$DU}5UOUinR37!W='`(*iߴMȧ&x]}XbNОF35 S1Heon]gz%SƸc[ Md@NJxb0Φ.[>+I=П'ioB∆n;TBk*F0nk ^K*[?@1H$s};{6feFBZsZ{8X–rR+f jFiH˺v$KR*%ݫr͒v\bkNGl9Y!7'AqCI}\*DgMC#*{SғKrW&:S04a敓9x\@$Q!ƒ+=tMA+ WQDk[5%L&&_$-@ib&J(91{twbKݜrneI]Ғ ?U 22 Y'.D<9{XgsbY:YXI-qӓ]!`B% p-)E~A%&NP]~)o7m O}X}ot&Sh5#koqP{LOR%aY 2%k8 pH`@/wQÁ6[#"1ISi`sD_KH7y.\@$] "Ĝb:~\E O'χQ;iẬ_҇LcXaJ٨p`󋚋ԡ )q/e@v*ۢ(~ffSIe$+љ\VF[ǜS1!"Ŝ ;ޜN݅ݣ}ch]zĒGm{|r)a)wZN2}buP/ K}족"䊾( @3j?itQ(urpl9i48R6-"zS 4 (%qyw $#}ߣ#OXmcqvzihHּT, hVEUۚ-"a :aH2 wF#wռm nJ/I09.z' O_\w BIIx;E}_hEXO*weJz_}\a1b:ѯ{hV! |~2eӷ:XI5Dt%I NNݨ1*ɛFto߱lBTܜRQaE3X8Vafޭj ט W=cWʄHhTJ)Ag h~jOD䆪|Cx6wU. A>1yyv8G̯\WVfIRX} ZE HIxGβm Gb٣sϯA3uhq;w Y|mk2&::񐛩, h'ΦjQ.+=G ?stF㵷6h;04L@#>,,Xo4:T\#*C@`ְ?p cq] R?yMx̷8 Bk#ggn73NFt'Y) c5t mHdZ1!ڗMBFzHQzH2˭AZݫ\@!42\!Uوck;>|Z1nG\NO4^ \Y``$͍Sy__c9ԎE.Z0mjBhrn-9g'0+%h1Ql_)3B`อ 3|+QUҖ༃1A^Tw}^El6^%|o˜*ujg.Ȩ+pQB`N2o@ '& ā;CͣMBa Gn"3(d~}a>~t 0rJ@ ,(MU6rwo;?-qxl[ 3({},5w:;su1Wf. ۧA@G֠y)C$ sR7X|l*v3cħ~1ycwB!YQ.YC_C?m5IuF^I^rSYhuz0,g|q{~<uely7v/ݮ>#b^`!eOsi 0,%FS~Y?A )&ա)*g`jT?yb2vH=,nñI> ŘG?t:&H=~`?!DgHGg9Hq{HaS919~j!N:{vӗ" 9A^[pk{חIK MRbdܜ6-M-Th/ 1s!mH+1ݴ D>λrI 6HO9"%tp/qa{ޢjЃJ煵[ oTzxf/^l𺤧syen6t[bkr0Uơ\渲N,EΎCJVCuLO[umva|!WBAP~"mh[ޟ"&P2CNa@P[@`'e)w獃d~#sh>ٹo4'GvK }pbi$CZ|>eBQN ĽaN!v_Wy6Htd}(Ucfp෗;Twlo=KnUnSn&pZMz]MWkm._Nbp0K«(&Pл!\˯F&T9fGUh=Dt ǰ92{r^*,λ nƈgmgw+^(qn97 @n;~"3ZT3$<8+$ B[~m1D6K'Vd>9D=0_6o\mښµgpB;Wrl~+z5A<kUN=A=-&[lZ-CzCuR%WxIRlNBRNQMiQGc(:6? mbnR r2j0m/j`!*qIMف$mv},M?yB4%M -8D1ȸUDqkK/3>ڈaf> rcM[l#,3k{ K_~۽.xE!WA==YufQQBz"qi>XS5h.\pApgk?sykS;CaMѠ* #Z`k*[T6Aף}Kj2Z>f|lVٯҦ/9iA7s /OaRs!g)^{܂<81XS13Rb(i)ωz{ns=,b3p2bAa5b h 9\-*`DI\S&`ąmEue )qPOQlOrVNV]Q^UKl=%1[5~A80(!VmM$YҞxZsG*7|4|X/j7m<ůEg6o8'b~ԝ >Nߝ_RFw#;C(Ǭ. 7g74y.#$lbѯ,ij 1#$3GP%%P\ܪJd4$5Z!~ˋmZ9.o ,hN𯴦 ՆH]HmgV |6D>7c P/IYu a%bW >UTqO?YFv1by\ُp=2y0@e+B>0҃k}PὦeWzsxNOJ(a`zlʦ ڰ}F1Կ~S!Ho*mf=M7qF\6tl{(H#IQ E1î![eCʲ̈́D`H^آO/,_O ߕ4U\c+je[-ȴD _5mC6T'8S_-B C?oN¯Kt,jkLlvvt{}z6覒(n0{z΁Hp~*}UBWzxnC7XL/N2Oe^v#!»巆ّGg}-Kœ"N>S$7:S%[fx^n*(С*ɔIYjh+x. _A/hLfYdE|xLp* >/-7I#Wν).6$E6c2= Y6*͎V*jn$L8wkU1RF*Ŀeg"P> h(CYur?ݿ_Mζ~1 κ{z8é t3Ĩ'&y?BuOc~BCآܐ Qξ[ @L%5 #0(/. NSi^!jlYHC$mNIBA ]ax G&$%IqʠjXùElМ2E߃ cꊝȸ5- ,\agH2 լ~A}ĘJfL\޹ղ4~cBF!ȓT(Fuv xS="Yo=|(_Ҏgo-#uӅdOcЮ~*FӸl_ 99Zœ PڃZoJF͏Ec>E/OGЅ{= =~b,+Pk53^5 Cj{n+cʕ E8NKj,O3xke^J =>yg#X YN1|;~iW|Ά&_ũ3#g  1NvsCCh|*D7 f#&]g2Aޫ-?Q[&~ʙb;oM1=ѫkRՅY`STNkJjO7>B#2"ͽwGفLTNmF5ZFA ˖ō|VBjLxd ! ]>rܔ38:d,x?E Q{ÈhnBP1fAC*{o8 Ѳ+?-(MePҷض]6 Wl+Q%}?ʘ&Nc?xʳi [jkdlB aR՗VMC6F:} hf+%|~'\e 6#q d|? ˮ$vPn lJeL\&B,V7趔 Ta@Aᘫ2:5FqºIHÊ,2bZ@W]YF{wǯ sA0{Sglj e()9&wNAx"ϭqQXesd]U .'C[ Qٜp Ay+)Z(Ldύk%ٌt@ل8[ oM&4S+xu澠D9`<愔K?/ oY8Ef }y`RY1"yӎ ֢ܖ>λ_-an Ԭ0q%)|ľ>pDx_#}t~l^TYVo :fkkŢy(O!W 2o. $)z \l( y\u+ƯoP$trF|/&Zc[ 'HtS^aVEOsn4zHz!8#/ǓΪ&Şڙ~f6$&{mD/ؔ @$L_Td!Mn")~ Iǝ*CmYs9ʰƧq(@ÔEj@Tb߃$K\A怮N`{7~np&[k5yċӿ\9堰AG;vR9ŏ9!qE(ԢО3;9?aZ"`nj/Ԁ%]&SEv|Mǻώ옃m- So w*l|Jۓ̊A(pQKh9׃`*8ak5hF%ED] ܱB<&;}7dfɔPT=!d)fY?mEߞIYoC[gض;7}lfCN @h Y7V1Ό(f-Ȕ/ i@PCk`D,EY6Mʸ֝ N8I[`)`)ƋSArzy U]:V9Ǜ>Ј_U*HXa|NK vDd)"vF75eאx}kZƷ>UM5빐~aneH`-A@c{0ƿ~cr)n?6Gc>j~d$}p3e."ttiJ\ XŔ-@pԩJUy @q!#-Tg>!'R/ G)ߦQA1wx=dem\#>M :h8g ^ (6W]AS }sVu=U݌UͧGϭ+4ѮJ[1i-ھSA?.Mc֐ Y Sm$k23>EAl50-:p^]ǭXߤXf%Z\%ؤU~S ? 7'!CIoۼ4)IFCrGʏ8gV{Kβ=f+Vt #Hf"8|QD}k_掭0_ A0+oX <EZ[qb^E(y v~'K76t{ zoUOz,73)9yIaeK)+Y '^ jऊe  >y׋ ƲqlHej><{/wfwy-_U,T|䋟Ž=aAj"y%Xvμ2ݙ;GR,Iqawa*g} D޿d.X"w]Pc4PBq΅@N/8bS(>L0ێ!eglt|φQtG7OG," #s)8VzyxKаKs6QK-eWgϢB?½Eڢ 3v3ZHbēo_B?\XpKqO-"EZ 6;!byc߻ۢe}W}b;L 2AĸԄr(&:k#F43KyhTr\Qgܻ6-Ybx'C+ysA Ͼ8bӥӢo;zT>H? 89ЎKG()5\j(ydߨʀ 񻝱E,Bz hi7rq-~$ꪞK󾭛+?zeS~ۏ*f,ʭꜯDXeƚE=<:_OG_BI}GC] xgsZmI0B7?!(QoDMǾ o7'i ^⠹ز5WpxN:OKx4~y%ٞ/T+Z\lU~vslpz]<774(0 תg=T?Hh[QN>E))8KD)拎_JdcQ,Ȏ_4~WnX-A 0q .'c"x%8]&lk u!lX.Lzgg=܉YG4Re91WşMrʅ|KZ$G!PL:*3$Z/H<"Z(q6eY*dFws3B غZq]_h\c6;6H*B!^zZ_Wsb{"9cLFT&0yI8H2yg·NqDGv:j7isIA&.Ĺ۲Cr5PQ*$&;g1[$_xިsŷ٭P\Qں`@z_8:CG?ng``?ߟJLQf9~1 ܳ! \RXrΦ A&v5wҥ% |9Yۜ4kqɢ2W~Q5Jw'R:U̖e?vD m>;+z:oi6ٔ<vctp_:&BHnF/"^ʔcp"0 =:.xWCj&֋ q垴mߑdwpäӤ#籊x`G!>˘uȌ7xq+҄nXLd֔A߁+ b%6!`[C >`x(E\UT>n_*6!ux~1,f-A/U)+AC頏 |Q^rɤv|gE1GzȞR'?!.3y vleq  ߹kzf&8o1$ sa/Px jS( hAdE_ 4/߫9H!'t%G"lHONMq/!4ʘҧq+BĨ7%Rf/ZZQPgYW\] ̂>^LuY6ĩ8ZcOj5 9SdY)3O)f6F7A 60M R: qq.1G@'n٠?Ws؟qŎhk,)9R2+};Cq;+$ɴZdg)Ra٦Љܵt̏7nUKVY1E`Tה­h⦹]qɭm2Т12ؔlu^f=1MK^ nV^ Ieb pp3* 3ZT>cXO(sq'vҍ6Pv lXRv_vGQB'\h zSߌІF6Do ʻICtՋ]X+==&ljm*^ȢIz%k]_f#Ђ{O>/fgqM lZB@ rX! E?gx.k@uO4p9;Q5k uSSj/ݵs%'aV-U}ww#_4Uqƞ7d92F؂Lp~_FE ly4xe+dx,$6O{*nm?hgKrqU_Nu~W:ʋ۷ ,pp!Q{5KUy5|$7pɭ0$L{R(|O +mOvTaV)r#dLH} ,̨MKWИ]c4 =k+9p2|yOoNoR<~|8%N:Dw;f*yuBxKq93ʖ<nsi_H0FATwvO?ZPKźC1 MEK1BEț iBO5uKmm8հ>$9qkT:ݾxE؉mhmtn^*@y5G +ɍ^GSf CK42/g*x/oH˜}a Qz,z."{2Uq#NUwʁ6 t m0R%;2i &z3ǹSJNJTdrgûUXKuE,웂9(8BM2\!{[*.u]uwZMTO~ٚpU6F17;VmY⃈Pz LkƢ.p* ηAA#@gpPSg7=:K[AYji֭w_W٪îMn hVL_vPbU $uI^KLa,tm_#ĘH4h -,ߛ4٩coyv'"`t,|,_4vK4 YM% 9̼kEזzuyBEiMקt>F>x*3f\s?Pm>I06Beoی_l}#(Tonq ZFng5젇ZƇv gmЅ\XׄDWUVޫQG'g:s B:x26x$yߔ:6_aQo|V #UJ8¢2yb [a4\,ֆ}k^#vW7#X8 xSv@vX>K$Û89OAIoT$Jj/I!.]LG9B܁!o>ĩ:8e FKWC `]'fxxT`qeEoYW 4P Y`w{`l5aq6+ש}dVTZT?,'֫$[ճQE;NuC|F; SIYfD+`z-:W͑D28殺uI)m3w-c~ el?a>5ʹ! @B NĘJF+{x7{ڦ#Hj1P?-ĢshA"4] "3iRq(d2=OcD|=>3~znMi]rw1$gDꀸejUl|?Ma~?{ry nL {؃[cbȅibhkU޵e!zG*)NYݗ@yQJh+*#V*qQނqk\hv/րўBMxtk={LbY0$=,*K/CsDiy,ڨ- [d *`4X,%)$^͏OMvo%kz CjF'L4ɞ۶OݔYrc~& O$+ůc=O}6{Vy+sU1p8Dva+Y+{^R, McP|n 53SNhgiUQYҌN(}lX+ q$+술r6۔Js3^Ko+W(rQ;FEC%mǝN9mX6 zr1{C{^G ;G/1*ĴSzl t-=T'짭Ŭ(YG3Hz ^TXibO*E[劐^=a˙s@Euo=Ô7lVO @qONRjv@_j#߮_/![?U k'hV< P{i?ht%P+ݲXZ_UI ,#H,`L0LM4V39EvickԐaփm|Age12&_9%-4dhoPԦِΧgS6=)W[')@b:܏ Uq')ͯr.'U]*icVqc+<ӑک[ʼnpY 8[Y ;[U7@Y b]tZQqG@*:fM |qow:īTUlԦ&>v!D*9h_&|B맍5.m1$ƻ}Q9Lk K-g:nT:js;akK #~0r} jڄ]ޙ9Q6E=:  b0mѶn5¯ZXj(еV-& "J@`Ln٬O n1"X h@֔kD a9h/,?zg FP *=l19Sk4b{A/mkEBwcqn/FI͑T+TنⴕIh./:QwSM"өI_zA;甼o `9uorolںGd.ЊXqa(81L]O,61WM~kdd':#/U'5ɨ&AKGY/70xă*^`.ﴜ;;y~~F$yiq(\ FrRvɪ) 7lt'UP=Fm(-W H'#7Ä$4J58;_rlY6͇ӟ&gCf]*J~VPdQ mj8-"k%L8U35"X),n{m 8!"#NV@8!C gHlhz pt5KŰ"әf ]HI$' SG%\ Sɼhm 7x/Oc+= <*(Z;C (eOBV6CVu'݃_Ӹ$/ #>c ?W]ց!:j3 J;&DK 7kIuY&9m}|.\K#+)SI |$sEVN6? kIxX_W>a\?yzB>?`e@_Ȟw@&>c8ٚOc=Ik .qA8ӯ,_¯4]\9+LYz&iHXʣ`c@ |r.諕n_ ~Nj@)S{j#l%ßan)VN%g8xN~ق 5h$$qZш #R]~H?FL^ yc#$nG$TWZ(9zzx'h eP  ̃jǢ3>9= [T $աΩ/tHakE`bݱM,([{e z)7=r { rP :+ͨ/"LU + xHСPХC?бH 3<8UͱleW"VriH$q 9X+gɶ OK~ 7Ee{7dgi,}_2]qG y5%j N(H 3&C$-: DۧÓڼ]guMWj;}~5܉k7.}M`_=7oVc.c܃l ׳D ͳ/3-0MG?vMGHh<1J@kKfT%f0u,ɔ, B{n]Zr4_\)~yJu«[tS񷕭4Dm*n-t<36qfG E7$J-"&SmUXqTKp{%*Ϋ0J j2IT BjyhxtEF`QOeELZנ}֓m .P;kB!<A[R}| 25n&BKwɹ8Th]QN,?Ju#+{`3x/L^Q,6Jڷ\+V%u复 4*o>߇KULJZ+6`F,+3Mqe.́ =m,y*TWOZ4Z`YlQDq,YQ w ǠͼvD~b6s;}⊙,C`dr'39#&>g%`\# í {V-`KjվSS/!six$ nk5-ws(:[N~Њ)}QF7npi]4x,G-)lG4 w?w /rXF砅TC79ʩcKF!5m_w<eEg!NWu_hwݸ^& ՇyDPhPC,PJtӳdK! AnֹnԂVn^ 28&0T1^s 9R/FE |3[Dʘ30g'z디EE6r_24:&ϩo9N~A f:rJ艩C9Ò0E $1:0EN=zJcU0i@4Y}':\_1_bz?jI\8hi/LξA(X|StNprpì懐eׂۡ׷M#\u@˶Tz\] }#CƆ˝QH96i)y. W ފ'6#>=ߋЖt1}M0g?.v[ * qѶ$cW%+=]|#96b債i8)p2Se[tI5@`ޡf 0ǡN-cҾ)oL6 b*W;wSh옘t`4<9!K:ՆQ(U~57Z0#`#=N[2l]a+J_^Nx7]`EQ1)u X5_"@?Qu갲'_lu11[W/,_-~ Y0i3ҹ' #XfZ Vq"wJbne>,$h˵NRZ&5^e.S7ڏc8zS8>zC#tjilDmȄQ'rL }x&EYy'О U;ХE= `_l0)|7\EΨuj?) `6  ]9{m."|jo T\omEW|<T!vL[jt'3M5 TrK7m~~RAH^R1 >WNqb FT UtCG2sK5}ydsH\l솅/-GѳBhtXKʹnH۪ 8LTd*@udd=0_gI0 {#}09WT] ѠNfkm_4DX(]8rAkd4$9dP!?x25@@+McK訝D9js}4~&+ \tppG K2[)5!M&x[6geME{_\ΎX)2@~n6uӪJ$s$`\h%\7PޏYngU=qY>n&(n豟]lGJ&(+DHVQlxjcqPYc˛^ta՚/aV*CGdDُ;nz!V^YmtUui4h8V=88\G2ƀg|gCJLҮAX+\0qdlxZnYK]p $WWm<o,̂h&l566b8^^D(/7I ӛqCY.RHIw5"S"A1B (1vYTނ KaZp̙0waZxB 2-쥺+лd:S#TH7O *6RK!f5#u]H*.Gjl!'K7MFWeC' ?6(͟a?Mt@K`ZK`K ސ ή|` ĉU)â"籅?wF-/ f"ߦHSNJ|cWR T/[sh;v?>s=m')ڣJl(]iZO ]Z tb$lkˮ@$H|"UQ9{JI?H#`;@vȫ0^w{ǯڿAʯLDp>-iP\U ?M1H#6JTq?Q]_iPke(0chW*ex]e0NcYO}[Yr0E;į-*ϰqU kQDVc %2nƤl^a0π0ZB9Cg =4 ISEi9&S>:&|˥#6EPYb`kR1*(?@;v݊dcH;"s]2bxriSi+ɍw|ks"*eD=vHуg'1)%l< slH@ 7N9CK\G!lVQA{TI,N#9 {F.v쩺YJ7f6uI3˩)Vj/Tcp(%]Y7 3y*8n#CuAZjWoJA2vZ`oaI^8`IGOz d66$Sӣ]B?Z0w2IH hY&BB7xu%ƂE8NmNUfNJ.)-\|A%κisf)7/Ȥ ť/-DJt*tUp:+K:DTaz"Hp[P]ߠD GaVL]dZ] 3ϝ&qo]福FE^i@DlA' o*^`iR46^%M%(=9v!#heH4ӖPB癒$`ː\^GJsNHrYQR/[- j`p4=.X¾4AI_Cѡ[cxjJq:Qs\cn;M@7U^AۜJ;yŽ}#}E~{7g^~VO=VIx~2vg\O: 29 ;EGH# -C]@+͇<^]^62qڮ#c0Ǹ4'% #LJk/N[s3vSp6Fla8-Wܘy#)GY Ylr&-q2w kj΁7(#dR% 4ک\`ַ%G$ؓdV3DW>|~@q0`attljc( MvQn1AʪW ͲgïxrᑎMJئ2->6V0G*Ar}J!r `pyAmMq #Rs彬f`"lcZUwPP4b}T0gCqR'fpQy|l3CtE=Sgfj._p|2/ZyLЇ[D)d] Pzm:罬0:Xj86,@ S<DZj&%Zipw7_|RUyQ.u@McQǯ}"8P?!d q:aXj^i |#C%F#=Qe bMnIp @ͭĆ-3(y8#SC(!b0\'(+rLb$SX,~f#EAc!tn_rFJR%Hsp]8wEj ]RYCp'5yIArﺉ>8kACE}dAg@ @u&Mp/z(º+݅sz%`}-^HEիں~WDRtp#_tHDmyX-MkZbToeτMx^k3,Ac6UW>eTƉ/LntɣP^Cʖ+LIOnHĊn@s]S#>!s?P8/^3n8Q^ЯBIɪ^9czx<~%u\ۃ4( +t )*c70E=I A$m?#׸ayE& ȿXUG/!<jÙ#oD+lR+.h=Q=5XX\BpLXִv 27(V=H ?*̌^\ T\m[4 Ժ2t@͉Nuz#>/z!K$м E8۴m;a]r]dSuC*L.8bbԻ?ly{CtGJ۳MF8:e rŖ. voR#S͂rڕz &iu4(.DKA& 1SM͜ND8՟S7u2 LZ_dyo92895%bb-Դv0J" ^{ǭˎEbjh|6[)-̥[\%- c!VZPqegO`m@ 8hxM4vgũ;V x@,LȊ>EICçRKE}vlc %L#|^aJgx%^[0o*-ƺPs-[|A=k\bELKDӔh0|@zNFfC "L}qI@ZtǛNx$ 5 QČaDYO ;ʖ2}N.\Vk_^vM*5/C.ޔG3D;kvӷ|0c ПyFn`PTtARìravM 7CA.1otm[ǐ5?@tC$m-4v7i _rz{4#noJKv sk"2z*Ɏg;& NeV3VCW֛Y_Rc k?5WO#o)J-$ @5c-JhwtMSi "h Y/>]`' @J=*H%<J?Vr};iKCEXًͬ!oG^?trJ]p=&Gm]EGqJ Ю^'BuĒ*c)peYҏ)2gRaƜ/^ditR4ש%`(b=uO% eS򳳂nR!@zma"nMNc"1n齉ŝQy}0*-L[<$cUIhhȁ/DQ`q~Laf=C|hmm* r{YJU6xe cϊ-.$rpAr%_< TM$ Edۚ+-m%nIN֚{ 2n}$(ThE4D+J#?5ėDFHe{L(3 zfݞ㫠wۉj \}dJ#(Oꜚ\.}cA媜z ͐`w { ʥj $.cB':l+)J0*mN MBid3,:[̝k!7t/#x:ߊ JP7v!'t^]׵R˟yRa{]aJBl+2[lvR-KP]t8 {h"D-Vy*%':Iv(qweuXTCӑab'+u'ғsxnҤ5q1ZiKQ{$ d[0TӾmG]!A]mjb2Q.?pf`m^"&y4|ybyj?j톉:~jǕgyc<+%Q s, 3퀬z30F{uX̷8!BYc*71hF4̠FMUZkKLqO~) ў12&w8ekL%n.9Mz*!)a~oנ4_ P}yar]g!>XMYyNJ&tXBLcʶ+0V ykD9q(ɝh!KYNbǶq(g~Sim8Z3)>*Ze4n-ưyH}J8LsZWQwI; ˀ3 |?-4 5p;.h2ҟs7ieHk=qNPm䎊QGTڮǏ`v }<yYg wY >4NeDm9K[69BN,s$5:X]Kxi}5Z'ij")6K|}%_SK +~RM \C&4rmV 7 4w@YΓ#bfx[ecJ&&dCC {Tސ(o=2 ''Lczw.Υ2[S~K0^ jJӯ,}Z|KE~rFxfxr 3 +4G1 ]%b~TT߭ }˥dwQ]Ժ֣67"hΦyr"Ł޴_P0݌Ɗs*D,l;%Q\ȔuPOD)&T##$O.|Z 6zyv6Q\ r.2r3oQ4uP@ %ē5+ػ Ϣr{reTOqbӽI&CUH i 8+#PVӍjgƮf,ro]"rJy$*cy3Om|Na 5@u4[iX ԿiW/3bmE lۊ+Xi..!\_MlXnts R]w%Q: zX y]+?T\S@p2ym=2L,I$Z>4/ه3Bǿiқ{磠m&Пꁯݖ=*[5ڋGC\*t*sMBH|W5K7[9}a|}Gɋ#:UDn=eR_5__G;">}YKVFU/k=b~s —]J]䰥=vxnq4Y-d iߑ7ݑkq/Z&*}%M{ކZZ 9 Q ?bbblGt +{H0ģ<&7&Yrr Pyy'V&dk!ȣ} ax14N6/DqHYz/ճL%܈w?[R8%Jc΋3;zFb1=$$36lv,aD=*g~8AL0;#Ng"\1]*Ǥjoĵ4rIb NEЕ$~PO2fY*MG-D? Md~l'ζxxh؀!LT`.Tu걪;[RR5N4ῐȵ@Ľ3j zLm˄iPmoh|m|wp]7x?1/vx[AЂzQhߚSkB!ad#K`L x,]V* r Va6) kŧ3YtJ&wG3qa1UnOIܘO t`76.%ۘa+[ѐpA 4K(8wt] ӷ+x+N/",dE76cf_S# mMӉ#JvEf{kX.촮AȌQ\pȕP3v Tnu F" nSlNȏ!ZSa|/ò'<%P'!{tU*sugO؄=E ӄwx>; ٥s#C@lRp&y%daOU1Pνoӕ{ANg+;'f#{ϐu[/V\rZa9ώ )ߤ9s52ԑԼ-h@G^7VF"QyA$׊ERozrê6\ddHNAEkVucكNN6_\ (To{$O-q¿_k S-d:ȡ,c7V}p)ެ6U)#FMS=9d߁ oxhHQ&]״Wt.P@}}|]:억* 44zlFB\g>+)}z 9ߕqs{ʿ;'171=V^Y OX!RvsP lۣOU;qdue _D5|maOED Gȼ=&͞w!qSr8Xt/v;1]L5s;:߹'jADC¢yEl3@qE.2޾`,>3)ڟl~@TYK/'qcycBek"ze Gr]0/mRšj R $ns6)>Nƴ?"<(qvQmdF9L+uağCWM֮+ "f=Qcȯc0f D 4.>Ft:*8eCݲ5hւT@Z,6C0[C Ji}^;m8~H}{ "!92aP'Xi+ Gг^,.j_~juA<PgM# n\%* l[3^sN0*Medu(qh0<1֪ ް*ze2C20@(b"7rLAZ>3x`I :{dvks VQU h`DM+~r֟+3 C[ꇰPLɓcH=n=hXF Կb؟aΑl¥Z< 0uC$Zxטۏ:JjMaE'J]PyP𗞌nU{4%k݄AdEe`۬nBIZrY~N?oEg("$O.!6R+o'QmO"QMb@7?P]YV ऋȳkBkAX |0ƩDp0[kx/<>-;TZ܋AՐe:v/[)1 c<_01|PB}\ So+ nظNH( ⥠| \+xTױ귋K9:O3Gb+gUIG/mcw\i~g2N]BDv`:l ^-N$|m0Y}n_̑?FO-^JAc-T=[db\3 QU UlDh$^pxpqJb_H_ic>?3oxusT|=+A: vʔQ@_Mrދt ĉ%]!Y¡\,1mjۗdC2i*ͶMi7.)>q S4i1U* R_O Ć;|M%c:,aB|#6]P,5H>4 BRo {ƈ@KKyߐ=:(_;FP`Wu4m!-i6 sR[CPmC[Sλ\1n2Ǥ݆.KqqJ%JCZIݖnJOu{ȟ"6xc=/yվ$@$8|KM",owJ mƤX8 knh ]YP_F@$=] !(4<WvxVs»Mi8oqMW2`Qk'@#p?v_VVZ}V7*Xc~3KNaTz5.qx$'[9gqMU,~n2Yx[bq8lWҌEq7P_fox0&D({X*_džI4_W{&|*N~>Z}рnB1 @a1Qݤ!;PT#nGqMNHdE#"m~k ((zOu!|ץՒ(={V;I6X}0*%I60\$fڼN F.aLwׂBڳ&u`_i,*15ld+AO|0О. f sQ̯`~L0^۠ a&׬g4="$Ai|ЃStp{۶K6ipOTJMZ%M48k9T޲R Q>EF䰁ŝy^R<~箞eA{jȅ]Bi-G}k^:< 'QP&Ϋ)TjZd^Jza,lNsl8cMn=A|ԄG\'+ܶT]gRـ=P @_M]@ĝ~C% 耰"=wWt ƨ vY?a«]Z 1{YMt/Y2e7qR'/zxtN=itFUWhԞW^:6e\\.ZUȩy A&f:֐_y'{q ?&T+֗[l9\1~MsPV%(Y5.ɚ^TOA V VsJ[ڦMOepb- عe«,̆0 =^x]4.>(2h+ (Hk;*L:ab˂LKo%%$PH 8sZߓ6fhL,jVMjDjt (}Fȉw0O8øeG 3$eiJm 0kXn?0qA=_Zp X#28Fu0J^k@)CW,jtfLx« !T-^C+{s@Zu@y Dzļsrfn7I%eNqxI,3ĴIL%MO`2lAaӮ'%xx7X9W7p bt bѠq?Թ=3񼈐EVp ?DW.1bk7)픦"LGiì%/ C.቙O<}' #r\SYlS@51#/M9@^4(#˜<+BD@\-|.W*90C+*6s9..O{H1F wR8Zx翵_)^.c:3> sF9l*2SdwU픾5YI%L4'噋Fl^ηwWhd`5#E`ҫEj> Ν倄Yq^~Hm۸ſp\|Pi؊ZA2GH*i&2x)5tOØZd<8үڠ+AryFT. ;8ljE  Q N9j ы;!>ru *+S`%^,Q 50s餚jo9 4{[e!m't+>[,3b`*JU&J'PR_: *_+]2寤RRUTg)P,ܸwf'춻4C0ե9vf:٠y^# 1>y&ݔBWH R>6]\ُƠuبz}.] [9W͍Y|7;pĆAj0e)&V0 6\XGc#mQ U!&l!tgz*7%HU;r߂Dn"8Z>-VP)!e~kqGhɁ{ xQwּis2_%vלh&ot­F0eIӵ f7oMr F _,obqR"}K; ,B(4IOK'P&&"BdzCָFF^+9g~$"/n¨Jia|*88i e8 'zOqGfsó좚A^+lW/KUULPpWCp=)52$HȾ ?#iS린UkY͜U%.sxa+S3C9`߻VƜj b#Ԕ1T4*t v{OruvՌ |;(6sJIiFV=Ck\2,a^nGr+EYt#R Eduu, mGEe -s0zYZFGC Ұ`7YuEy0tI٘a U-=I]|ťAL4O22 =iD2,^BرR-jQ[d^3\`[dIшt.MS3m ;At5h=}q2 *XBٰ_4 -}fSQg9,jZ6FugRO\%[ї% ^iV,!2~fc򪴍8^΀Q@xmSYj>q%.߀`UZSæT͘N)]#n5l=rՇ TO&BnqeU'7+ ob+KYB86"B4+zhWL7vPf9|Q7dP/ =(҉kN,/;O 8|BTc}L k'cW=Hi0.=_P}r ;~Ew)v! #IEt2mFze=YLBbȭHy;#"swd?dʸx'ӷU#x9RD`\b1hr՘_RrQ`L_spDI\Gd ,Dyc[gtl%$˙3XlSsjEB7B)B[;k!gHTTb9UZrx WPMG잠1]H,R^X9|A"WUfy)2˯7F~kLWo:?#9m?s/2bLa=e^_wu5 %{ mٜC3ri#lIQ ٫;}kNd1ib(1pK9hL?lr]Ih QnUv+}|k@ ZЉX] ǧRf?W)PPϼ%Z@3ɡv<~tNڼuFH2OOܶ@X4"}gh#O&SͼhsVp?| HLJF[%4_2EEРe!>8It9FTj.t-rh&LFV !c] SE?Lg1NM8x ǦY?D @{`)9:{GOכߕ2. Mǂiz+Pz%X60v}2gתjR2?LTosB?Z5v8܌r`qĬTw "CmFu 4|]k,"pdo}K r*N5Ql/ NALޜƏ9IN{%Y9HzaU ZS{3v+*f?tЗM5ftt%%bãoe}xazAQe5~^lTppHAir))?=m򵗢1^x;K+1,UfJ̕xfߵUdGZ,a&4[`,~&řқZpIXy38Zt ߨ2UwE)cYo[زmH!aCU֐6>ち *o/Z*ˀ@RS$#eĨPa }FW2@'فU\5ai3;_>H䀩;٨e|x`tx6K,<">!۔_p\s6 gytl!UbZ,%Bb$ K转P^Jp!>k3r Ek.8tJ-$#.m#MH3w>wKG4,"D3zϐy*d&H:z;GK50K;2 E'Lh2RnI*(c]Q x#͒?Ptjqyo}z ?D:VQ', *511PJpIwTM0hPٮJ25c ygC}c&.ۄ11-̤4k W%0NAw'Nm gK[uT+" Nd8#ĕ.XNj8q_O,|zjʟ6NuE zǭ#%2\i K}O@D | *ܱz$ 1jPy6/{hJt7|껮.Z"JHm)O]e0> MQe3 eEW1Za]~Ȼ`2|ŝ WwGֻ,Ag Gxu z,k5/07Ѫ` 7vZz;x/Y߶$_0H7jkI e3a?= i(*;hno(NcB4,֏CPE Thl l/Nj<*S@jvRPղ|C z{S? ("Wpq;zmq!5؄4m?.Vn6]ِXz1[o̵~+AU d5UX !k4i2=G)`wϺl&qJ5$.jHR BDI:abǶ+n"Jpup(OR\TBz3+-,9p7 {y=C%׮ m:+HM_YۈJ,(%(tJDJ(+7)4Kk&Fs _5gF`)!#Թ}IiK0V0o C _u|3Q򝫠qL̷:Wb@Gc:V1ϮLzyM>c% ,˖6v6=Xz{0>@(bQp5LbzC^yutΝM8`/:R@k^'+˼8AF* Ql \G6꣏Z*+:4T ݐp_S _ n}q:~ުiJfX|N6P_b!hO0T!I i/B$jUKd}PZţ`+\z[dIZd+S$Yy^CMb M E$L:K@${2cC(?2Af`}WwF2 ?@8I0Xc"\h-jk0@mꁚWZ9%tN!8e%uKJ*M I%yFǶh(:*VƯ* s"'RoX;kf#r`Z7{Kn_ !c҉Qoq%`?7_fJ#euoX$ j&Y4Lc1RM7:̆yRG!ɠkb;Z'hsBQ :GA5r4z5kzc pp8P?t :Ln^1 u4 :S+.uxHpZdw1Mi-Il`}',ݴ(xzReZGJ޸hfTSm :yȓ4vV\쀐7Po>=2И¡ݝPb00K\J. '/^eP7gaO.*x9/-tﰸ0 U#~q'7.5 ]mUr"nj{^e4ՙY\#Gӄ4k*_zۿN8фP 5}4r5GJS zf-7xurO]cvC"izN/XΜ@Q9/nzrabJeM[cb ̡뼀̸C{Ϲ1d)jSYJr˝$ܞcE%g?q}9! @%͆9]@Ʌ5k~[2w@LK'mQoZM3,᏾;2ibGҒF"99+gq}x-VY\jR]`;E:(x|sG#*r)5u{Ͽj׷:A~7+/5\3"騃%$:ǿ<[f۝V7#UV!PgTlވus76?zwwfWY!&KP"Vqe{Q2ޒq)'U(d$ 6O/%]^)v=i/% 9|xaxPjLj|ӎR^qym/71~=~ FFss;"jb@*f+x&pL# r78XTKn6J8o8~*P:/$l;+*J9wQw`ɔAqInjQ]w} Es޾K~I᭚XYx6@ΓkeaBP9vIZ[D 7Tn]r=C$R%L$HQW.$0]TM> ZF{cd޼j f3߼_X,\S'A`';|׮ʠ2{tcC *mn4L YpEcv ½AJ>0?DG 1`N'ON)c%E f4=bZ5V4L~WY~g,gŚ勳GYŮ aG9 ze}I4nNo<9n$sMyS޸zU,5;>Dş;8\(P2VG4`9zx!]^}RO N˴|a:' rW_Tw(IZ]Jq@'`c;{C>Na{%)!<"]X#XoG\h( 8;Y/ 8~f"*cДu |Mh̳EM~3Tޏo:-bW9T ISGq2H<[">kr9To%ZFOhVCSQAgJ˹P늰0Gͣx[u%˻>4~z"_0 )ez([e {WI'TBsAkZ`&vit PtsSoXRq-m>iRkh?D=8xIW6vOnxG2VOg|j~;|fc/1r%JRw~, )*@5쪎" p8Gv'yN hn aLͻER|b&!_^Q wQFЯZZ :^۹ 뺅vnql,yt9|j`4 ;Ժ KZZL}CJ`t9.;E?*9Z;QK;9X~:[yK 6I~Sp7s͌Ć+aEA} Kr6uآT4U64t*ܿxŅrTizIxS.W.rS"=A6}F4쏠6֖5Tl~Pw'F3˨4]yQDE)E*IH٫Nlm&+7*'% ʘƀ&R+[E==8@c99}*t7!y9A_3=.+RS| 0$>{H 2E 0 -N\Afp~ҾB~x1 Dts[K IlH +<뻃.'s^Jy=_)߈8Fʚ*~C4vVhD2C%يR7=A(U:iAhy If A?x`2O&}wtI@M?lMY 'g @ W' 6'IZr9[&ǥ߳>x0޸mDz+^Όӱ? .zW> ŽIu϶kOaӰڼuzws[:wD 6FJCs>q'ARz;q13>6xAPuVEYj'j\I}?#$NV~@,-N.g(:Ƴج5RW3]HͻFA <@1v#eV։+?ITvkwȃV[WұP__j1j+Bǀ5 [R#MߓFr/_a;@~khzT퐩z9.r}\NjJJ[ Gaӳv^2I|vk,dw`L|m;xPEzD``NA|#3de\T;Ec,6o$k>$D&Fϐ:M8d afR}=߈:v.EDK1oE޺+U^SBŏXB"o`?bd.&qP_i-.5ˍ3\ޛ,zM(cYȭmplMvZ`kC [79L;-l7v3:REwD8:ENSpX\HY@2ζ[Ġ) !\ђqG&d=i wf/B8[S;pcfxGyM Ox& F ~\wp0P>G[n"yrPej[ޢSp7 yTحeݲsllݳyE7BP!:ȷf>fѭ},9iAbsr>#J~n3ZtSm"5ڛ(G{OS{جfCs/k\_6x6ʌ`Wܔn`72Ɋُ,f.DH%gާ:PNJxay뺲iԈľe3=-C^kJXݵi@o>'MGLl @jU+V`5~2я$a?Vx^*`nlGP7Q8OWSᯩbʛ5sl3$!Ɏ9ZHѵ%wE$AUvSb:u{2?3i5L  {re@^e@E)/Y7ŠgQz@ lg C}jX ('mC7X?{"6㫭ݨgY9̰ܟ !IqY|zZeDɈ+M:_țYT͖(]6F^ks.y.Kh^Lt ^`I:c?#}0 fEf8աwZ>υ:Z(pW閿˔]'|qV2?b8;3( ͑ ^o}|R-<5z롓(+&_L9A'g8r "#igT2c˭jcgfbdaG%\蛻ȄDA8Ő*p,o&|<rwD2XM=~3[jЃ[%d.# 4x( ^69Gݬ^MȈukݐA{ ՛Tf7LC̈́4=Du$N EZ@؍{ QgV!?t?akJm,r@{F]+{ h٠,HZ.tс79}ZQ - vN+L䈩W`=q&X9 +lGz*AYqfE i|+"~Zdϡh@w+Xa kE:ݞAܘ(N`OJH>1Hzyiʁ IU{7@d=CNXC,Ag $t~D.܀{SM?$8yAsS.m*Ypݳ}< #&w.F] 0%a=1wL0mtlj/ ?0'H Îdʺᩧp9, /LKJr{C8/2٨ MQr وF|7WLC~i8N|<]nR'I#~#8#3;rinPY!5=2ybQVuw~|nRN6!t79zD[WdL12pG60oL 1U1<ЄR_2LKtI?5S]֙G2ªeYjjvU7:$13¬ n/ڍ}D6s0>naa⁍,.8Z=vsin&aО.Vr pNӺ@{橮fe>ɀHؤ:6WkDE Õg I% P`Axӫw4s>GNEHP~qq`?N2W Tj1rJ,vSB`}g교forEyկ[q4SFmɝ'[OYFD30 zbR*"MXC -/JՒ%]QSO)9FG(#Ls#?Œ eϫN8[߶s_,̀USl LDk/4x'yk_ e+uG+Pl K^E5fC9n"K 38* Y0'a3aQdU/|U|<i,j[e@]qW `r{Fr EY?:d6\lf$Jk+ήԑa?7b B4Tي纍bXiS$T힃f>,|s&4VctS)ZOt2puC8hdI}:ghz L>@:ϐ1>evѝfڳ,q%I@:K" ƖA_<įaqȡu.=UU@H Ls&7{_|q2h9KtMtn%e-U '(-̣ϷOL4Wb}bɃɽẒW7V]U -nJa4H$q=䘥ƅ-Mg-#yBd=^9g;lZ~%?!@(qrt ?IEOiB6fWRծȰɨL_)1f -Wo9gp=$2Цч1 ! Ec4Py$[s^tOv jV9 loC/mju[[ou}̻}ioܐy2 bLWurVU'кG7Owyz1AeA4Bx|ˊ9l_$=h%9}Jg׍*=j`{/0o(ۈ߽,F8c~h73vw'B!u떖SX`(:d\NTUC#qVҥ@/[yͰ׻!~:))#w~7-5:)V~^/`7oPҥHZ p:(A:\yT԰QlD 9ֆ Ǔ;"xu%-_<rS_l-#'UX,Jgɤ1\nn^`34% ^xlgȨ~Jz`:ǦUOf"v.[dx&W-YI-ЧXhzψl '&o_*PRAN%ō/E9sCOQGWm4 _8~^__Xc?I6d>C[ Yb[u&K({Lzđp2>'V5,Fw*rO,B( /i/MqQn_Jζp_̏s^{!{ܙ}W$ ~ҸO;Nc1uqq{WXur ]MuJ)+G? ܜ#w>ƙ(ON~#"?XEO1,3Z iwDq  !Uy7T(r֊tjo{$B"64'gYJZu$FF _&D&H 3߂~"0=w !X< 6x4_ *ԛ]:Q^UtOz _`ŰQl|>Yʼ(G°T\­;| O=B3ax#~LFdXshN$I$KR5R!@fla{Hj >ꗤs牝]KE_+7.<۹$W \(B6Iu j"@WqDbx6/d&TmMmo{_J z]7傡_QZ*>+1w ^`lj}F^<θ>,i̥cE_4p_"?)YEghdl7B%]Dr22(DB7J5!F 4DgL<շ9.jw)1ȉe0f l(8*fil~.ŅQAтQ, B!d, YvM<l MC!>L<5HLUxZ5՘*֎N=^V[ K9;,JD"\:PE'_=?ٷшA@vyUi`V@w1ms5 |9_J@E̸OPG"8ތ/e'5OCqVOu]B6ޑ2 abۡYLlƧcN1)x=9kF{˄4ŞZonxRqd V49KD[9&.'6g6#.X LO^_$lS#^a%o}LQGwk|vTT3n0ؐuY7y@I>q>?ITVF!wd}Aڄ|@ N}#%-m_nC<< D}͊$o1bYhfD.Ok29Q'^l7iD4[YNI?1uR]A=`{:L;]O{d&\N^уܲœdR5X0 p ^q(_STrI4.qd1B>s|`\3,G Z( ۭ`\GpK6"LOv%$jUi3kA!mchJx{&\CL=xC˼> 1 y[~MBfzʓs(3jˈ * b >eM⌷ CIŻF }JYro͊|@'l^GR: O6n/ҝ[BN8FJ%~CgyƀPN""F6d8R!\Ū\Y:\DK{Q1 $ċSt,Ǘ5i,FpNE243_/^2rvz OydAg\iP?k{E",ֈ]V!+>?oW3j}I{7aRlj"#hfVagjPFOіSboOѮ"W3ҫre^19LKN=}Tv,?L`=)\ j\ٻ_Bœ!-1NfI-N'VYEMv+<[$RD-5)=,FE{ fESTBS1/EOB 3^X 3i|P%)W ̎0ەt2; ;CJYަwkXM'=< 3Hj80-A҅Ŝ Sչy !AƮB=Ĉy׽Gc wJn<t%r #2bSULV 6=hn!h%(}&bTBya0 h @F>Rݢ ݼlF0)m$퐉PghvhhS =(AmrYF$Q2b0Lz }n(l#NaٔPHYGYϗm-Pvz' 6v~ILopQjXv޺"(Vlz8Tm@v$R!Zزp0) .#p~U&"w&Q-l<;E9;1\ujVz 7ǟW\6 fzT[20ftQ!+ިmISʗ ؂~ѵMŨglccj6&hk_Y,LʷPa;- 2̀/u1V ng,9Y.m%,2S*_H[[{(ԤQ&Kc>QFFk}O N4ʕPHZqS4t5TU Od|P&GTLo"CzkkcK⾣dC>ʗ$rR:>Zq͘{Z~}>e>,K͂M3r3\@| 1_ډ$v=KG2A+P=eęQU`nXEV]s-q-z88t!NHaF1 $:9ӎlU\gYu(`$Vrn2/oAd= 6/}YWѕ<~yy/7w,0ЉAY)kt ƴJ]GGyPL?̪.7D#lFB\hFZ%A@ҵh&%p tq | ۞wV^a9Ts$%@!x(;-܇sXLثg!3v`"ƀdGNøe3.#e?RSp8Fi牿=\*]кX ̉G-! b5^ W-G&(ϾEΜAIŬx.@ړE[zWVZ@qW6f8%Nj!#0}n=m  n}vW*s8 S>\|6^.6MN&Sg( [m,GAdAy?c;]s+iy!EyH]ErfQq`.[ՂO Pg8h 7}շwb5H6I|ydb"? <2@[C: { V: p2uK곺Z)MndÈ0K1P^eE*/ɒD8:1%4z^,V2!\?qS9TXNXδly0FGxr_Ėp.:jNf.{+DPTh sXZ5eUŇU220SQc[cP&_yлЕHE>rp6l V](fA d}0L?hbr1 $SWlB -+oP\ޢ1!!bl +&)! ~)1K3e[`j(/g)0աN *#CƎ731 z-ցs!SNeƏ׉lsLU dЁ#MqXruтYi ծXz=04}~txF{>BۼnOY g&Z"i:&>:eҷ ܎_lĴQ=DY9zSa-ԉןz&MXRut3SQ79}/O0Xf2:۔.p VN 9CwOE#5<{ eU@&nF9<Áۧ:ꂣ1B# k.sH?}➛ ^ufkk~+@7wp}jiᆉ2'nY,'%0'}5'VoYD忏\B#/U]F6)\뺦\{0pN.+ F>HWSdYgkIQ mg6^y4T2 I_A/@U5kVA̼H;#}VH#KW>) Mj;"=Zޛ<ݽ0cD<_΃r_~rk8~QwIAћlc@-—In1fzv߲0^-b'ӥRAse5fkr8Qe< #*|aU!㗐V=l^ͱOj/ܩ)pu#G3YAvmnjCof\m _N""!!~G{ y`{Fˮ6fXFh'Nb.sFv=" YQ֞Wb@OrX:CH㹇<RfgC \zݾyy7 2y' Fr% j'0mT532Ӿ>rtjeݾQ]6 * "+4 / v.H7o7ֵ8 $8q"k)LM==(*yCMMo~!UKr8`Gw:ve4i3X0 Sʬoޯ42 .VʷZ[+>#YmdY"^HMA-/NmP\v? >Y+L{1U csшEvڝ7yV_5;W-}zH cN{?CUfuKrw;nVB-ޓVޯ򫜁2j}cUI&Wy D|oR`we1zP!a&lPkL=mIwpƹwGId-:h|(.t!۞HL.ȡ<ާ15X=6絼A|^O@pdgT3 H~w$a*UNWKED|ZxgJ^iV0}d0xyMMpe}YK i)"^QP9xrå8,.8: ZD{XYunXҶml˵ٞ pL^ ,Qo JALM NCi̵V2Il v,s)w<=:dxemIt\1E:NOٚi&E ¶ʽw}}XJJK3IˊRh0̃ = ] S{З4C$#`|Lï~qG29:e;`oq14-Dkii&~|QwH#t_phv<(tf`MJnmJ١dHͣmJTXMjARO(vFN}~%Ѧs@S)ew53ӃQQuUB&`l1wsw/!eSB@d?ݛo{I k.X'Y ApRDE˛фZNJԯ"OS)Hu(3syiYp# 'wUӍ7}1m%dr}s(܃Uo/_9ԁor0ܮ9Tr"m|w?+| z,"{~Ub|GBEMP=GlrZ҅ggq,7]-J{!a}Bw[=&\'sZ~īT/I㡬.G%~":ej2H} oAwܞKܕ{dhxl8L՚ؒ=T\P )pX ɒ"jbr,+wNR(UL>wFaϒ;s H4+eTfY8F| Z-@ 2-ƤHF21`+/C߮fSˊ]s [*[nD`l'q7+z5EGTߕk|1+SE,@,e=1l8H@YĒ5VSm7昳(tyܸb]eL_쌛tIȜ].)է3)˝;$2yY0suEDa%0=IEuad5SdM+?2Y*U oݫ&c|wb"?9: Rml/wۑ F[hNcܬ) pPnK*՞QlNEg{u?54wi)¦nz ȸn <0|ζ|[!vm7+drl̶X0/O@kdZyhI "AoZG3Fj'.ik^6q<15'wF}z<*uǞ6u7r~Ko_n>09:1/ۓ>C&'V˥bV~K&9QfHVSm]bVS9Wݴ/^,DiO|TN\dU?GKA ՜8JH_vLC@҃p-@<](P"Ij{lp%a>Nll2O[%sRþe>KUG7Kfω}'ߣC&Ԃ76 !$7IOSb &3VlȁNq{qJ]vӊ"L&gU %]<&(r@MU;`VkЮ=a%McV@u?G$2$̉gsyF qvh羃G8Z]'X5&L.읪[2BxN]UyG[)5H!]sS[ ꮏ+'kT~}1bQG>>PEU~-A;ӻ+E;l$ج:qBߕߧi 6Q}2>3Ir+nZRPz敾b/GDD٥7E aG5 n[<₄IX!Нrmg ʣeK?c0iU@6.qԍƙtB&zU떸P=TyɅpt3^locQAe[R[IŐՅUm.ԯf% MT6Ԛ̘!~'=  V[H|Yd"nNɋ^}s#0l7{T?kO53NnJcj;Kiw6vB.$R9Uip">j>$V;wOe/,#v1%ߵ# p+QBڦֺ޿9sRchՀ!!0 `  LQri,n_| LwOȴW~G Ajۢ J JDG_Vvr4@o ;wpDo:O&ܯnU#K+"_їj̢>2{to@n9wyK9}a0wh/[T=_ZyBuv^qm`htmȌA50˱tC.Y-*֓L0TVnĩdqJA$iiB6PPyt7y2NXv4# &TM33D.fZa+kP P}J:+k;h0ݿBr1{UiȤtf?]hF}Du:&֬滸o"=aҔ40E3VSْZ#2yV؀(ۭ[\]%Mr&\BPOtv'h,Bnc %f-sIpqpPwg#m^4BnR\(A{@WGn?[-qQ9"u s뇕`xcX_FM5d޺nȻorΠ=tM,ɓ& )hĐH68vITp@6](#+j se;VrpJMʍƯ=fcdJ g^'*FM ï]e*KwrYřcȫҜIb}h|—*p,9 }]# &ep} xr ܯUC3 hN&R&ߟ94g $ lzk7UJUR5m+S7u[iJ|ݽf aqw EղE/8x!Rw8Q Fq:tB [%DXfIgO3Giֱ ;NBL*<ɾȻ C]裳EAWbR@|xZf||yN^W> o#\0"[?uWkVR 2QcY.,IO^]>@^XYFTZjG1l0l.|Q9>uӉGU^9J~oJ[cjF(c,}ˍwM8ٿ )fe#f(B6_22ڰBgNU,TvGl~ڗMY,-HW GLbcEK"8ȏ˦)e:Ͽegd-c;sP^(5(M(̪)U|L^t'ۥEj;( | vwceY 4ͻ]YXJ3Lbw z݇C| (1xh߲irԨ}1 xJh>Rh2˿IPu0P ~]&K-<=O9f]i:X9mQB 0/ M(5) qe[[V cr[nΣ5.&>wp$+RؖP^8i+67TjzD'@*Au.t,Vm;Pi]!RDqN2 x4]WZ!hHQMAD,й|H#\u hk$c)/M-bBisa\p2MKRr`yXm,Þ³gw- /[E'dMpޤAĊV'"}Ð>1ڜ{r 41cl4 1ƍnS8;yEM*&_mNzj̸́CN]ɝd<} }} Ұ|W./`:8h>-w(5\x`œvoҾ۶F Q oPB箪3'_qe3[W.*Rtg3AWMoWigg0A҃4v2e]1r{G*oL9N22!+ҏ^Fn j8C F֎<$^ѩ۞Ich)ibbefmbXOY^ג= \_ytۓK$OdGG L.|0SFc*F'dQ)#=ZeWAV g-յhiٵ/A&Y<:(@>?݇^M)hQr*뀀s ݁yae^{LO(ajL&Ŕ?ۥ SC":]IDβ!!s zרl-fͿۘDʘWV  k;ZUuA38kBx fq ڦ[]ɣz@Ks,(pT_#9;3n7KHM.\9k>n38M"0$"P;UB 77; |5G!-r( &yS]gpU6;-H%ոy6Pz҉nZ2He]B_mGwOO@Q;N]aiƶ`,ȃ-g2'b-WH`{\TryM =X1xH,HmY\UѠ=]APPA5<8$u@r h\A$~5~ih ,ܼӌD0J 4gz`5ǿT_5m Bœ#tw[tTP7{18)$. /zC[U.,hDF@ZչX,N4ϊ#boXWVP͙#s#zW(')mӯ%Cxzs)Q-?(m1spF^Ԋ=-j٨SH2 {tYL~g}9m-[U|v:0vǍ(xat*Pӊ IU qH oO=RVqH~ <NXxjKؤ!L.[j:WD(#wr]B7_gk ְEyfD`RY~W;z~hnhU0f/΃=_Ӕn3I#i6<;|?NUKw (NhGy\J1 c~| Gؕ{i7|^HW'$u/6s[B Uinpn[Bv_3\|p{N2P%`h܈i=obgf˿Vu=kjg룻^у*M6;2LV%T%Cv:b#!9z.eh9:e8)IES| @Py9kظxq!$?S_[)G+a*3'"v;TX!RЅ_bhsl+T Y+yfvH6ہᾫ"ބ׃'Ʌ I2d Ql(L S~#w}ĒuN8:jQ Wˮ _܅G~Ntq-zBmy1MSu| zK ŽNbUtV$QTP9F'nDKBk԰ݎ_1[O^^¹A!\ge~8fbuB˭4F9ڰkҸF`EQjY !Jay!Yڏq/6<(`Tl 's3tɴA*/r-lߞ1yYm~C3y/ FO8]WPȞРtTvBhMuES S ΩJ%F& `@ 8; Fv)w}a1y^'wʘciT9 H=q[,vq"U=`Β/ *Mʒ)Hc"T#LA\1"پzR0Y%l{P&WϲPHW!K`˽렦V~%:#W:Q>yv؄rU+ˈ#D7^ v;j] 'PB~̀ @8XGFC"^q #qth .z ]CMYC]6Z (RRѼvTbs=dNZ$U !Fm))IbDžqw5^؛cgE n7:' &X|B}Xh PlEl,8SM F.5괓ٚE߈aV(CNm-Pa&#k% Z7Ոt eko?D$ߙ[ u^Kll"@cp聦SZQb CuI}Чy !8 ZZif(tH ,/ e\6tF5d7yC3j`',Z_@_F֑ApZ5- a3Co]RV#K +pc)<)*顟9/L:E+:áن{czLޝ(m HQor8KW$yL*~Ǻҧ87MQGfKr^§񽀗s Ye~4F;m܀(ǐr{Xj9ۇ+3;\>/~lOFQ> *)>~['(긗1c$ nXqtKuL;GRi=LE }<ӕ*` hhx#|5Q<&P]a;شlWPSŷOM)(TRSz [訮]$flؕ+6r?;_<|CeoCɿ'տ1R[{c|(YAe,x;*kv̔kC'Ʌ󔥭`o".8 p2#aphumL"W݆W-:L''〱B$ ȯ*Uٳj7q[K .=i"JYŶV-{UF.i#[ΊC Xjs ];)m&ƽrNpyϏ62&,et/R\6㱅l?N2, -af7j+^QDD(:{ .K<(ewZ(1 B$羄[ly0]"@oO3L3K:Qt vCoA5_;[m+/4JހݬBAAq1"&ZdqktږNS߯ ^?VųhAIaU.u 0Xu~~cIF66<>ikhTPܘǭ%5-6rx1n954cf;TTý^kJ<[)l- C 9!n ,C%$Z;S X18 J, =  ?ӛĮl$<\]lCEszh gqCpTVj"0M#1 l-yR3̔9@²'7ʰ\%8/Ea2^_ 3ѺfEkFEV75_Zg_.Ok]'ix;28(^DZzNοV1;GC*~ (w,UiZ^zmq78ߦX vP0 5Zdimn2!6+=6 iz YR vqi3BĨW3IB@KM<悱+H -̥%~Ap;)sMC607'Z}ebw!qHʱ8l#+B1Т{2 3UL\>+$&tYk< &]MqH<"!DT;x% k։\ :̀(EVcELɭ퍌\Z$$v2><28i.S4rN|9KMƺLF\^@ז(T ADswCai>1c1\gu<y6t~ Q*a(M^,#L ڢ I(8f%8 IDVY'lOo-mϛ J`?/-%fǤQ(hx=EDZ~R!JMϻڦ#A-)^-?nvw^rsJkm^d2,ѝE4' T, T#8L1ľT^m ћ昂dEs|tJێ/dS |Y2%Dj3=F3NV31ŀ:H3#F|7Hv!7 E` w/gÜt& ?7P QE&yUUyg$Q$c֠luA] Ux moBd/?= 0 8 հ*]3A}XZKAn-I˙ P5=.E=RD8'a=P}q4h v|lz&e-{!5W}A@An9ahFmNpfG~zNPDTb nY ).&%~Oӫ ;0pas TX76 1E.3m+)N ?&\_ʲi"z+ Ă/N$ > kFv̼ 3x]A}cK[;"58-2 vcw{.o\D,j62!y 3oz%rF1"H0M.J{dA1VM r޿qMS,y`OYIԊǒ|sr:lxj8%\e5Ly{liYnq9,y7 ,es%,cȝk4y[4)Դ2"1Vѕ҂Cr < ^yAAEYL<  IYȢ Ʒ:W;)xW `zZ4}Ѩ. QX!f\ }uvP2fls1w*Q .;|^ĺ_ ^W-zݫX2`ļcT#e)*Mb΅5\)3;E63O0а^WzD;?tD /h⢯eƓ9A{y9&[./}sU~$N]C&nz mz%==3|䙈:/U؆1[*C ;Vo堹<>=<~姻B(ӫO@r .D @k?1شE5%W v)L񈛄&ʏp._be6'8hJx!~*̑LS+G~NgaǿZS?w5?m)|qH#9YyB_/\&v/Gw[ct}ٹ]t֛g:z1eZx%TU)D=fkGSJ8sA2FWM7)Pa jQV;mM,cvFC0*=m6\30gC=)wK9i#Zb((Jb.SutG9>^ !fEז藮ٳXPh߱CgTI8⴪oB\.%[ {&잇X -u,6\aV+sY# LVeY>jal@KH z_%3??u26zxܩ;v[@D?1(xaNȂe,c`umő"ꎾ9r1gJv Y1V_# j}~Nfw7G?P@jt?U_ld2D&?'<3:d{p93Te+@u Ł!y&{撓j<2>l}A+9l>2!䮧WhAJ8 ]A^1@1_&e4G]%SQf Ԁ;[:B>o\T"qߜ;=^Q>~,k~VxbA,ȵqQ̶)A'>:?NvWhJ眽W*~<,Ebnm.`6ٔߣvb*<;z`>@aYsܽ &؋N ߡq%5hj´$}і祼o]w-Kȗi=)i1/U["e,d=u;q+9S+j3<#bάRF\erɉL-P{&7cg2I~DPu0zwmʉkTB^eW& vF5/Cef\WꝌ *FF?#Pu^VBL'tgAr9ZJSha;s@k}{m |=m(n 9ӺXE2:Im:_ZN.P1K9|U^9nD^d @]ᢥ;6pC{dߜ\ jc3`a=Uca:֐`P ̩]7m)@W ~ue'^e:y_S?߷/z ^7QSc?FgLe CHSbܳ_gg~zwo]>cIw{Jya.KAKcD>$QPu=L:ZerP*sldl[b$~|WCR#ڭ>!ف.\$ӿiYēf1p'ɱx脘M}mr[T _U,Nlhn0 c,}S 4b6!kstoC/MS|Q}_XnD.pr$faʂ$bF!kKEu'.xuO:̩NM<,!A"\iX+qťDFI%r-YzzwIR6$on>5A {z}a}ϸ.RX&>0'm`T8;kYz.i0gb3$bcs%Mcƞa\\p(?/n;cje>%Hz9UFb;Y jc?4Ic8 .̤6Ic;MUcnS~~#ř>G$il #8ݭAU9Etɚc{cއ%Vʫ ِ =T3 -!g*rIݽZXUQp&AXÏ2wMǦa4e+ߧ֨_fw*m2&OmI׻uuo!GA) Y(8}65yJ>x[|Ye1jY@nÀ1[-?L[|mn4,胒B)4梦]g~\5J`%9-.ʡRMe12Dmə_ o}tV RMnIct81=b콀1{m9guo (Brܶ=f/A; rk@vT;p̑NLl2aZ$w'[M=3B/X_~O旼Z‚#>ep _Q+q DH]ET~]Q͐ZVaÇT& \oe{#?}sx>~8˃ʃ'a2odž=sJ dXTFpʟ +wcbvP2߲̱7k=PaquyCK)bڬOCϩT+NH>bUkaqrz~kh F'"+eJF՝6Fp[Sxg-^``&[6@fbex/3 l!٤QI`#61brM G-N9P\lq К[^n8l<ȧke+7tфD4jyJ, ̟}a/hqJsG5Mi--0?}}7 !(@14pΡ$f?vb*|b!tB^ pZ5g٘[!hN3I]Z<+ fR[fcjh+:m3Qu?]v2 bC23ܹovPi/̘<9xht4YpM]٦ާkHJ7Jgm `3EixLTR_$E8VUZ-Ax:6+|'3(qCb8DIpNMf9a\p@+d(y Y;͕fYӁƉҙpu[dCȞ@.%_$:8R%n1[LI5)}f>@=,(\MtGT?uW BO/&ݽYoaꮚ[^su>:ÂPdQd!u>2) \0v5 X$i"%37hUac)&8Z2?iIu31$ڵ&_8a%R +Utjԛ`4^ߖ9=}4Σ/s5!US;(qu '13^G-SQQ\`YvRW.YU|BvҠI\c16: %1A2oj޴`wp`t$4e"hAD ?`FroG}oCrI/9ΔwkY t䭙 H}RPgPO`xșfFfV oև&)6|Im8ۛT6B JvCG[Ӊaƚ}`إC+oNa3zcQxkS&? QB:x fHB ,WߖγUghGɾzYhM`ڢ .Hۻ= ILְ/Fb:ZGA2S* rť1{e"ؚ-=Ya GTȴq$>:@gvj0I"""0Q(|\ cWDȻF*:βeAcM]&ǴrіZt,D c JW!嚻B7`=*>@E/zj;,`SF|ÏӲp|1n5>LxsF7'=Zy oJVjJIXWqu!#dW W<2<~&>jN^/.NjhC+2L.zQ0/5r^Ñ>#K\#6JzʓBz]av'{Yz4T3|Nk9P a y}TZJ8J.e<>]{@i}c__*Y.@-Y%ކ2i) g#ȡه$5td \Qțn`0;Tfmyy-A =tr ?)dhN߶M;Gd{#f#$NL>ΉO@j?tlV_I((WA j)䅩k]F{T(oʠ+Lez0%bEfavf&Rdq9˵=CTNx&\= k᝻0e;*N1E{FbF 5ackUf)d{V78\@*Z#Es='a 鳼ktܓ|G@$3{| ڷW%pk1H4gk[K 2dzNxP:!hp &o$ĻUwt+j#3:Fv*;́WmH갢eXI[幾i/+b͋AV'˲jV}8І #aǡ--Hh+4 ʯ=ozVM>Zd-(fū;M=#ޞs0(Ηd5\NO$zwErRwQSN 6ֈհ` 7jCe\m YBD/M.n*^~C 9?sͮ0Z?y3Z;4:B|9j'RB 'uZ<Ԧ~?EWrZP]u؊z!.cbTwi%:jH dx9l-?,=\cT^4Nhg A3ZH\Y_:ǖY#JQD7T\?-6.k?md5?T9w\pKTWiFCWqFgl %9`Ft,'1ү`iס- &:Y-@]='B|y8hd(WYӣGlM:c`;kk>WfWkM^6@t 5"4Ih5wi&*G]FFNȲn^ekH[~: 3ylx/α꥾, NYdaS)+v Si71N6wqJ욠K;Fh_Fg &&ph1a^WfHY&qE'}; ,`I j#NτI>N̜;a|=|>~$?^ }k$a gߩ**M!qWVU!Zڊ-R&`a#eKo?K<,j-:wŬj F=U'\5BW۰GA+MFkf 7;2` BA5EO+U\{tKj@*{- ۃށ:˓*w#w KŴ==[m~!Qv߅2sIWp^=y+4əL*&w(U@Bh៧M!jF|Yv( ϭS{X*}0za^C5m7%cf"s6sY B[ pZnԁ=vOMGF276;U9Y6f[i=Jq3h7EBOPZtLb'\bH/3(6e4I<3WؼRyUXnߚ VE(6:{)ψ;sQ:kRpl'={Ǩ֧܁c*A-ķG?!_uz`>UUCDOW.Ar %Ղ%H Y(w2d]Oԁ .TvY\h7ĸ4JWX}* 2o0֩UBDqc7L@ޤtL&"ۼO8F^d #w4n<%t@1UO@zUJJe_7_f8kk*5oJwj&G7kmWq OA^tֵ6i]o&pIZn.Uyuz\&L,ȋn|,'tQ31q;J=0[{MB^b l"_d@b-FǐMq/M1HDudr.@gt,5VfO2<[3D9  eZ*BJ (e6G-i+lۄ .]캑G\6ĝ7󡏡3V"5,SD[|z\=F9D,TIXuipJED> ~~be\3SIړĂ{a1MlT0HoɐАsI:X}0uח0ٲBjGƉ^ȓ8 l;<ΩČ[2Zk-.;fuNt5v嚹sQ*Qc]j1K4z!j\nSȠ;b["4E v1χ]F CnT-0zXzF#3r[['>ecWHBچOo*R[6Z)7%s"?6~'2(R^S,8_g %J3Wܤ\aOn?*G(sa.! c7']>N WvZdjY FDKp 4Qq ?""l1I( S<3 ʩqAA a'ә"Ͽ&XiTK`Y;eC1ܑrmz-(ET&xj>E72TS)$A즼=̭M:qբ|bU2o7D $Q@N@&f9R,FFnɽe rF4x4Rq#:fdD_L25 |,7=Gf:#AwZ[4aW:n},Y)RY (gMKuVdȕ:?) ,bX&EM-VEH &Sgg=\gɵym-G nBûOroq;+p 0훶9~"F( h_ok6~u[:9 czTu? #Vr3*Tg'utFaKbghxz nL@_>'A^ <"_ݓzC1<T!F!n>/c&aqDkH,>\D-:JhG#ww޶ҫ;%rL-,`KV>?lo/:ժQRP2$1/;]%7=1q %Q_E_ o~bYZ}r;zG"s3tCc6U2#9B3d5=7I1P[?`\;`i/T^] 16tl;bF;pݱv|"$h/XZ}9ǖ!{KԵe9ȳ6㽓%(U^.[o M׼U'ݥ=MmRS@a7\_iF+?T2`Rw{ m!t3dR5ĕS -+Y,lmqp+  CZCVpT(Mi[ `N`x=*(Q-SgIL(!fUг#=˗oX /OBF_`j:@[a`<|)M%][],<:gkwøBj_ b\~SH?} IbO{B%kgB`ٲ "ek=MN&ao{fQr.Z-ykvR뗬ls5 r-\vTQ~xyQ%T.Ci Exe僅=[U0C]j%))uƦޮc +з4:BlJ;P nFL{%fܓh`:eJvLܢ6i-Q=ޗ)Y-%pp ]0f G۴KjPt5Ya^ΌCJZ`rw% KinCYiEl4T%?jlc4HO%%鵵 ̵BQ>$ow!;͙@wl1 M]&Qn!`a^XH GY"TŖ[%*0uu:n`~.58/)C4nM py/uLG3!Ai}K L6Ja{V6wP9nܿ[鲍%UU-|~ Wd{9!iAԬbh>+ԅ'dҵ _b7KP:k=]%%m6wR2!$ո&W7۽ .VF?b90-3ZI$z{kQu*n˶U&r (#5MjJ?1؜@C B5kt`z^) ^̖ jJ5>a߰tg̥!l+|ѥ x0)'F[BlW@w;K] ?3nCDn(Q&O1L{b6^ab` ;Pl= >H>/If<)S,a{޳mI(G*\x[=`-hUap0M85p_O@)vzqPj++7H/w<2^ c/2.E|4xmW닜ұ?݋xH(1OHLx5#]D2NIUS3q*5zIrf cTm z>y6|%1*% l3!1bG2;tfR&Y4{Q {hnRDXGbu.+#o,Odjأg`b6y99FM܃NXc' vltl`uP5֔P>2a"+Iw3*AI :=^X3hZ\%^,ו,;Xgt9eǬ(U}+Xw}~2r`O?g ?ǪO*bxF5>[ՃԾ>a::i3UE2O<[Xce(%+VR*:+ThiDƣK( 8^!R̂1@=9lbdo_9\MfH~AsA F\`$ct\OUV9j]i -H>QlPEFjϡ!Αt JIAH<]>ipd[>l/ zݥ"o{1h5o9jLނ*D7j~q ܧk2߅+"Zj oXfl8"Po4A烓#3$@O[V.v5.a.g$cF-7=ن'R ET5wWܘ;d~2ov{ξ w/r0O2f"E͐[fAQ$;PHjT J}W&QYpdmR'!*NV&lt&E}^?F?JWN/;afE9P~ <>%d)d^l瘳BrzzŘQx2z~4RO(&C#~ї'6Xm9&ebXՀ n qA@mbYǂA39^Igz㮘/o0~ ME ɷ9RJ}1˔իk}YFibcWރ5=8a|G3g$Y]+s:]%'F؆p/Q"J2Hxn뚴+WQYWOӯҀE[3M _wpFqb%Hj}cf1>Hk!._W{+jXNTPsUKdj,1@˴QQ VNa+J L@ #`Ң}:[bfSԡB,*͏ii+1tt80}\D41O歼"ȕIG=w'漋^S|e4]؀.ګ  ꑑۯ$;ZZwUfE7N؏)}1":oǩtn^@BhS yc?j2@ A KaңViϐfl9Bc<8yD IxI"%GwK!PA]pm:=׆f>dR2.Хզc>-[&6{-UmU#,"*jB5Q|B<͆mK\߇lQ0H^FE7=>qiD/̾ I{#;\9ɞO Ѽ?,Ħrxr^! n=BmGR [vŲGUAZ E`aЎQ+ -tb SKzۉ6W_YSf@PD7N"T[JD{ iUڱGҹ)^\U,[aҵ {&O%L].oʎ%iQ#x/ eȌ%BOslK[-~_qp<'X9ؽ ]b!ƭnOS/x|\E tӔ oE Gjz]sԸ$aǥz$^`!;{Hy yqMGe `d#M X 7uDcK}kEA|iĴθ 4Dn 2S%uYMD:hmA6jFjHChqAS J͔W3 JӾ-USid7׶XgN2Brxߨ(#G8X?}/XDޤ^*YK7)wYzepf* ~v ]/'0j'keL . g3KXrwґ4ƺ>rusXB7moI3\W{y#gS622IGu_)J`1W ĮHA{Ϙ(/E.s~k~բ!/0Vdʏy@ĊPTUܲr]"ը>ä|xVtWs;5%j͟g^R63{&ksģ!;8WܦO%pj諝 3 VT4d*oםطlfSd߳Jr<$/2ao8= y>I}w+vq":ܲ0 QJPR 泓Qٰf*ԱS dEh2IDL-D5 F۴f*/Ɣ{) Uml6#0Ւ|Ut!> - XCUzX?JPsD{;.B~L#{ L>3ͅډG<.`Ip*f?S9iEM3nu>D]=&6Ķz TB=, "xTt;k=Ʊ꣕; 9vq*";`EUSMΙ2/l"!gz񢠪_& hhirPNE|$[jgvH-| &FW>RFw)*S }K]u 6ٵh'KtAx#!$~9 H}o;[dU;l8n@[ٓϠt}_qb!a3UC$6,27d8zx\$ڢhP&WPsLyj'3 ,Ne$ 4L@d~>ؙ?ܿ? SEk;׉U`jPP7OoX[G$aMBH@%;d!!gQ;6`w8&Z' -E.%;WMJ]hIѨ/Y<K!A8! 5Lr cjټ2 L\Z$EOQ~ mfqګ{dd}(\:b]+G<˺&k+x&G$g-T)WwuY duӽޝ==tf-SS>^H?y;V8| :Qb(QU_f&>v8` }$$7VNb#Ǩ%4~5kewϩ\-O&B80ߧ[ VszG&)ingHM4o ON5K*C[=,UsanE`djbS ^!{I 7ٌ}LlK@maG "_CihsuMcz1Xlri_H E{iy+g;(^[<}epJ%ER1\`vobŴh|o8hYZnk@|\~IHS.C8Au?P':]hK8KK> 2&ҘqI1@O5W},!W&h&'dOFe?$&a.)-Zӓw`4rULR@?$: \8^yJUxE 7cilR5C1;jCwrCvt5n蔲`&9ct8вYad~ȶh@C$ h 1@%j}&;*Ϟ8Eڏ%>p`Tf=, CB)0Ά16|/?((_i_gTlU/ojlǤ=;Pz#_dd1rnR 4s3PW'"[dz"[hs/mLp>&|5%J)u =${^j;i%q~O`{ŷD19&Y]^Xgy9k!g/43*zPχ>krV>I!;N|ܿ&9S:|&e${hJ4InN2ۏ6h8hHıxbšіq)sM s@5tZ:.'ɸ_~6$?5Gru>Vfa- #HRصy::du$zdhsqF;ý-#;knzqYQ"NA4Z/H3^>iUI Rx'@|QN֩cHEoEAPWJn^P/=%4ZPJ̪iqԟY')w6oF]0;5)sݤPz9"{7θS<;РY11udm?E^ 8(#?4b0-ve&>PQCT#-pN& {E6C m#fg9' 籬*W,;߸+_wEWXl ^O=ųrT\ e~5ABˠ4!Y3#7UgbZeda;#g+X G_ ΖEE\%)ltcNhe;/0^aAaTʿ+TUO4kO跁(4ä̺'~6x&k(WÄ|d'79aA=[T`ܟVkĸ#;w61":@?zIbd- (u93I^T Fq|}ւOzP'~]\erնB$$ʹ,dPJ ,CNN%MArVd& Ө 7HG|~~i|^>CDeqRq|"hEx3yC O:}2?MyNwr 11\ns}e&h2={ߦyf66Bk-q6Ŭ=C!q.ꌹ~PV.[F o=T^CuYp"f?S5 wbSSmZFp?W1"E TܾC\uԺ?[* b'5ۛAH\N@I=rřHXZtIiH-)vB:1*VFGw_oQVZ[\Skzo̍^/>L5 mvZovV}d69@aU]G *Ė~9kX9~C!ި!J]`ښ\.딤HL_lppy9;X3@5o˪}D4='htEȶ{6lsNx !aa0jb1{uiR*ANUxLַQY3s=86/br wllnVpő@-3NsPgpD!׽W@ Ɯi#lMV> C Y}h2 $_mGx lv~|73JXdÔrDY' :$'ppPro3aGŧ;hX3Jt_/–wM.3 K+%`2LjH6/+C0WcjD$ UִQ g 9ϕzpnlQ2So7W W{iGM|YjJJ{Q : hwІ9xyi.NL,~t-p?}0m&GiAɭL2Xs[(![+=7W/.õ QɊA iɿE\z }<49W@@&s"pER:?V%7fTPR7o@-W]xe5Q ibW)v%IuTbsImKuF;uQd^'*ЄLQZ'9AE߹UqEzc&/CKQ\Ujm$՞ w Gď-F~J9>q'\RzbB]Zɷ;ı`ldXp+{+S=g"t޶ce rw_Ϲ#{7)d"}+)z?r買%,5jliHl2R|].8_X,۟Z=7YBS? 62o ňnf6pdQnYsIڟ1cazi7d :2=[ԵZ4cdF~| >3P|lB+>hx:˴US@MeC)ʸFIG>I \{3lcW U;x;Yr##]YۮF]"yƙqKAx|.vYok}2mJa _Ky2u$VJ 'j7k3@pf{%6!j:g )Iw 87v{ajK-_%TFv.&}r>BݪY^?xXսKE]<[f I #7ni91d#_x#_``'H Ͷl}]%R{)jLlzgRxm*]by7W`Yӽ˼:Q;a{0n <.E{3 ڧ0_ebn[(C‰-|bW|hx6wy;=_*B8D dEIpȹFġE@;CPѾHs:]yU |? [OXӲ?(%9Vu!{Niaqgn^<~W[09G#ze¨hQL8K4W>[ !2n۴U^+iawB֩z3Ő~&oJN:iX\$p_(14Ƴ"s jj4ŢCJxnw+ p`mD3cl/DFZA/͹'/@T$!4uТZMz.ɡ{ 8JwJ.$LKPޙWњ0Zxs[N:7{LW m^9pᦿ.i 1o efZLxjԓafmi#tG͈Ԝ%S ta\pRvzL֗ԠȄ]`{yΖ_\括5IKpގ݁RA@u>p10wDa~x7vf?2`{%7ZҜ9߀a_AC}cG5Qj̖V; >$;=c+7> 0hжt-]swt[!rz5=SQ;v۸ʾ 3C"Bɖ(H4XB0 tE\:sG"|f.WZ!q/ԶLmFRDfQrxwg}# wSdk#;*KUw<)턒31&6m>Y\ȷTjRq$qۅZ-':Nf5^-'͉3y#CO?L|."8U6㠒'g$Rۇ!I8}G杉砈vm@w(jO3L>L/mЂ62aO'Di\0Lud;N.fV*[bjg=W 6('y {{Ls"0. {kXbMO|Kݮ1ܕ C`4?k; 1VG9<7 eϰ'-6؈!JG bՠic jrɺ1'F~j ЎSn od]$#V_#>V['Ei@>20%-/\#Qg$NBE9Z*#u(zF觗Ѯ{ dz 0^PvCf# ~ScYu[{1QԢ:X4Y[/}Ju'# Z ?~ő}x)f%x-i]d#k*fU}ġQoj=t b+;Ëhp-?g77tr+*sCU"%(=[G1Yʨҭ`0seEF nU}ƺdd#?y lFvsޤH1e|Ȕ 6oᛋr s DRFA 6AlucۏR@+'\WgZ]c3Q f%a p0GaWXՊBsJto7HOى9AFۼ`bU[5}: ($Ac C | a<;uhD+"Fin,VU-@oZBrF&ձ< h( 8qbb*:!IL 7PE u')ձۓ((`@Ng^ڮR0PV!4<5eZT)5 yBzS {N!d2quZ|YSJ=uĚ&D L]}|BTf<(ܯ{#Qk:XhGp|0Wʪ& c!P["fqt@cs5,Shjg\ bث4#SLk:)zOP #$g70_H4!GytMi7vS$֊1-d#()&:W;6r ?_ ĶGAEo[$w]?ɖQwR푁1L @g5MԲl="ՌTnY4`u~165B^*:AO"a&_9Mĵz O#UPq%b@gRԓQGՈ!u 8;|' {58R^?ǫ$l ݜ{1&<&HuR6WRǩKRЋ18dx ^C('f \4«*3O|R}цn s85 (nʗ~O 4HI3T-G.QSdjZw2Ńxa?*U“zST_p?1pHO]fx0,tLI Ky` In5yieU*e3fRcb)Ym*݁^Jsa:&oT9ƕڱ(5>8J~ ֛Z/'Un)DN7D]F&nG"KJK93EV8ؑW#ۜp*%hyq$\}0UQOe8( J܈[1,[L\I9\&sT=;v$^ }pGtGhaضKv;KjDwR ,/EVpZhȪ"y~1 PoZe ][7}{ެOsTHNb_=נȜkfjx-bV-vC!7 {}v1! @-pG"-%O(6p`b]]6lCt; /j"1n%6նW*M_ϐN'Ͻqߤe@O *&ʉRX0U{C; ԢDG.ōO:jsZuDo{k4b.%Bf0n\9>Ӂ``_ *TXcV"I+g99N^6==Leq\0xN/Ř_xVG|{70Pz<j4n`XlH3NzcU;|t#b2Qk"`MOvq1 Qq)뮡WwT1{PMx`OH9IV l=خO uMiׯHB HFNܫ"wK ́QvkGӉ0ũ3S`CI%vN1 .%$Y,# v$C0-c8XO' Jvw/A4s 2 T˫sڼex \d WTDp*lVH^:Iّ< BǞX;5ch%Әд|;mg i\Z/i4+n ?.{RBӿ Z(7#i~Nj 2Ce&$bH| b̐"NriǯrnýMQԽi"bLw/˂'h<^TFFDCz32\i ǎ,qDoG݈1/I>:q̅\p_F yRmq9߁P1͵e9RLOo5q~bFhhZtAʾ؇Jk@cfc.!bV$'S~E :WNt4ٹʎUFR`Pt"t:/Z/tIANUN_v07p ҺHܫx¹UF{*%i&Em;/De,ϲaXSeJ}B(3DqO8IM;Y`,;R0ѲE/^9 횡-nVAztUrIL~љ69; mSi6"]ZM%[^ ,޿nN#r)pRy_0Fv!B 佚]ؖ ݕjRIr7mN,0_>xJQ8B%fYVe;!$N8'[:)8?\ūyKLGؑ!o %ͣ\eVRkcdXQ"_bZS3@FNfA190f\X  ZPhulC+ل1:s.B}NGC҄ @:j% wLԳ(>b1`VZRZ6kHvd~b Laj!vrSAɷظABuϽdZ;Dr "d>wvP"Kɨm6zj 0oȑ`$rqM* mߺQ?TvER|JйTїAɉ(U&Ar_@ceGɐbޑȷ;㏭fy!34IEJP3=%uW&[^B}AV[ C| 'yMF7#ZI6B%!"~x\CqyPַ#XK(Pf#rꎓ*k>Ĕ)83i^z(avSrXъzZ:L"X[k3tSk-B95N$ܪ1?bD_}qz{p!1R"8K͈fEy8&?PkS03}H @'kZ4Zم jwOC4\B8K@֩&*Q-q:3oy bX!o\&HYL1=13Fa8-'k)ooK\_Ǚ3߁g9m>ldEp[>]G4|s}ԼamF־MւnхY~6{گtr, C`UH?Dzw7d}O6c^YxzSbC'åՖrp@g/4HE߲ hސJbV3}UK_Vu *lhiY?Juv. x=AeʷK`8 ӥ68%lRݻ\3pXDΜقz%=62 hn|!Y!%ʵ} *~{ N%Yyf >7Gg Uվ5Ʊ{)pHЊW}΋YQҁ^kJAI@]!.hTm8/JSKcNǰ=~P:ՌknN[ |;Ѻϋ(W}nWg'N3`W!)`Y{AEH$op{&oVbt 6]zý{ŕ kVBMD*KR^٭ BE1,;8q^Cav( nw0:8BG$mŒ/y"U+IcH7  )>VHl*8HO#^\F=&|NSfLA^uޛz {c2&߆Ϡ%>ҼQ9 (Y#E[6&1cEԭ HJàx5r|p3c)* )!I rE2x6]SnYR67? Bcv^ZqɅ"4J& 9G Cq q§׃3-16)S' 4s_T\WpW|Y/ØYLqkaFo _50{t 9qqH(HtN}-ӿIȂy襎JjnZLߺL9?n) Wi_k2iKb])QzBz1%.C:4ǗeW'@>=e[VM9ygIq)[^ `F:Oug{VɨF z>!ݚ^uY$87A 3Erss]צ?[?ܭ8}DYDUen3HE Yj&QKhx \ܸ.@a:&W 1]֏|>)K4#{Al΁G7]NN>, aBiBfhѮ ascq:8>Y"8N ̂k[C#Y j[}}rI4nN0? ,vL]ZfTx\VR0*=8D&)u*ו9$ \[9y .rO<]@K%1);HRK_}P ΑCBhG7y#g2{NuZt(C?GWa'(y.x3Ghm$q[i~:߃%0;%Iۊ9>TDjςUŽQYI#l'_2}-ésD>OQu}i;5BS*5%ۑU6`x@˜qpC$_\O*Gs9gW6 f.rD a2_hr@,S DeĠsv0@79j/[3s̚j?^ĹmWzy4]Ѝk'ʲu/&a;c.T!\")#t/!%n> Õs " 遑[74;ͼ1!A^h3 w\Cפ &Vʷ6j-KzqIt}a8Ly>`=68զ+ E#PAGdAPǑ4%e߫@gLϊ1k_zO\r6~KVĿouc '#uH_BÆpQHIRp |Æ\Aw^ԇ S`}JYM\9*,@s)ksէb.(_$$<~őyaTL/dHy!]mt5yH0Wa6:Rɀݱh?Ֆ>x1Coc#:)o()9ۓ`bU6-O\2HTai>u;n_Yysݟx\<b`[&FKrgbVuiR]A?1W| ^< ]FBOM3ym@M'0 (|ɩ&$!Zx|'yFwy9]A٥3m:z-&[f+)1hhF'2s"!@x_Tˬ WPR"mqG墐c:d.BT"fǘɟ*Ի}zYg'G4c5̾[ SF,.X֪pB(sV̇B@ITߌ:Z {~?5Qո21J#y03.̛|W#V-ƾkL\LH" ' )SiY5*Qaq=4:C+p99HqZ>Ŗԍߑ˛V*%h%|UY\1tWȧf2\rY(œj>SE- :Qv@bIW3-1,o` #Wio_I[ͳ>Ư D >ycX6{un;*ySz5Gn쵠nFa<':E> + l_}R. zTOٶCgi{2t_ͳuʇ|Lg Q7r':Wګ11ֵb b:Z9Fsya[~zDԸ1%!R(!a"<惆/AƹBMdP`Q!`z 5'@?yy@[>ADF@r6]S"lvԕ+``0HeIVz0>ݷǖ%tLw"؏ʃː.\ /H Labskx&jxe (VO ewƓ@VFgt ( !.Ko $V88شSRjFR1< h7Is@x2AkNdPA7=j!90bDP`ύ|PX=KwKPa=!཮NP0 ym1?N(YcsJκˌ#쾆3,f1lc CPaDeKpMP KLV%~V)]E=%͡f$$;7:YI sk( 3B7H}ub3osʹH?/q o$ g/k nS)VҝE k6<026 E~C,U.=}K !vP%ֆJ-,f|fAAwk)TY*K]r0J6|M@{k4 EWA8'l){—w?+QJ te'6>2G2_i׉&LsY6uYqڙ7w/=flr(0t=4K/!V9 h3B ߧk13yTY,q`eyQ|Y' 6HvjyDT69[{iDMc*G!cg F LۖO?I(#A;lBl43فR޷# DKٻl׊訊(sqa}hg/qW3i} j&mw| 0R2Gp^0|;|qzigݴ_Mp@rSp!k`!BdGsEV2=`eހoX3u_Pd3YZ==Aۃq_02z`0c7ߑ Rݧ󧥓ⲚWŽ#Z.rll{`R(=PonaֻDc-E[/NCp؅XvA$lnɰ,v;$ӫ04 z[N+cFcuxձ!sBip"}=š^:Spgn-ԥDo:O̟MiXvuf^Iy)裼lˎج'3۴y=i\vN 냼Ej7 ZvLƽᑽNa5 $L{r]u[ R$vc^sEVeT ᆢ0pQBCR}I^Bu)EJv ;[ˁ3Da]۠7 İ<9v^0x֌wIZج(hLV3'pti}{{iL \'(}MmLf.&w{r>e:q?6d[(@4TD;  0Z~d/F(=~"rhd54R o2ǹ@֍2F-y&컾{h .EO|*d{踍;o$ո7Ɯq{c?T4%\ 9Pel_[)_?ݝOz eZ6\Mx8 t?x;w7暆LLO>kzӢ-(LwxV*(oR;ŗњ.Fu~ʤwhM˼z0 3B-i tX*0e۝.|Mjx :_(׀:.n TuIt\fa%RUlh?6ɼIWo¿mG8?w!J3bDqg tɉ*8kN3J';E| c CdS@М6A)[\A0_#e|c"f_ɹ2<êu{aݒLk7GS]xwr}R_nD6j~zh f7lCf;TXb) 5d z+_(-"Ȼ t0gҊ )&3/NFQٳcO(ҳZ8R%70w0΁Ǿ*":#t*2^\+^fNum'h0q[ I'~ qr5K4G&,ʀӔUɺ*_ʮbŜG|PO GUIFTFه&=$ٝ&N$QЉONCf4~o*vΡĜ=\w*GB 2_aQϒB_%HYRm'1/`nX;>G^. FF5j`%{!M_{ܙ۷D%3bI&ն!aaDQfA]#k^yEi[xK]z'5 5>4M$E.97 ǶH`aggw?:팩}+Q.AJ\ RЫ+/oP>osl$c= LEAeifə`f}Ǽ/21Wyru5a37ĨqT3chE/^Mb &Go T7Ơcj17+sg'CIl@ȎGQ[=S!/ *orNZj0~'솲 "Nmop}E8X!8^LG! %^ 9^kCȖ 4?ϻ;Oǁg"WLX+ېTۜ,Gzi1'5h _9'aιsOCx;#FN~E,LÂ`/v.K ~_ڐaZW45q̑HJ\q\ws%zu8&#q-C܎ST/X浈U)kVg:kÃ6)ծ2۠旓K::D16g nK"PR,UC9#NLo/Kj vނ0Gib_ey9,4/m3=k:䔿P݇4,3810jNNBЏ;Aup^)¨07M~C҉Tlϻx-\ЁWaXwA Iţ*8ܑ'fa, #vٷ")i43KyfظF(>x;:@>R "#u$fYwk7H0hz)4grlI0?,LrxU>VLoIA30UTUJ,y#%gl:F? bl2Lq `3R]ٳELG9?=wj@?z sХhrfIe5G&lF4Gv4NJٗ;F2vOwEFےXiWBʳ ze.S_8Vf+@:@9%QK>^WeE/-7o3c-Gwlh\<9&KgGՂmbzQmY""*60?h%s by\̌g/ݷyE/l8 )wP쇘@rzOK,$:tava%F"a{@i(F*™{aQوP⣻l xVPcHݦЋuǢ}"?_\t{ 钘j:YvdAk+:% PREѿf5 65Yv/z_v]')CxO  ^fIqD r|1BvaDz:c{v xUPpqK맄ݏ&;5X,*Z Ns]Cap}p0}h 0?2 #RMM>vx B,Ǵ5sfAWvQ ,uӜ{em>W0% շ(& H-\iwY4a>'F?ڠo f>Q"m܃zAhHSmT< :KݝEb•@HA8F9Pl{*j<~pDJ\=,y3w$^uE^qFۮ} AsÛ g)z $;V:Unc&e+Cv0s'$G[dmW5Z딠7P4)rtQrh2Z!-᪥0)3q^.5E¦W4YD/A^Bp6#ucVM#՛mp[Q6b^oCX#A]19pbA%#:܄cmgڛwڔkL1NqMCuiH]g#{:u1WY I:#]h"QnP5'l#ttbv I/V?#B<|R 4(uC&e~?.So.2PAyZRH /q/ kImtwn.)1 S[G&*UE< mhV2kr\"sM UE7Ⱦ3ly| uh8!! G¦!+xj޽=ӎ鬏i.̨^J y'%TE)ӶT[#zArю[P˅],ICG_ }W{dDM.g'9O5p`̄3nz3K8.qUP9H,n?]3fମb%(ũ]PDfC&4-?ĔF-\ի*=}_ qu@vRnO Eg<11)77bv!SrЌm6[uԕ`C+ANGZg^ f>eB,(NyoTns RAw2% ػ8vNs:$?K|*SdF*àٌVhK'l?cHR2CfBEh]IR%rm)-h(!* _K +z opl 9rwk6vM}\fwI ]zwFbk |pP]YFSy9Brqw9 Na?me1܊IWYX+.&ʻ"~Jq Szs* X/SB7fwgl  ^l&}Fd q :'Bq}뾭9].i$c~SgOۅ6/2r iuȤgSb_yaƒGGOf0V>@6QayzW9|o) \BTGlU7G|fN!: ڣf^H7=1,~| @iB|WTKT-Y;X3u(l7tQQf9|8 H$3Ӡ.F(n46saOYROZmK- aM@NjؕV+!7+3Hs>w2Xu6Ag~>Fwy#'1J{bdȼˑ<u9b_FA`cHi7 2.5쏸(@cJNpTW% "Lz#zbM,P1f+Cifܯ|;9ӯ-Ys,x>{ ɖ¨˶B -vb5Gw!25m9BFoګ_Y!XIBև3Eɡ?2 b7Q|(-{m&Oy+.(8 ρXq@Ъ=9%1z /]N5ћ mPBjo|٧'IC} KɄ^a>$ f5 \`41,dޠ1_Pxrs>тNS ->ES{[F?I2L"a YZ