NetworkManager-1.22.10-lp152.2.9.1<>,`ae/=„e5inÂV?2r}&75?OhE_^IwTA:ddɞ7߄^ˆ84J;;bGX~4Bl+eR[n׶72-3ư[jh̥~~U QR]gv4a4E)1q !LT7Sބ}HMV?c"U#,%s(0k_nDD1+Ad"C4q,$V>!  Г'N'4-=#`Ľ2 &$a>L ?d % W 5ciq W {{ ~{ t{ `{ /{ 0{2p{4{7>7l{9X :R;RCR(D]8Ddp9F$p:Pp=q>q?q@qBqFqGr{Hs{Iu{Xv\ Yv Zv[v\v{]x{^ b0cdwe|flu{vw4{x {y zP`dCNetworkManager1.22.10lp152.2.9.1Network Link Manager and user applications for itNetworkManager attempts to keep an active network connection available at all times. The point of NetworkManager is to make networking configuration and setup as painless and automatic as possible. If using DHCP, NetworkManager is intended to replace default routes, obtain IP addresses from a DHCP server, and change name servers whenever it sees fit.aearmbuild22|IyopenSUSE Leap 15.2openSUSEGPL-2.0-or-laterhttp://bugs.opensuse.orgProductivity/Networking/Systemhttp://www.gnome.org/projects/NetworkManager/linuxaarch64 if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : for service in NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ; do sysv_service=${service%.*} if [ ! -e /usr/lib/systemd/system/$service ] && [ ! -e /etc/init.d/$sysv_service ]; then mkdir -p /run/systemd/rpm/needs-preset touch /run/systemd/rpm/needs-preset/$service elif [ -e /etc/init.d/$sysv_service ] && [ ! -e /var/lib/systemd/migrated/$sysv_service ]; then /usr/sbin/systemd-sysv-convert --save $sysv_service || : mkdir -p /run/systemd/rpm/needs-sysv-convert touch /run/systemd/rpm/needs-sysv-convert/$service fi done fi if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" ]; then /usr/bin/systemctl daemon-reload || : fi for service in NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ; do sysv_service=${service%.*} if [ -e /run/systemd/rpm/needs-preset/$service ]; then /usr/bin/systemctl preset $service || : rm "/run/systemd/rpm/needs-preset/$service" || : elif [ -e /run/systemd/rpm/needs-sysv-convert/$service ]; then /usr/sbin/systemd-sysv-convert --apply $sysv_service || : rm "/run/systemd/rpm/needs-sysv-convert/$service" || : touch /var/lib/systemd/migrated/$sysv_service || : fi done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ $1 -eq 0 ]; then # Package removal for service in NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ; do sysv_service="${service%.*}" rm "/var/lib/systemd/migrated/$sysv_service" || : done fi if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ) || : fi fi k&    x P ]!E@ ` 8 x  0< v h ~/VSp ,v D(7go h!o:d8BFl>P    5u<5 n=RAAAA큤AAA큤A큤AAA큤A큤A큤AaeӴaeӴaeӴaeӴaeӛaeӓaeӓaeӷaeӷaeӷaeӓaeӓaeӓaeӝaeӝaeӝaeӝaeӝaeӷaeӷaeӷaeӷaeӷaeӚaeӚaeӚaeӚaeӚaeӚaeӚaeӚaeӚaeӚaeӕaeӷaeӷaeӷaeӷaeӷaeӷaeӷaeӷaeӷaeӷaeӷaeӹaeӝaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓaeӓae]^j^j^jN9^j^jaeae^jaeӔaeӔaeӔaeӔaeӔaeӔaeӔaeӔaeӔaeӔaeӔaeӔaeӕaeӕaeәaeӜaeӴ308ba657a5a151b03dbdac10c0e62979972de20b2ec475b9670c87747d2046aad4ac24338101aef3456e8432415e87bc7fd9e64dd2c65e740ad6305e1caf39f3e035417ff2475f8d16b703d1aae45dad5faafcf1d0ec7bdaad53655e344637e77c01d24ec8c6ebb69ff208e8185c7fab94f74ab693ff49b53355ee91193e61e139a782a4df1d6febafcf67615dbe03ddccd6b27abed09a3df359931bf220fda220b55c624f369ecc04311dab3d740018f256005716aa99e9a972292f848d05d58bd6b1a49645d0b55c3b53df917165c980b3a5251ef4b2619a002dac7e75167073f63dc9363ac6530c3455be765f295f53728e84d63c92c0c1747e42442908983a4a6fcec370b622b2622d635c554afc9a991de386ca5ef4a71e28ebbfad91b3fe662ab5c53af7df1e47c9b22bcff7c794fb46dd595de797a900e598b9aa4c9fb29ab4d226c2167db64bfd50d04f1f5de051557beeecbe1ce9f17ce9fb76274e76b267c9966331f5d13376bb092a115b6f761015f68472a940017a2c69a36e63666dd6b5893fdf22b5523022b23db7b3919ac3b016645f04fad2fb6a52c1edbdfaae0141f881203b471d1095dc78d0bec8774bdce6a6d1f5d16e3d10ec96d72e7525b2e5298edfa747c595fd2af9b6efd63ee03250b907c8ee1178863bc32a81b839a7889b25beebbfc33be00c8ae5d17c1a7afc00e39ff3bf8319d8e5226c3a0163d08e15af934bdd1153b71234a939e5790c4f3447afad3c75b697a9e1522b22fab51e822fdee6534bf08729b90ce8a28f869fe56eab5f76a6a27299d63602080d2ee92df52508f70c222d5cd73612032f92a37e334b2210d7eadc3832b5d1e070407e588c917bc8284fdda0cb16e94b3a8001dc44566d479afc2ca2b943feec139ea3f47eaad52ea6812816e9dbcc3ddab1c95d0ce005bdbb1664aa862a410ec1888c2b5555d64764ed86cd6e2034cc1cc95acff4a2e39e5b72b31fbed5e5a16e1a2d404eb1a9ba18152c64cc4857f052696e9f9dac02deb7dff13b011e6df6205962d5a09cdbbe8c98e14155338b539fb7036cf85f7671e154b8041c98945bf5aaa362ec6748070eb5881e9cccc8b2fc9d05897b0c84e1c648a016548ba70ef30053ebd1b193b86f253ad467c6c53f0f78c4f7252c354365d1afcfb0f53162292edbcd70027e8a644b5a196ef7a1b3b7a342ab4e989fa0d56f3ff0f3dadc384be48d8c53850be30976d590eb99e2a332b17c8593747554967a196ed52d50c7656758f2ad3fe4e3811c90a5be95f68f45b198f068ad95ce9f3dee8e57ec6e307ae7da92949038f1e475b10b0f5fbca36443a736112c57a338c4ea73493c78b6f363eaf094faa33ba31d8025b2fcaac21c7a053ee1ff9882713964f659e052384ca14ae3d3c871c9dca348deb923437beb889df92730ef1344cc37af07f2a91a270a842cfee1f3fe298ac5b58e06fbb17c0cfe8e1d2f4d86db3a3bc08cb5dd0f4e55998c74e2fed169bd76e8617140e8841d0c693a6575e4c89094200b24b7b5c5a084e337d74c8a16b3d69feb381182fda7350d7e12e87940317ba4e08552b7543c609c39e28ada5443aa1ba6826365e8f56fbbaf1b24732c5c590a304628eba831ca7b9d10ce51970a542c7ace39cc2c485b75e680633eb07a5cf4ed1c3d9a2e0f9e177f52a2e1d19cc3d51a6fa5bf6735728692b42f963a495120c5a4451389f2935b793a3fa519e2ef2b5e5dc80025ec5620a9811c2a6fc79fbe8ee55ef2747d5a56c7ef3b06ae49508cec0742748dbe4889db543fafe5d1c5813e9ac760f0b0589d03817a3dd40c260d6929ff5417ddbfcf2a0dfcb503738add99ecb9da4b238170f918a2a6509705ee618ab096c8327362bdb39a322f218c566d92a58924aea6948a6be59f835c2fe2664632d441fc2597f773d2ca9b86f2a3b6b6cff94f762a9116d8348ce5e8da1236119c18bc2d6a77da410d1e44b01628b70c3b0fdb1ea443477861774fdc6ebad3b02c20703539c56b110173225aefd70b2b60dd6bf01786ab0af62b4e26d74ce85a1902f17f19814d4086184f65f8986d53eb7ceb59da16562d1a18770b98538f2e36ee2058ec953543812554fdcb689a93e3d7f7324b2754dc78e723d91ec347161383ef992102f61b16dbcf5019075338eb1c1b83c8f5116626f8764b77dc7e2cf82f0e1431b9cea9b4e53be223638700e338db8eab8713921950c895b933bdd0fb76d1a42f6109e7dfae8f92ef5ace35fb9de910c3e030181f79687441b6f72f8c35ff1c3972fddc6e5469d618242acaaef04c4491ddf3e95ac39190badbe8b570ba48e936445c1f83ec3b785cc8eb788e41010722e31bd7e17273db71940f1daa908efbbbbcbf7f3599311cb1a95b0cbe160269b8cb41a34dbf3ef3ad56b401aaddff61bbd32492d77a0dfd321a15c206eefa8f5e80a41af4d34f8c0720a7042bcda075b350e8021029a9e563acdca4de772716a1ff10afd3b59534f864df8f44bcffe6da92add51858d29deabf39684ba6ece1c2cdb6bec5302e77841bd878960d839cfde78b0680d176f7642134c7760e4135a85469d535553db28a4ddb2311a02ccbe81d480fc2c2c0b6738472d53ce7a4be6f5d2a5fa2950f8be7aacecd41fee04e5547bb4ea0c8691a147a1ccd7988b873becb676b61196be1da4bd32572b12d91b01410b7a2d6094bb8025613584c5deda2097ad8b1a015ff7b0043007e3dedcde7cf035ff7794542911e787208ad8a43e1ebc4d749b8dc9dfe4ceb53be088dbdac16afdd12b18cf6ba94057ddabc81f320fd9ff2587177b4605b8a137c0f56d3c8170e6ec58b775db8493b14175188143767011a20c39fe37faab55ef170da7736977547de62d7eafb9a7c7127e9d3ed6505b940406638a04ffb7751980c3cc86efebb01ef3ce5668931e55ad82303aaa50498724ba1c2570b9cf416f4a838365d8cab5622944e003841209cd91538120d25ee64e625e3c3aba8aea2a53e84363ad8f2e8d2ccdf1cb386ee766f21c6125af273a06ba6a477ccfafd593c2180d5addfbd271a41c729fa9e77a8f4a041d067c2c08974571926f3b4daee85bd6ffb25d55dbc0581d5b60adfc2d8136d4ab555cb4c6c131e97654f8c6501e4eb3cb73dcd501c05bf8fe1558f5e237d6fa1901a33cf00da686e7cf4c6db89758637c25b709114e91bed58b8812a85956d851c0b013817cfcd86a5aa8be7839b441b64eefd6849d831545f70a5b77913e5cd20c0a07de5463942ee08c87988a05de4171b3a6aadfcd5cd2f0503dce5cd370793c12e19b2b3e34cbbca70100b10a6997e676e30bfbea5aba1bce886026442fd79d1d113347dd1ccd4e81f0b035fe4a944715f7978660701f1517243d79d4846fb7ccaec4dcb956543eae8b1fa68dc2828914f44198e3519704593bda3a4dfe54eb937073e0e398bc1b5bc834e27826bb88a2bf0b89a1bc763a572d1ac8508d006f69a59d0ed395ae1d6aab5ee7a4391d90acb2219ad69e10b72dcd0935f2a1e664c453e319fb07a2b331e554c277ef36b7211cb34f1bfb89119dd515d67aacff74ae673e518092689bcb62b8bf47bf5d1404710f405183f417e2091b8af97ede1a801423fd973f80743960cfeebb4957f1829610a47ae11f9ff78cf2d238f5e0b46b45d0853e24dc4a678d6267dd1f6ebbe33c637ba39840c238531d7a9f0543c137bc0eece552d42642d1bab31707ca3b3663d9c7a81ac3b270a4780e702ad3aaec79d8986730d2b52844bc5d63b411678a3d916a0d5969dfb40b77b67b1a3a278d2837eda191ed85420d1c7a531f9309c5fe1443d80546c220bd0946eeba9757826ba5e7426b3e24a21b41e14cb32807a3826f3046ac041ffb9ff7a1f4c0db3ef959395d0460f93e05c21956011558da2b285d5bfd954011b5a8816f35338b6fbbd177e9c5e3d2812ac8995fee6f2ed452441de7d6175b0300c1fb63e8177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643aae5ed4f700b9c9b5ccb7e5e4de196be9968d3aa64c75513102a06cd716f909f4d250ec220285151d2608715a0c44b4d844a156f491e9ed9b209ba15e77c6a653a63498721ea04e0a39f57250bd47e093c1d24f65fcb759ca3702a39fa42555d3a63498721ea04e0a39f57250bd47e093c1d24f65fcb759ca3702a39fa42555d3a63498721ea04e0a39f57250bd47e093c1d24f65fcb759ca3702a39fa42555d3a63498721ea04e0a39f57250bd47e093c1d24f65fcb759ca3702a39fa42555df447adac5280ef309a1cf7fe7fd46e1ebf3914dec7181a9b10dcbdc45b0d21e4c86953dabc1454e3bdca3c2f0ecaca7f36d889f184b23244981433d84ce9f4ac10fb729d1665370357ac8cfc41362a2ff650ba33013a8ea3133f7e8145ff1e74f447adac5280ef309a1cf7fe7fd46e1ebf3914dec7181a9b10dcbdc45b0d21e40ca90ae0424768edb9206adb2936975e0d69b9d4bf102c54a11807b6125ac0cdf48d1b19250d0dc24c75eba8a34d0e7a6ef555c80a2dbfe7aa145d104bdb95fd9ecbbe01137d7cce10c973fad3b84f97a0463abbd5b5fa2f30f5247504af67a2f09ed2f5f43ea31bc413a3a65a1b4dd77f43a6797f2c4aeb0ce6b3b03c9e32f44f610dd4ec27af590d81e6b2d0d03e7a03b9b539dbc0632d70180d728c78e431nmtuinmtuinmtuino-wait.d/90-nm-cloud-setup.shQrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootNetworkManager-1.22.10-lp152.2.9.1.src.rpmNetworkManagerNetworkManager(aarch-64)config(NetworkManager)dhcdbdlibnm-device-plugin-adsl.so()(64bit)libnm-device-plugin-bluetooth.so()(64bit)libnm-device-plugin-ovs.so()(64bit)libnm-device-plugin-team.so()(64bit)libnm-device-plugin-wifi.so()(64bit)libnm-device-plugin-wwan.so()(64bit)libnm-ppp-plugin.so()(64bit)libnm-wwan.so()(64bit)@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@      /bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/bin/shNetworkManager-brandingconfig(NetworkManager)dhcp-clientiproute2iputilsld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libbluetooth.so.3()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.26)(64bit)libcurl.so.4()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgmodule-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libjansson.so.4()(64bit)libmm-glib.so.0()(64bit)libndp.so.0()(64bit)libnewt.so.0.52()(64bit)libnewt.so.0.52(NEWT_0.52)(64bit)libnewt.so.0.52(NEWT_0.52.13)(64bit)libnewt.so.0.52(NEWT_0.52.6)(64bit)libnewt.so.0.52(NEWT_0.52.9)(64bit)libnm-wwan.so()(64bit)libnm.so.0()(64bit)libnm.so.0(libnm_1_0_0)(64bit)libnm.so.0(libnm_1_10_0)(64bit)libnm.so.0(libnm_1_10_2)(64bit)libnm.so.0(libnm_1_12_0)(64bit)libnm.so.0(libnm_1_14_0)(64bit)libnm.so.0(libnm_1_16_0)(64bit)libnm.so.0(libnm_1_18_0)(64bit)libnm.so.0(libnm_1_20_0)(64bit)libnm.so.0(libnm_1_22_0)(64bit)libnm.so.0(libnm_1_2_0)(64bit)libnm.so.0(libnm_1_4_0)(64bit)libnm.so.0(libnm_1_6_0)(64bit)libnm.so.0(libnm_1_8_0)(64bit)libnspr4.so()(64bit)libnss3.so()(64bit)libnss3.so(NSS_3.2)(64bit)libpolkit-agent-1.so.0()(64bit)libpolkit-gobject-1.so.0()(64bit)libpsl.so.5()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)libreadline.so.7()(64bit)libselinux.so.1()(64bit)libsmime3.so()(64bit)libsmime3.so(NSS_3.2)(64bit)libsmime3.so(NSS_3.4)(64bit)libsystemd.so.0()(64bit)libsystemd.so.0(LIBSYSTEMD_209)(64bit)libsystemd.so.0(LIBSYSTEMD_221)(64bit)libteamdctl.so.0()(64bit)libudev.so.1()(64bit)libudev.so.1(LIBUDEV_183)(64bit)libuuid.so.1()(64bit)libuuid.so.1(UUID_1.0)(64bit)mozilla-nssppprpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysconfig-netconfigsystemdsystemdsystemdsystemdwpa_supplicant1.22.10-lp152.2.9.12.4.73.0.4-14.6.0-14.0.4-14.0-15.2-10.80.50.6.44.14.1aK`@`pA`\{@_@^@^j$@^h^K^:@^4^,-^g@^@^]@]@]µ]]]]]]]@1@\\t@\@\ޢ@\@\|\@\6\r@\R@[@[S@[j@[t[.[:@[v[Y[&M@Z(ZZK@ZZkZZ@ZZH@ZxG@Zk@ZiZhu@Z8@Z+@Z!D@YY@YdY_wY^&@Y0Y.@YXQ@XBX6@XAXXXU(XU(XS@WSWށWu@W@W@W@W@W@W@WWL+@W@WV@VbVV@VVV @VzVTQ@U@UoU@UL@UL@UK@UJ@UT@TܕT}TTq@TTO@Jonathan Kang Jonathan Kang Jonathan Kang Jonathan Kang Hans-Peter Jansen Jonathan Kang Bjørn Lie Dr. Werner Fink Bjørn Lie Michael Gorse Bjørn Lie Dominique Leuenberger Bjørn Lie Lorenz Hüdepohl Bjørn Lie Bjørn Lie Bjørn Lie Bjørn Lie Dominique Leuenberger Bjørn Lie Bjørn Lie Bjørn Lie Bjørn Lie Bjørn Lie Jonathan Kang Jonathan Kang Bjørn Lie Jonathan Kang Jonathan Kang Christian Boltz Antonio Larrosa sckang@suse.comJan Engelhardt bjorn.lie@gmail.comsckang@suse.comsckang@suse.combjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.comAndrei Dziahel sckang@suse.combjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.comlnussel@suse.debjorn.lie@gmail.comsckang@suse.comdimstar@opensuse.orgdimstar@opensuse.orgfabian@ritter-vogt.deseife+obs@b1-systems.comdimstar@opensuse.orgsckang@suse.comdimstar@opensuse.orgbjorn.lie@gmail.comdimstar@opensuse.orgbjorn.lie@gmail.commgorse@suse.compavlix@pavlix.netyfjiang@suse.comsckang@suse.comzaitor@opensuse.orgsckang@suse.comzaitor@opensuse.orgdimstar@opensuse.orgsckang@suse.comtchvatal@suse.comtchvatal@suse.combholst@lusku.dedimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgdimstar@opensuse.orgzaitor@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgsckang@suse.comfcrozat@suse.comsckang@suse.comsckang@suse.combadshah400@gmail.comsckang@suse.combadshah400@gmail.comzaitor@opensuse.orgdimstar@opensuse.orgdamjanovic.ivo@gmail.comdimstar@opensuse.orgzaitor@opensuse.orgsimon@simotek.netdimstar@opensuse.orgbastianholst@gmx.deglin@suse.comdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgglin@suse.comdimstar@opensuse.orgdimstar@opensuse.orgbadshah400@gmail.comsfalken@opensuse.orgarvidjaar@gmail.comdimstar@opensuse.org- Drop nm-add-CAP_CHOWN-capability.patch: This solution was denied by upstream maintainers.- Add nm-add-CAP_CHOWN-capability.patch: Add CAP_CHOWN to CapabilityBoundingSet to make teamd work properly (glfo#NetworkManager/NetworkManager!860, bsc#1185424).- Add nm-fix-dhcp-client-timeout.patch: Better handle dhclient's timeout so that a recorded lease can be used when dhcp server is down(glfo#NetworkManager/NetworkManager!811, bsc#1183202). - Modified NetworkManager.conf: Use dhclient as the default dhcp client(glfo#NetworkManager/NetworkManager!811, bsc#1183202).- Add NM-restore-MAC-on-release-only-when-cloned.patch: bond: restore MAC on release only when there is a cloned MAC address (glfo#NetworkManager/NetworkManager!775, bsc#1183967).- Exclude systemd.automount from nfs processing: fix boo#1116625 as suggested from Neil Brown- Rebase nm-add-CAP_SYS_ADMIN-permission.patch.- Update to version 1.22.10: + core: periodically cleanup stale device state files from /run. + dhcp: fix crash in nettools client. + bond: fixed the validation of the miimon option. + Various minor bug fixes and improvements.- Modify nfs script (boo#1164642) * Also mount nfs4 shares * Ignore nfs or nfs4 shares in case if the noauto option is set- Update to version 1.22.8: + Added configuration option to customize IPv6 RA timeout. + Internal DHCP client will now request a lease renewal using the previously obtained IP address when expired. + Removed length limitation for OVS Bridge, Patches and Interfaces (only Patch types) names. + Fixed initialization of 'secs' DHCP header field, this caused some DHCP relays to drop packets. + Fixed failure when creating team interfaces using 'nmstate'. + Various bug fixes and improvements.- Add -fcommon to CFLAGS. This is currently being done upstream (boo#1160381).- Update to version 1.22.6: + Various fixes for the internal DHCP client. + Slave devices now do not get created/activated if master is missing. + Fixed 'startup-complete' bug where NetworkManager would reach the network-online.target even when not all the connections had been tried. + Updated translations.- No longer recommend -lang: supplements are in use- Update to version 1.22.4: + Fix behavior of internal DHCP client when the server sends a NAK. + Support 31-bit prefixes on IPv4 point-to-point links according to RFC 3021. + Fix memory leak parsing RequestScan D-Bus method arguments.- Fix 'nfs' dispatcher script It was checking for an enabled unit 'nfs.service' - which does not exist (anymore?). Switched to a check for an enabled unit 'nfs-client.target'- Update to version 1.22.2: + Fix multiple issues in the internal DHCP client, including wrong parsing of search domains and classless routes options, and failures in obtaining and renewing the lease with certain server configurations. + Export NM_CAPABILITY_OVS capability on D-Bus and in libnm to indicate that the OVS plugin is loaded. + Fix libnm annotations for nm_sriov_vf_get_vlan_ids() to allow the usage of the function through GObject introspection.- Update to version 1.22.0: + Drop support for BlueZ 4. BlueZ 5 was released in 2012 and should nowadays be available everywhere. + DHCP: switch "internal" DHCPv4 plugin from code based on systemd to use nettools' n-dhcp4 library. + Add support for "scope" attribute for IPv4 routes. + Add support for specifying IAID and FQDN flags for DHCP request. + Add a '802-1x.optional' property to consider the wired 802.1X authentication as optional. + Use the Network Cost Wi-Fi information element to determine metered device state. + Support main.auth-polkit=root-only setting to disable PolicyKit use and restrict authorization to root user. + core: declare "startup complete" when device reaches "connected" state, even if IP addressing methods did not yet fully complete. This changes behavior for unblocking "NetworkManager-wait-online.service", and "network-online.target" earlier. If this causes issues in your setup, you may need to configure "ipv4.may-fail=no" or "ipv6.may-fail=no", which delays reaching "connected" state for the address family accordingly. + libnm: hide NMObject and NMClient typedefs from header files. This prevents the user from subclassing these types and is an ABI change (in the unlikely case that a user was subclassing the types, which is no longer supported). + libnm: retire deprecated WiMAX API NMDeviceWimax and NMWimaxNsp. WiMAX support was removed from NetworkManager in version 1.2 (2016) and no such type instances would have been created by NMClient for a while now. + Deprecate synchronous API for D-Bus calls in libnm. We don't remove libnm API so you are free to continue using it. But tells you that using it might be a bad idea. + libnm: heavily internal rework NMClient. This slims down libnm and makes the implementation more efficient. NMClient should work now well with a separate GMainContext. + Add `nmcli general reload` subcommand to reload NetworkManager configuration and DNS settings. + nm-cloud-setup: add new tool for automatically configuring NetworkManager in cloud. This is still experimental and currently only EC2 and IPv4 is supported. + Add new NetworkManager logo to "contrib/art/logo". + Various bug fixes and improvements. - Disable networkmanager-checks-po.patch: Needs rebase. - Add new nm-cloud-setup.service to pre/post/preun/postun calls.- Update to version 1.20.8: + Fix handling of system CA certificates in the ifcfg parser. + Handle ReachableTime and RetransTimer from IPv6 Router Advertisements. + Fixed setting of MTU according to its parent device for some device types. + Various fixes for the initramfs configuration genertor.- Update to version 1.20.6: + Fix updating agent-owned VPN secrets. + Adjust IWD support to new D-Bus path of IWD 1.0. + Introduce an 'optional' property in the 802-1x setting to allow the activation to proceed in case of missing authenticator. + Fix ARP announcements for IP addresses configured on interfaces. + Use proper interface when adding s390 specific details in initrd generator. + Don't disable PMF on Wi-Fi connections using SAE. + Properly handle uint16 property types in libnm.- Drop NetworkNanager-client recommends: this is no longer needed, as NM itself ships a frontend by now (nmtui). If a DE has a better way to manage NM (by means of applets or other way of integration) it is up to the DE to depend on the applets.- Update to version 1.20.4: + Fix crash related to Wi-Fi-P2P. + Support rd.znet option in initrd generator to support s390. + Fix not creating default-wired-connection when a suitable profile exists which is not tied to the device by interface-name. + tui: support WPA3-Personal (SAE). + Fixes for OLPC Mesh Wi-Fi. + Various bug fixes. Notably, fix unit test and build issues. - Drop nm-fix-gtk-doc.patch: Fixed upstream.- Add nm-fix-gtk-doc.patch: Fix build with gtk-doc 1.32 and newer.- Update to version 1.20.2: + Don't ask wpa_supplicant to attempt to enable FT if the interface doesn't support it. + Various bug fixes and improvements. + Updated translations.- Update to version 1.20.0: + The libnm-glib library, deprecated in favor of libnm since NetworkManager 1.0, and disabled by default since NetworkManager 1.12, has now been removed. + The DHCP client now defaults to "internal". The default can be overriden at build time by using the --with-config-dhcp-default option of the configure script or at run time by setting the main.dhcp option in the configuration file. + Added support for configuring fq_codel line discipline and mirred action. + Added a possibility for distributions to ship dispatcher scripts in /usr/lib. + Drop deprecated setting "main.monitor-connection-files" in NetworkManager.conf. This setting now has no more effect and was disabled by default for a long time. Instead, after changes, load files explicitly with `nmcli connection load` or `nmcli connection reload`. + Rework parsing team JSON config in libnm and stricter validate settings. With this, NetworkManager rejects settings that it considers invalid while still allowing setting arbitrary JSON config directly. + Drop ibft settings plugin. This functionality is now covered by using nm-initrd-generator from initrd to pre-generate in-memory profiles. + Support "suppress_prefixlength" attribute for policy routing rules. + This is what wg-quick uses for the "Improved Rule-based Routing" solution, and the user can now manually configure such policy routing rules. + Support "wireguard.ip4-auto-default-route" and "wireguard.ip6-auto-default-route". This automatically implements the "Improved Rule-based Routing" of wg-quick to help avoiding routing loops when setting the default-route on the WireGuard interface. Note that this is now enabled by default, so there is a change in behavior if your WireGuard connection profiles from before had a default-route (/0) in allowed-ips. + Rework implementation of settings plugins and how profiles are presisted to disk. This is a large internal refactoring of the settings plugins that allows to migrate a connection profile between plugins. + In-memory profiles are now only handled by keyfile plugin and will also be persisted to /run directory. This allows to restart NetworkManager without loosing these profiles and it provides a file-system based API for creating in-memory profiles. + Keyfile plugin now supports a read-only directory of profiles under directory "/usr/lib/NetworkManager/system-connections". Such profiles still can be modified and deleted via D-Bus, which results in writing profiles to /etc or /run that shadow the read-only files. + Add new D-Bus method AddConnection2() that allows to block autoconnect of the profile at the moment when creating the profile. Also add support for this API to libnm. + Add flag "no-reapply" to Update2() D-Bus method. Normally, when a connection profile gets modified, this only changes the profile itself. When the profile is currently activated on a device, then the device's configuration does not update before the profile is fully re-activated or Reapply on the device is called. There is an exception to this: the "connection.zone" and the "connection.metered" properties take effect immediately. The "no-reapply" flag allows suppressing to reapply any properties, so that no changes take effect automatically. The purpose is to really only modify the profile itself without changes to the runtime configuration of the device. + Add "ipv6.method=disabled" to disable IPv6 on a device, like also possible for IPv4. Until now, the users could only set "ipv6.method=ignore" which means the users are free to set IPv6 related sysctl values themselves. + Added support for Wi-Fi Mesh network. - Stop passing --with-libnm-glib to configure, feature was dropped. - Drop sub-packages libnm-util2, libnm-glib4 and libnm-glib-vpn1 and obsolete them from the main package (also in baselibs.conf). - Drop typelib-1_0-NetworkManager-1_0 and typelib-1_0-NMClient-1_0. - Rebase some patches with quilt. - Disable nm-add-CAP_SYS_ADMIN-permission.patch: Needs rework or possibly dropping as the ibft plugin is dropped. - Pass --with-iwd=yes to configure, build experimental IWD backend support. Not recommended for endusers, only for testers willing to take the risk of broken wifi with no support from distro.- Update to version 1.18.4: + Improve handling of externally added policy routing rules and for rules that are taken over after a restart of NetworkManager service. + Fix taking over OVS devices after restart of NetworkManager. + Bugfix reapplying IP configuration while activating. + Allow reapplying Wi-Fi profile when seen-bssids changes. + Various other bugfixes for minor issues and memory leaks. + Various build and test fixes.- Update to version 1.18.2(bsc#1138213): + Add support for policy routing rules. + Add support for VLAN filtering for Linux bridge. + Support ieee-802-1 and ieee-802-3 LLDP TLVs. + Allow large MTU sizes for infiniband/IPoIB connection profiles. + Improve nmcli's handling of list options for connection properties. + Add compatibility with out-of-tree WireGuard module on 5.2 kernels + Fix parsing of BOOTIF= variables in initrd. + Accept numeric IPv4 prefix in place of a mask when parsing a command line in initrd. + Don't check connectivity of unconfigured devices. + Fix PKCS#12 handling in the ifcfg-rh plugin. + Avoid waiting for udev to see software devices created by NetworkManager. + Don't attempt to stop management daemon for Team devices created externally to NetworkManager. + Use FQDN for persistent hostname on Slackware. + Restore IPv6 configuration of a device when its link goes back up. + Fix management status of software devices on system suspend. + Make nmcli not print certificate blobs if --show-secrets is not used. + Fix MTU reapply. - Drop 0001-Update-connectivity-value-on-device-removal.patch: Fixed upstream.- Add nm-add-CAP_SYS_ADMIN-permission.patch: Add CAP_SYS_ADMIN which netconfig needs to call setdomainname (bsc#1129587).- Update to version 1.16.2: + Use FQDN for persistent hostname on Slackware. + Fix wrong permissions of the /var/lib/NetworkManager/secret_key file. + Don't terminate teamd when assuming existing team connections. + Fix incorrect persistence of connections with EAP-TLS and a PKCS#12 certificate when using the ifcfg-rh plugin. + Fix reapply of the MTU property on devices. + Restore IPv6 configuration when the link goes up. + Fix build with sanitizers. + Other various bug fixes and improvements.- Avoid using "systemctl enable" in spec file (bsc#1038403).- Remove legacy checks which fixes bnc#803058 during distribution upgrade from 12.2 to 12.3 in .spec file.- Fix systemd-network-config.patch which added lines starting with "+" to NetworkManager-wait-online.service- Fix the connectivity value of devices which was set to LIMITED when the connectivity check fails. Now if the connectivity is being set to LIMITED but the device state is DISCONNECTED, then the value is coerced to NONE. Add patch submitted to upstream (boo#1103678, glfdo#NetworkManager/NetworkManager#138): * 0001-Coerce-connectivity-LIMITED-to-NONE-when-device-is-d.patch - Fix the global connectivity value which wasn't updated when a device was removed. Which is a problem if the device being removed is the one providing the connectivity. Add patch submitted to upstream (boo#1103678, glfdo#NetworkManager/NetworkManager#141): * 0001-Update-connectivity-value-on-device-removal.patch- Update to version 1.16.0: + Check connectivity per address family. + Support "main.systemd-resolved" to let NetworkManager configure DNS settings in systemd-resolved without making it the main DNS plugin of NetworkManager. + Write "/var/run/NetworkManager/no-stub-resolv.conf" with original nameservers. That is useful with caching DNS plugins like "systemd-resolved" or "dnsmasq" where "/var/run/NetworkManager/resolv.conf" refers to localhost. + Change default "ipv4.dhcp-client-id" setting for the internal DHCP plugin from "duid" to "mac". This is a change in behavior on upgrade when using the internal DHCP plugin (unless the default is overwritten in "NetworkManager.conf" or specified per connection profile). + Improve handling of DHCP router options with internal DHCP plugin. For one, accept multiple routers and add a default-route to each. On D-Bus expose the original DNS and NTP servers without cleaning up local nameservers. + Allow binding a connections lifetime to the DBus client that activated it. + Add support for establishing Wi-Fi Direct connections (Wi-Fi P2P). + Add support for WireGuard VPN tunnels to NetworkManager. D-Bus API and libnm support all options. nmcli supports creating and managing WireGuard profiles, with the exception of configuring and showing peers. + Add initrd generator to be used by dracut and use it as new way of handling iBFT. + Deprecated "plugins.monitor-connection-files" setting in NetworkManager.conf. This option will have no effect in future versions. + Add AP and Ad-hoc support for iwd Wi-Fi backend. + Warn about invalid settings in "NetworkManager.conf". + Support announcing "ANDROID_METERED" DHCP option for shared mode. + Support SAE authentication as used for 802.11s Meshing and WPA3-Personal. + NetworkManager is no longer installed as D-Bus activatable service. + Mark docker bridges as unmanaged via udev rule. + Add new PolicyKit permission "org.freedesktop.NetworkManager.wifi.scan" for controlling Wi-Fi scanning. - Rebase systemd-network-config.patch and nm-dont-overwrite-resolv-conf.patch. - Drop NetworkManager-1.12.2-docker-unmanaged.patch and NM-add-wifi-scan-polkit-rule.patch: Fixed upstream (bsc#1128560).- Do away with em dashes in summaries. - Combine %service_* calls to reduce generated boilerplate.- Update to version 1.14.6: + Fix memory corruption in internal DHCPv6 client (CVE-2018-15688). + No longer limit number of search entires in resolv.conf to 6. + Support restricting NetworkManager.conf device configuration based on used DHCP plugin. + Add "${MAC}" specifier for connection.stable-id. This uses the current MAC address for seeding the stable generation of MAC address, DHCP client-id or IPv6 stable-privacy interface identifier. + Support special value "duid" for "ipv4.dhcp-client-id". This generates an RFC4361-compliant client-id like the internal DHCP client used to do by default. Previously, there was no explicit name for such a client-id and it was not usable with dhclient DHCP plugin. This also generates the same client-id as systemd-networkd does by default. + Support and use a new kind of secret-key in "/var/lib/NetworkManager/secret_key". The secret-key represents the identity of the machine that is used for various purposes like generating IPv6 stable privacy addesses. It is now combined with "/etc/machine-id" so that changing only the machine-id results in new identifiers. That matters for example when cloning a virtual machine. Previously, the user hard to prune NetworkManager's secret-key to get a new identity, now regenerating machine-id suffices. Secret-keys generated by earlier versions of NetworkManager are not affected and keep their previous behavior. + Fix the DHCP client-ids based on the MAC address of IPoIB/infiniband devices. + Fix restoring IP configuration after interface went down. + No longer let NetworkManager touch rp_filter setting. The rp_filter sysctl must now be set outside of NetworkManager according to the admin's preference. Note that a strict rp_filter may break valid use-cases and interacts badly with connectivity checking. + Various bug fixes and improvements.- Add NM-add-wifi-scan-polkit-rule.patch: Adding a new polkit action "org.freedesktop.NetworkManager.wifi-scan" so that distributions can add specific rule to allow Wi-Fi scans (bsc#1122262, glfo#NetworkManager/NetworkManager!68).- Modify nfs script: Only mount/unmount when the file type is nfs (bsc#1074074, bsc#1146935).- Update to version 1.14.4: + Fix a crash in nmcli when a device is removed while being disconnected. + Fix a crash in ifupdown (Debian) configuration plugin. + Fix a daemon crash when a generated connection doesn't validate. + Fix a memory leak in dhclient DHCP plugin. + Fix line editing in nmcli password prompts. + Fix a RPATH in bluetooth and wwan plugin when built with Meson (otherwise they wouldn't find libnm-wwan.so).- Update to version 1.14.2: + Fix a bug that could cause NetworkManager to crash after checking connectivity status. + Correctly apply a default (-1) metric from DHCP. + Multiple fixes for IWD Wi-Fi backend. + Multiple fixes for builds with Meson build system. + Fix a crash with OLPC XO-1 mesh Wi-Fi. + Fix handling "serial.parity" and "serial.send-delay" properties in nmcli. + Improve auto-selecting device when activating a connection profile and don't auto-select unmanaged devices when activating multi-connect profile. + Avoid expiring the lifetime of IPv6 addresses from router advertisements.- Update to version 1.14.0: + Added support for IEEE 802.15.4 and 6LowPAN devices. + Support activating profile multiple times via connection.multi-connect setting. + Add match setting to restrict a profile to devices based on a list of interface names with globbing supported. + Fix PrimaryConnection for VPN with default-route. + Add support for ethtool offload features. + Add support for configuring llmnr. + Deprecate endian-dependent D-Bus API and add new API that can be used instead (rh#1153559). + Add support for ip6gre/ip6gretap IP tunnels. + Add support for detecting WireGuard interfaces (WireGuard VPN cannot be controlled via NetworkManager). + Add support for configuring SR-IOV devices. + Improve error reporting of activation when no device is available. + Support reapplying changes of the route metric. + Support EAP profiles with iwd Wi-Fi backend and support iwd API 0.8. + Expose slaves of OVS bridges and ports.- Add NetworkManager-1.12.2-docker-unmanaged.patch: Do not manage Docker bridge interfaces (glfdo#NetworkManager/NetworkManager!15)- Update to version 1.12.4: + Fix crash in connectivity check. + Fix accepted input format for vpn.secrets in nmcli's password file. + libnm: support private keys encrypted with AES-{192,256}-CBC. + Fix stopping pppd on modem hangup + Various minor bugfixes and translation updates. - Drop NetworkManager-fix-compile-error.patch and NetworkManager-remove-assertion.patch: Fixed upstream.- Add NetworkManager-fix-compile-error.patch: Fix compile error due to NM_AVAILABLE_IN_1_12_2 macro. - Add NetworkManager-remove-assertion.patch: cli: remove assertion in nmc_device_state_to_color() (bgo#796834).- Update to version 1.12.2: + Fix missing symbols in libnm ABI for settings. + Fix a regression that disallowed activations of VPN connections with a device specified. + Robustness fixes to connectivity checking. - Changes from version 1.12.0: + Improved support for configuration checkpoint, including support in libnm. + Added capability to set IP Tunnel configuration flags. + The systemd-resolved DNS plugins now supports MDNS. + Systemd-resolved and dnsmasq DNS plugins now honor the DNS priority setting (CVE-2018-1000135). + Wi-Fi devices now support FILS for speedier roaming support. + Drop dependency on libnl3 library. + Add support for "onlink" routes. + More robust connectivity checking. + Dropped the obsolete "ifnet" settings plugin, + Try harder to generate reasonable human-readable names for devices even if the hwdb contains garbage. + Add an "overview" option to hide default values in nmcli, resulting in more concise output. + Reworked the inner workings of D-Bus interface for better resource efficiency. + Add support for configuring nmcli coloring via terminal-colors.d(5). + Added experimental support for Meson build system. + Added initial IWD Wi-Fi daemon support. + A non-hexadecimal DHCPv4 client-id is now properly passed to dhclient with the first byte (type) set to zero, as stated in the documentation. This represents a change in behavior since previous versions where the first character of the string was used as type. The internal client is not affected by the change. + DNS setting rc-manager=file now always follows dangling symlinks instead of replacing /etc/resolv.conf with a plain file. + Added wake_on_wlan connection setting to configure wake-on-wireless-lan (WoWLAN). + The libnm-glib library, deprecated in favor of libnm since NetworkManager 1.0, is now not built by default. While it can still be enabled, the distributions should have a good plan for removing it if they need to keep shipping it at this point. + Nmcli now scans for Wi-Fi networks before displaying them, if the last scan was too long ago. + Added the ipv6.dhcp-duid property to allow configuring the DHCPv6 DUID. + Extended ipv6.dhcp-client-id property to support DHCP client identifers depending on the MAC address and the stable ID. + Set NM_DISPATCHER_ACTION environment variable in dispatcher scripts. - Rebase NetworkManager-1.10.6-netconfig.patch and systemd-network-config.patch with quilt. - Disable networkmanager-obs-net.patch and make check, needs rebase. - Pass with-libnm-glib to configure, deprecated libnm-glib support is no long built by default, and since we can not remove this yet due to Steam, we pass this option for now.- Update to version 1.10.10: + Fix crash during reapply of connection settings. + Minor bugfixes.- Don't fall back to writing /etc/resolv.conf if launching netconfig fails for some reason (boo#1092352, NetworkManager-1.10.6-netconfig.patch).- Update to version 1.10.8: + Fix connectivity timeout handling (bgo#794464). + Retry activating devices when the parent becomes managed (rh#1553595). + Correctly set the rp_filter value (rh#1565529). + A fix to ensure teamd is respawned after daemon restart (rh#1551958). + Better handle DHCP expiry (bgo#783391). + Fix configuration of IPv6 over master interfaces (rh#1575944). + Other various bug fixes including possible crashes. + Updated translations. - Drop NM-look-at-all-rp-filter-value.patch: Fixed upstream.- Add NM-look-at-all-rp-filter-value.patch: look at 'all' rp_filter value too to determine actual value (bsc#1084336, bgo#794689).- Unconditionally enable translation-update-upstream: on Tumbleweed, this results in a NOP and for Leap in SLE paid translations being used (boo#1086036).- Update to version 1.10.6: + ovs: fix compilation issue of OVS plugin and various fixes. + team: add support for team runner "random". + core: cleanup activation of device (rh#1537160). + dhcp: retry indefinitely to renew the lease (rh#1503587). + core: fix blocking autoconnect for no-secrets (bgo#794014). + libnm: mark async results as cancelled (bgo#794088). + Various bug fixes including possible crashes. + Updated translations. - Drop nm-preserve-agent-owned-secrets-on-connection-update.patch, NetworkManager-1.10.4-buildfixes.patch and nm-fix-autoconnect.patch: fixed upstream.- Add nm-fix-autoconnect.patch: Fix autoconnect with agent-owned secrets (bgo#794014, boo#1079672).- fix nfs dispatcher script (boo#1083831)- Modernize spec-file by calling spec-cleaner- Add nm-preserve-agent-owned-secrets-on-connection-update.patch: Backport upstream commit to preserve agent-owned secrets on connection update (bgo#793324, bsc#1082762).- Update to version 1.10.4: + Load jansson at runtime. This solves a clash with json-glib that caused a gnome-control-center crash, but also gets rid of a hard dependency. + Correct nmcli exit values after receiving a signal. + Fix libnm secret agent asynchronous initialization. + Add a default route for a modem even if it didn't sent a gateway. + Improve communication of DAD failures. + Remember device default metrics across daemon restarts. + Various bug fixes including possible crashes. + Updated translations. + Add NetworkManager-1.10.4-buildfixes.patch: Fix OVS compile errors (bgo#793183).- Replace sysconfig with sysconfig-netconfig BuildRequires and Requires, this is what we in reality need.- Update to version 1.10.2: + Added support for 'onlink' IPv4 routes attribute. + Wait longer for the carrier to come up after a MTU change. + Implemented abstraction for team connections that exposes team configuration items as distinct properties. + Added basic support for tc queueing disciplines and filters. + Introduced an Update2() D-Bus method to update connection settings with more flexibility. + Many bug fixes and improvements. - Changes from version 1.10.0: + NetworkManager includes now basic OpenVSwitch support, good enough to be capable of setting up simple OpenVSwitch configurations. + Added support for activating PPP connections on non-Ethernet interfaces. + It is now possible to authenticate to a Wi-Fi network using WPS (Wi-Fi Protected Setup). + Implemented support for Wi-Fi PMF (Protected Management Frames, 802.11w), which can be configured via the wifi-sec.pmf property. + Now the maximum rate of wireless access points supporting 802.11 is properly calculated and exposed on D-Bus. + Background scanning is now disabled for non-WPA-Enterprise Wi-Fi networks. + Added support for the Bluetooth NAP (Network Access Point) profile. + Added support for disabling connectivity checking via the D-Bus interface. + The internal DHCP client now understands the domain-search option. + Bridge connections support the group-forward-mask property. + NetworkManager can now configure multiple IPv6 default routes received through RA and each gets configured with the announced preference. + It is possible to specify the routing table for each static route. + Support specifying a explicit routing table for any non-static-route, including routes from DHCP, device-routes, IPv6 autoconf. + Device are left configured when a user sets them as unmanaged by NetworkManager. + New connection.auth-retry property to configure how often authentication is prompted before failing the configuration. + The platform code that handles synchronization with kernel status via netlink has been reworked and is more efficient. + Allowed the update of connections that have an associated ifcfg-rh routing rules file. + Non-UTF8 properties are now escaped when they are exported on D-Bus. + NetworkManager-wait-online.service now starts NetworkManager.service if needed. + The MAC address for bond connections can be changed in nmtui. + Fixed dependency problems when setting the MTU of VLAN and master devices. + The systemd-resolved DNS plugin properly handles the DNS priority setting. + Fixed setting a DHCP timeout greater than 60 seconds (dhclient). + Fixed some memory leaks. + Many other bug fixes and improvements. - Rebase networkmanager-obs-net.patch and nm-dont-overwrite-resolv-conf.patch. - Drop nm-disconnect-proxy-signals.patch and nm-vpn-remote-connection-disconnect-signals.patch: Fixed upstream.- Update to version 1.8.6: + Fix a daemon crash on permission check (bgo#787897). + Fix a daemon crash on VPN state change (bgo#787893). + Fix a nmcli crash in interactive mode's describe command (bgo#788104). + Fix termination of the nmcli interactive mode (rh#1517401). + Properly handle route metric of zero in keyfiles. + Add support for DSA switch devices (rh#1371289). + Fix a memory leak of connection D-Bus objects (rh#1461643). + A double close that could potentially race with the D-Bus thread reusing the same file descriptor (rh#1451236). + Connectivity check fixes (bgo#785281) (bgo#784629). + Fix the metered properties handling in libnm. + Avoid dropping agent secrets unnecessarily (bgo#789383). + Fix the asynchronous initialization of a secret agent in libnm. - Drop nm-disconnect-proxy-signals.patch and nm-vpn-remote-connection-disconnect-signals.patch: Fixed upstream. - Minor spec cleaning, tweak spec to silence a few rpm lint warnings. - Replace addFilter("dbus-policy-missing-allow") with addFilter("dbus-policy-allow-without-destination"), filter out the current rpmlint warning. - Add addFilter("suse-branding-unversioned-requires*") to rpmlintrc, we have this unversioned on purpose. - Add addFilter("systemd-service-without-service_add_post NetworkManager-wait-online.service") addFilter("systemd-service-without-service_add_pre NetworkManager-wait-online.service") addFilter("systemd-service-without-service_del_postun NetworkManager-wait-online.service") addFilter("systemd-service-without-service_del_preun NetworkManager-wait-online.service") to rpmlintrc, filter out warnings we do not care about nor want as we do not want to enable this service by default. - "Mark" %%{_sysconfdir}/dbus-1/system.d/org.freedesktop.NetworkManager.conf and %%config %{_sysconfdir}/dbus-1/system.d/nm-dispatcher.conf as config files in spec, silence rpmlint.- Add nm-disconnect-proxy-signals.patch: disconnect proxy signals when closing; fixes possible crash when opening the user panel (bgo#787897). - Add nm-vpn-remote-connection-disconnect-signals.patch: disconnect signal handlers when remote/vpn connections are disposed; fixes a gnome-control-center crash (bsc#1073472 bgo#787893).- Remove reference to deprecated and dropped ifcfg-suse plugin from configuration.- Switch to python3: + Replace BuildRequires python-gobject, python2-dbus-python with python3-gobject, python3-dbus-python. + Explictly set environment variable PYTHON as python3 in build time.- Modify nm-dont-overwrite-resolv-conf.patch: make netconfig call an atomic action, don't kill it after 2000ms (bsc#960153).- Update to version 1.8.4: + No longer install NetworkManager-wait-online.service in network-online.target.wants directory (rh#1455704). + Fix nmcli device connect wifi for APs that support both WPA-PSK and WPA-EAP (rh#1492064). + Fix crash unregistering object manager in libnm on restart of NetworkManager. + Improve handling externally managed slaves devices. + Don't reset MAC address of software devices to fake permanent address. + For dhclient use "timeout" option in configuration file, instead of the command line option which is only supported by downstream. + Perform the public-suffix check only for the hostname-derived domain. + Fix memory leak in connectivity check. + Better restore device managed state on rollback of checkpoint. + Skip addition of default-route if it already exists. + Bug fix detecting error condition when deleting route in platform. - Drop NM-dhcp-improve-parsing-interface-statement.patch: Fixed upstream.- Add NM-dhcp-improve-parsing-interface-statement.patch: Fix NM not writing DNS servers to /etc/resolv.conf (boo#1047004).- Update to version 1.8.2: + Fix bug blocking startup wrongly waiting for carrier. + Fix handling of non UTF-8 strings in libnm and fix non NUL terminated string. + Handle DNS priority for systemd-resolved DNS plugin. + Fix assuming master devices as they wait for slaves to activate. + Fix reading managed state from device state file. + Fix crash activating bluetooth or WWAN connection. + No longer add a direct route to the DHCP server. + Several bug fixes and improvements.- Call autogen.sh networkmanager-obs-net.patch touches the build system.- Add nm-dont-overwrite-resolv-conf.patch: Fix NetworkManager overwriting /etc/resolv.conf (bsc#960153, bsc#1021665).- Disable 6 of the tests that are failing on OBS runs * networkmanager-obs-net.patch- Version update to 1.8.0: * Default routes set by devices that failed connectivity checks are now penalized with a higher metric * nmcli is now able to produce output more friendly for machine parsing * The slaves available at the time a master connection is activated are enslaved in a stable order, making the automatic MAC address for Bonding devices more predictable. * Hostname management is now more flexibly configured * Support for additional route options (pref-src, src, tos, window, cwnd, initcwnd, initrwnd, mtu, lock-window, lock-cwnd, lock-initcwnd, lock-initrwnd, and lock-mtu). * Fixed detection of EAP-FAST support in wpa_supplicant * Support for handling PINs for PKCS#11 tokens as secrets * GSM and CDMA connections now have a MTU property * An option to disable selected TLS versions during EAP phase 1 authentication * The 802.1x authentication timeout is now configurable to allow a faster fallback to other connections * Persist managed state of device until reboot. This improves seamless take over of a previously managed device after restart of NetworkManager. * Better handle devices that are externally managed by somebody else by consistently generating an in-memory connection to reflect the external state. * Expose SRIOV capability of a device on D-Bus and support configuring the number of virtual functions via NetworkManager.conf. * Support matching networking devices via new "driver:" device spec in NetworkManager.conf. * Introduced support for creating and managing dummy links * The teaming devices now support setting a hardcoded MAC address * Settings of bonding devices can now be modified on-the-fly, without the need to reactivate a connection * The failures to activate a connection now communicate better error responses to nmcli * Reverse Path filtering is now disabled in multihoming configurations where it would interfere with legitimate network traffic * libcurl is used instead of libsoup for connectivity checking, resulting in a smaller dependency footprint * With DNS mode "rc-manager=symlink", don't write /etc/resolv.conf as a symlink if it already exists as a regular file. * Support attaching user-data in form of key-value pairs to connection profiles. * Fix accpeting fully qualified name for ipv4.dhcp-hostname setting. * Make NetworkManager more forgiving to failure to change the MAC address during scanning. - Wimax switches are completely removed - Added dependencies on packages with versions to ensure all features are properly detected, configure reports yes for most items now * add libcurl * add libpsl * add python-dbus test dep - Remove gudev and soup deps as per upstream changes - Enable testsuite - Add patch networkmanager-checks-po.patch: * Our patch added new .in file that needs to be excluded from translations- Replace nfs NetworkManager dispatcher script. Issues of the old nfs dispatcher script, fixed by this commit: + It only mounts NFS shares with auto-mount. In SUSE's default configuration, those are tried to be mounted at boot. Unfortunately, this would not work, when NetworkManager handles the connection later. The boot process stops at this point. + It unmounts everything on each "down" for any network interface, even if the NFS share is still connected to the computer via another network interface.- Update to version 1.6.2: + Fixed build warnings with GCC 7. + Multiple bug fixes in NetworkManager, nmcli and nm-online including several crashes.- Update to version 1.6.0: + No further changes since rc2 (1.5.91).- Update to version 1.5.91: + Bugs fixed: bgo#777402, rh#1406454, rh#1414186.- Update to version 1.5.90: + Avoid reading the permanent MAC address before the device is initialized by UDEV. This avoids a race where NetworkManager might detect the MAC address of the wrong interface. + Fixed race conditions when renaming interfaces, for example as done by UDEV for persistent interface naming. This could cause detecting devices as the wrong hardware type. + Added initial support for PKCS#11 tokens with 802.1x authentication. + The stable-addressing for MAC address randomization and RFC7217 IPv6 stable privacy addressing can now be more flexibly configured using dynamic randomization seeds in "connection.stable-id". + Added support for managing the MACsec links. Requires support in wpa_supplicant (version newer than 2.6). + When the master of Team, Bridge and Bond devices is specified as a connection UUID, the ifcfg-rh plugin now writes the master connection's interface name into the ifcfg file for improved compatibility with the legacy network service. + Improve handling of MTU by resetting the previous MTU when the device deactivates and reset the MTU to a defined value on activation. + Improve tracking of parent devices for dependend devices like ip-tunnels, MACVLAN, VETH, VLAN, and VXLAN. + Many bug fixes and improvements.- Update to version 1.5.3: + The cloned.mac-address property can now be used with Bond and Bridge devices. + The ifcfg parsing code has been reworked for better compatibility with actual shell variable files. + The ipv6.method=shared is now supported, utilizing DHCPv6 Prefix Delegation option to obtain prefixes for the interface. + nmtui now supports creating and editing IP tunnel connections. + The libnm client library now uses the D-Bus ObjectManager API that allows for quicker initialization of the clients. + nmtui now utilizes the asynchronous libnm client API to paralellize communication with the daemon, reducing the client startup time. + Ethernet devices now use "802-3.speed" and "802-3.duplex" properties to allow controlling overriding the negotiated link parameters. + Order in which IP addresses are configured is now preserved so that primary address is selected correctly. + The PPP manager can now be split into a separate package. + Details of the DNS information obtained from the connections is now exposed on the D-Bus and can be inspected with nmcli. + Added the support for DHCPV6_HOSTNAME and DHCPV6_SEND_HOSTNAME keys in ifcfg files that control "dhcp-hostname" and "dhcp-send-hostname" properties of the "ipv6" setting. - Add python-gobject BuildRequires: needed in order to build the settings documentation.- Update to version 1.5.2: + Introduced Vala bindings for libnm. + NetworkManager would now keep most connections up on shutdown (except Wi-Fi connections, VPN connections and other kinds that can't be assumed on startup) + The checkpoint/restore connection can now also remove new connections and disconnect devices that were activated since the checkpoint was taken. + The configuration is now read from /run/NetworkManager/conf.d as well. This is useful for handing over configuration discovered on system startup to NetworkManager. + New connection.autoconnect_retries property that allows fine-tuning the autoconnect behavior. + Support for configuration and discovery of Web Proxy settings with PacRunner service. + Support for systemd-resolved local DNS forwarder backend. + Fix emission of NM-style PropertiesChanged signals and deprecate them for PropertiesChanged on "org.freedesktop.DBus.Properties" interface. + Change the meaning of unset "cloned-mac-address" settings from "permanent" to "preserve". This changes the default value and affects existing connections during upgrade that did not explicitly configure cloned-mac-address. This has the effect that externally configured MAC addresses are preserved by default instead of setting the permanent address (bgo#770611).- Update to version 1.4.4: + Order in which IP addresses are configured is now preserved so that primary address is selected correctly. + Don't deconfigure devices we can take over on shutdown. Makes it possible to restart without connection disruption for most device types. + Avoid reading the permanent MAC address before the device is initialized by UDEV. This avoids a race where NetworkManager might detect the MAC address of the wrong interface. + Fixed race condition when renaming interfaces, for example as done by UDEV for persistent interface naming. This could cause detecting a Wi-Fi interface as ethernet. + Fixed a race condition in libnm that could cause a client hang if a last value from a property of object array type disappeared. + Fixed a possible nmcli hang on D-Bus object fetch failure. + Other fixes and improvements.- Update to version 1.4.2: + Fixed emission of NM-style PropertiesChanged signals and deprecated them for PropertiesChanged on "org.freedesktop.DBus.Properties" interface. + Fixed race condition in the communication between NetworkManager and the DHCP helper which caused loss of events. + Added workaround for failures in changing MAC address with some wireless drivers. + Improved bash autocompletion. + Restored check on JSON syntax when built with Jansson support. + Fixed a regression in the serialization of empty "cloned-mac-address" property in libnm. + Other fixes and improvements. - Drop NetworkManager-fix-broadcom-wifi.patch: Fixed upstream.- Add even more commits to really fix bgo#770456 to NetworkManager-fix-broadcom-wifi.patch.- Add NetworkManager-fix-broadcom-wifi.patch: Broadcom driver does not support the random mac addr introduced. This patch works around the problem (bgo#770456). - Conditionally apply translations-update-upstream BuildRequires and macro for non-openSUSE only.- Update to version 1.4.0: + The MAC address assigned to a device can now be set according to different policies: preserve, permanent, random, stable. + NetworkManager now waits for IPv6 DAD to terminate before completing the activation. + Added support for setting IPv6 tokenized interface identifiers through the 'ipv6.token' connection property. + Added a 'Reload' D-Bus method to reload configuration and reapply DNS configuration. + Added ability to create a configuration checkpoints and rolling back changes after a timeout. + NetworkManager now follows symlinks when accessing resolv.conf and rc-manager is set to 'file'. + Added support for oFono as modem manager. + The devices now exposes counters of transferred data. + The 'may-fail' property of ipv4 and ipv6 settings is now respected more accurately. + The timeout for requests of secrets to agents has been increased from 25 to 120 seconds. + Name servers passed to dnsmasq now specify an egress interface to avoid problems with multiple active connections. + Reverse DNS entries for IPv6 are now added to dnsmasq, and IPv4 reverse entries now honor the network prefix. + A new 'dns-priority' property of ipv4 and ipv6 settings can be used to tweak the order of servers in resolv.conf when multiple connections are active. + configure script accepts --enable-{address,undefined}-sanitizer options to build NetworkManager with GCC sanitizers. + The default resolv.conf manager can now be specified at build time using the --with-config-dns-rc-manager-default configure option. + NetworkManager is now compiled with --gc-sections to reduce executable size. + Added a new 'VPN_PLUGIN' logging domain. + It is now possible to change the configuration currently applied on a device with 'nmcli device modify' and 'nmcli device reapply'. + nmcli invoked without parameters shows an overview of the current network configuration. + The 'nmcli connection add' syntax has been extended and is now possible to pass properties (e.g. 'ipv4.dns') along with aliases. + nmtui now returns to initial menu after a sub-form exits. + Improved bash autocompletion for nmcli. + Now devices are disconnected before the system suspends, executing dispatcher scripts. This allows external applications to be notified of the change in connectivity. + Dispatcher scripts are now called also when connectivity status changes. + Many other fixes and improvements. - Pass --with-config-dns-rc-manager-default=netconfig to configure: ensure to use netconfig, which is SUSE's default. - Replace pgkconfig(systemd) BuildRequires with pkgconfig(libsystemd), following upstream. - Rebase systemd-network-config.patch.- Update to version 1.2.2: + The dnsmasq DNS management mode now uses D-Bus API of dnsmasq to make signal nameserver changes. + Hostname is now correctly read on Slackware. + IPv6 addresses for default wired connections now stay stable. + Reading portname on s390 systems on 4.4 kernels and newer has been corrected. + nmcli no longer warns about version mismatches. + Improved developer documentations. + Multiple minor bugfixes. + Updated translations.- Update to version 1.2.0: + Bugs fixed: bgo#764750, bgo#764955, bgo#764956, bgo#765225, rh#1325752. - Changes from version 1.1.94 (1.2-rc2): + Bugs fixed: bgo#764839, bgo#764690, rh#1324895. - Add post/postun scritlets for libnm0.- Update to version 1.1.93 (1.2-rc1): + Bugs fixed: bgo#761389, bgo#763236, bgo#764317, bgo#764332, bgo#764398, bgo#764402, bgo#764483, bgo#764606, rh#1299103. + Updated translations. - Changes from version 1.1.92: + Added an option to enable the old-fashioned /etc/resolv.conf handling (using a symlink). + NetworkManager now checks the connection data from client for validity and gracefully handles unknown properties in client. This improves interoperability between the server and clients of different versions. + The activation of a VLAN device with a virtual parent that is inactive now results in a parent being activated first. + The server name used with 802.1x authentication can now be constrained to a particular domain suffix (CVE-2006-7246). - Drop (presumably) no longer needed patches: + nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff + nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff- Update to version 1.1.91: + Added support for detecting duplicate IPv4 addresses, with a timeout configurable through the ipv4.dad-timeout connection property. + Fixed a race condition that could potentially lead to unauthorized access to connection secrets (CVE-2016-0764). + dnsmasq configuration for shared connections can now be extended by placing custom files in /etc/NetworkManager/dnsmasq-shared.d/. + Generic devices are no longer assumed unless explicitly requested by user. + The reorder-header VLAN flag setting is now honored; to keep backwards compatibility in behavior, an existing REORDER_HDR=0 ifcfg-rh key is ignored; the flag must be disabled with VLAN_FLAGS=NO_REORDER_HDR. + Fair amount of bugs was fixed and robustness was generally improved. - Rebase systemd-network-config.patch.- Update to version 1.1.90: + Added an option to enable use of random MAC addresses for Wi-Fi access point scanning (defaults to disabled). Controlled with 'wifi.mac-address-randomization' property (MAC_ADDRESS_RANDOMIZATION key in ifcfg files). + Wi-Fi scanning now utilizes wpa_supplicant's AP list. + Added support for Wi-Fi powersave, configured with POWERSAVE key in ifcfg files. + Added support for creation of more types of software devices: tun & tap, maxvlan, vxlan and ip tunnels (ipip, gre, sit, isatap, vti, ip6ip6, ipip6, ip6gre and vti6). + The software devices (bond, bridge, vlan, team, ...) can now be stacked arbitrarily. The nmcli interface for creating master-slave relationships has been significantly improved by the use of 'master' argument to all link types. + RFC7217 stable privacy addressing is now used by default to protect from address-based host tracking. The IPv6 addressing mode is configured with IPV6_ADDR_GEN_MODE key in ifcfg files. + Improved route management code to avoid clashes between conflicting routes in multiple connections. + Refactored platform code resulting in more robust interface to platform, less overhead and reduced memory footprint. + Improved interoperability with other network management tools. The externally created software devices are not managed until they're activated. + The Device instances now exist for all software connections and the platform devices are now only created when the device is activated. This makes it possible for connections with device of same name not to clash unless they're activated concurrently. The links are now not unnecessarily present unless the connection is active, avoiding pollution of the link name space. + NetworkManager now correctly manages connectivity in namespace-based containers such as LXC and Docker. + Support for configuring ethernet Wake-On-Lan has been added. + Added LLDP listener functionality and related CLI client commands. Enabled via LLDP option in ifcfg files. + CLI secret agent has been extended with support for VPN secrets. + The command line client now utilizes colors for its output. + The command line client now sorts the devices and properties for better clarity. + Numerous impovement to Bash command completion for nmcli. + NetworkManager relies on less external libraries. The use of dbus-glib has been replaced with gio's native D-Bus support and libnl-route is no longer used. + Dependency on avahi-autoipd has been dropped. Native IPv4 link-local addressing configuration based on systemd network library is now used instead. + Hostname is now managed via systemd-hostnamed on systemd-based systems. + Management of resolv.conf management can be changed at runtime, private resolv.conf is always written in /run. + DNS options in resolv.conf are now honored. + Updated version of systemd network library used for internal DHCP and IPv4 link-local support. + Support for event logging via audit subsystem has been added. + Support for native logging via systemd-journald has been added taking advantage of its structured logging. + Live reconfiguration in IP configuration after changing the settings without reactivation of the device with "nmcli device reapply" command and via D-Bus API. + The API for VPN plugins now supports multiple simultaneous connections. Most popular VPN plugins have been updated to support this functionality. + The libnm library now provides API to access VPN service definitions. + Fair amount of bugs was fixed and robustness was generally improved. + New DHCP_FQDN key in ifcfg files to configure the full FQDN to be sent to the DHCP servers. + Added multicast_snooping option to BRIDGING_OPTS ifcfg key. - Pass --enable-gtk-doc to configure: needed to have the man pages built. - Remove --enable-ifcfg-suse configure parameter: the ifcfg-suse plugin has been deprecated. - Add perl(YAML) BuildRequires: dependency to build the documentation. - Rebased systemd-network-config.patch. - Drop NetworkManager-geoclue-interaction.patch: the patch has side effects when geoclue itself is not installed. - Drop NetworkManager-openvpn-route-configuration.patch: no longer required. - Drop nm-ppp-manager-clear-ppp_watch_id.patch and nm-update-ip_iface-only-if-IP-interface-exists.patch: fixed upstream. - No longer recommend avahi-autoipd: the functionality is no longer needed. - Flip with_cacert_patch off (set to 0): patch needs rebase.- Modify nm-probe-radius-server-cert.patch: Make sure the "Apply" button in Wifi configuration page of gnome-control-center is clickable (bsc#985332).- Move provides NetworkManager(cacert-patch) to libnm-util2, to ensure gnome-control-center doesn't hard requires NetworkManager.- Update to version 1.0.12 (FATE#318572) - drop nm-core-fix-crash-during-Wi-Fi-rescan-by-emitting-NM_DE.patch contained in version 0.9.9.1. - Rebase NetworkManager-geoclue-interaction.patch - Rebase nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff - Rebase nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff - Rebase systemd-network-config.patch - Rebase nm-probe-radius-server-cert.patch- nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff rebased._ Update to version 1.0.12: + DHCP leases on software devices are now renewed when the computer is awoken from suspend. + Improved ifupdown plugin robustness and interoperability on Yocto and OpenEmbedded. + Fixed failed VPN activations when plugin supports interactive mode, but the VPN daemon does not. + Wi-Fi monitor interfaces are now ignored, not turned into managed mode. + AP and AdHoc mode connections with manual IP configuration are now able to autoconnect. + Broken device drivers (AWS ENI) that initially have invalid MAC addresses are now properly managed as soon as correct MAC address is set. + WWAN devices are unlocked a bit earlier so that supported IP versions can be queried. + The NetworkManager.service was ordered after network-pre.target and dbus.service. This ensures NetworkManager doesn't set up connectivity before firewall rules are in place and wouldn't exit before remote filesystems can be umounted ensuring orderly operation of systemd managed installations. + The netfilter rules used with shared IPv4 method are now removed on exit. + Ability to manage USB gadget drivers (UDC side) has beed added. + Infiniband transport mode change now takes place with the link set down because some drivers need that. + Race conditions that could disclose connection secrets to authenticated local users when changing ifcfg and keyfile connections have been fixed. This has security impact of low severity (CVE-2016-0764). + A handful of memory leak and crasher bugs of minor importance have been fixed. - Drop patches incorporated upstream: - NetworkManager-openvpn-route-configuration.patch. - nm-ppp-manager-clear-ppp_watch_id.patch. - nm-update-ip_iface-only-if-IP-interface-exists.patch. - Rebase systemd-network-config.patch for updated version.- nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff rebased.- Split out a NetworkManager-branding-upstream subpackage that installs the default upstream version of the /etc/NetworkManager/NetworkManager.conf file. - Add Requires: NetworkManager-branding to main package.- Add nm-ppp-manager-clear-ppp_watch_id.patch and nm-update-ip_iface-only-if-IP-interface-exists.patch: Patches from upstream git cherrypicked to stable branch from master.- Add NetworkManager-openvpn-route-configuration.patch: Fix routes not being applied when connecting to openVPN.- Add explicit pkgconfig(libteam) BuildRequires: force team connection support.- Update to version 1.0.10: + Added support for handling VPN secrets to nmtui and nmcli agent. + Fixed a regression that caused NetworkManager to ignore external deletion of a device with master. + Fixed glitches with older versions of glib (prior to 2.36.0). + Fixed build with most recent versions of libsoup. + Fixed busy retry loop on non-transient errors from wpa_supplicant. + Improvements to testing infrastructure. + Updated translations.- Update to version 1.0.8: + MTU indicated by a VPN gateway is now properly applied. + Fixed MSS setting when MTU changes. + The default route is properly restored on device disconnect. + Build with older toolchains has been fixed. + The team devices can now properly be enslaved to bridges. + Failed DHCP attempts for assumed connections are now retried after a timeout. + Default wired connection is now created after udev registers the device. + Support for Bluetooth DUN devices with Bluez 5 has been fixed. + The ipv6.ignore-auto-dns property is now properly honored making it possible to override automatically obtained name servers. + Invalid permanent MAC adddresses as reported by some devices are now ignored. + Device links reported by more recent versions of Linux kernel that reside in different network namespaces are no longer confused with links in the namespace NetworkManager runs in. + MAC address changes of VLANs enslaved to a bond are now properly propagated to the master device. + Fixed error handling for teaming devices with invalid configuration. + Wi-Fi AP list is now updated correctly after AP mode has been used. + Management of a device is not attempted until the device has been registered with udev. + The error handling for VPN secret agents is now significantly more robust. + Detection of s390 CTC devices now works properly. + A GATEWAY property in /etc/sysconfig/network now no longer affects non-static connections. + Added support for IPv6-only VPN connections. + The systemd service now uses HUP signal to reload configuration. + Change VLAN default flags to set REORDER_HDR for new connections. + nmtui is now able to ignore automatically configured routes. + Numerous bash shell autocompletion fixes for nmcli. + Allow setting IPv6 and PPP settings for GSM and CDMA connections via nmcli. + Added support for adding ADSL connections in nmcli. + Numerous crash fixes. + Updated translations. - Rebase NetworkManager-geoclue-interaction.patch.- Update to version 1.0.6: + Improved capture portal detection. + Default route through WiFi connection is now preferred to Mobile Broadband if both are available. + Expose a flag to determine whether a particular connection is metered via API and client tools. + Add support for locking connections to a channel within a particular band. + Add support for configuring Wake-on-LAN capabilitites. + Allow overriding the MTU for team device. + Usual pile of bug fixes and robustness improvements. - Rebase NetworkManager-geoclue-interaction.patch .- Toggle with_cacert_patch to 1: the patch has been rebased.- Change nfs dispatcher-script to be more reliable in mixed ip v4 v6 environments.- Rebase nm-probe-radius-server-cert.patch for 1.0.4 (bsc#938198).- Add explicit pkgconfig(udev) BuildRequires: we need it to define %{_udevdir}.- Update to version 1.0.4: + The MTU setting from an IPv6 neighbor discovery Router Advertisements is now ignored if applying it would result in invalid configuration. + Some configuration options can now be changed without restarting the daemon. Notably, this applies to 'dns', 'connectivity' and 'ignore-carrier' settings. + The connection activation was made more robust. If an active connection is reactivated, the device it's active on takes precedence. If an attempt is made to activate a connection on a different device than it is active on, the activation proceeds removing the connection from the active device. + The device specifiers in configuration files now support negation via 'except:' match. + Devices that only have IPv6 link-local address are no longer assumed to be connected. + nmcli now provides hints and tab-completion for enumeration properties. + If the IPv6 interface tokens are set they are honored when creating an interface identifier for IPv6 addressing. + NetworkManager now maintains correct routing configuration when multiple interfaces are connected to the same network. + The management of devices can now be controlled with udev rules. The veth devices as well as the virtual Ethernet devices of various virtualization tools (VMWare, VirtualBox, Parallels Workstation) are now ignored by default. + The IPv6 privacy extensions are now enabled by default and handling of the ip6-privacy sysctl has been improved. + Activating a Bond, Bridge or Team device can now optionally activate the slave connections as well. The behavior is controlled with 'connection.autoconnect-slaves' property. + The platform support code has been refactored, resulting in better scalability in large configurations. + Changes to network interfaces configuration done outside NetworkManager are now picked up and exposed to the user via NetworkManager API and tools. + A connection can now optionally leave externally configured default route in place instead of overriding it. The behavior is controlled with 'ipv4.never-default' and 'ipv6.never-default' properties. + Multiple crasher and memory leak bugs in the daemon were fixed. + Multiple bugs that could cause the client tools to hang or crash were fixed. + nmcli allows multiple devices for 'nmcli device disconnect/delete'. + Firewall zone is added to firewalld for device-based VPN connections too. - Toggle with_cacert_patch to 0: the Radius CA patch neeeds to be reworked. Wrap applying the patch into a with_cacert_patch condition, to make enabling/disabling a one-stop change.- Update to version 1.0.2: + Wi-Fi devices now indicate support for 2GHz and 5GHz frequencies. + "nmcli device" output now indicates physical port ID + New config items added to the 'ifcfg-rh' plugin: - IPV4_ROUTE_METRIC and IPV6_ROUTE_METRIC. - DEVTIMEOUT. - IPADDR and PREFIX are now supported for specifying address ranges of shared IPv4 connections. + Dispatcher scripts now get a CONNECTION_FILENAME variable with the path to the configuration file for the connection. + An example dispatcher script that is able to apply complex routing rules (such as setting up policy-based routing) for 'ifcfg-rh' connections was added to examples/dispatcher/. + 'mode' key of Bond device options property now accepts numeric values. + Connection attempts for devices without carrier on startup now wait for carrier to appear within a short timeout instead of failing immediately. This makes system startup more robust. + Bridge connectivity is now properly restored on resume from suspend. + The D-Bus name is acquired earlier during the daemon startup. This makes it possible for the systemd service manager to optimize the service startup so that services that require networking are activated sooner contributing to faster system start up time. + A lot of memory leak problems were fixed, resulting in reduced memory usage. Many of them were discovered as a result of improvements in use of Valgrind in the testing infrastructure. + Management of 'teamd' daemon instances for Team devices is now more robust. + The 'dnsmasq' daemon respawns when it terminates and it is configured for management of DNS resolver configuration. + Hostnames that are not fully qualified are no longer sent to a DHCPv6 server for a dynamic DNS update. + Connection UUIDs are now checked for uniqueness when connection configurations are read. + Receipt of a NDP Router Advertisement can no longer lower the IPv6 hop limit (CVE-2015-2924). + Many other bugs were fixed. + Updated translations.- Add NetworkManager(cacert-patch) provides: to be toggled to 0 whenever we disable nm-probe-radius-server-cert.patch. Other packages that consume the ABI introduced by this patch can specify this as a requirement.- Reabse nm-probe-radius-server-cert.patch- Add rp-pppoe BuildRequires, so configure can autodetect the path to the pppoe binary. - Recommend rp-pppoe: the program is needed for NetworkManager to be able to initiate PPPoE connections (commonly used by ADSL providers). It is not strictly required to operate NM in most setups, thus only recommended (boo#903553).- Update to version 1.0: + A new 'libnm' GObject-based client library to replace libnm-util/libnm-glib: - IP address, IP route, hardware address, and other properties are now represented as strings. - Based on GIO's GDBus bindings instead of dbus-glib. - Uses modern GObject APIs including GAsyncResult and GVariant. - See https://wiki.gnome.org/Projects/NetworkManager/libnm. + Devices and VPN connections now have individual default routes. Priorities are handled through configurable route metrics. + nmcli now supports password requests and PolicyKit authorizations. + A faster, lighter-weight (though less capable) internal DHCP client has been added and may be selected with the "dhcp=internal" option. It supports fewer DHCP options and does not yet support DHCPv6. + A new 'configure-and-quit=yes' option has been added for environments with less dynamic network configuration. + When running on 3.17 and later kernels, NetworkManager handles IPv6LL address assignment to ensure that IPv6 connectivity is not enabled until intentionally configured by the user. + NetworkManager no longer causes the nl80211 kernel module to be loaded on systems with no Wi-Fi devices. + Bluetooth DUN support now works with Bluez 5.x. + VPN connections can now persist across link changes and suspend/resume if their VPN plugin supports this feature. + A new 'ibft' settings plugin has been added to support firmware-based iBFT/iSCSI configurations. This functionality has been moved to 'ibft' from the 'ifcfg-rh' plugin. + IPv6 router advertisement MTUs are now respected. + NetworkManager no longer requires polkit libraries at runtime when Polkit support is enabled, and Polkit can be disabled at build time too. + Automatically created connections are now deleted when their device goes away. + 'nmcli dev connect' now attemts to create a connection if none exists. + Manually configured static IPv6 configuration is kept even if SLAAC fails. + Manpages for the 'keyfile' and 'ifcfg-rh' plugins now describe their configuration syntax and available options. + WWAN connections now support IPv6 if the modem and provider support IPv6. + Software devices (bridge, bond, team, etc) can now be deleted from the D-Bus API or with nmcli. + The manpages, documentation, and API annotations have received many cleanups. + Externally created virtual interfaces are no longer managed by NetworkManager until they are set "up" or activated via nmcli. - Disable nm-probe-radius-server-cert.patch for now: needs rebase. - Drop 0001-core-don-t-auto-launch-logind-bgo-741572.patch and NetworkManager-dhcpv6.patch: fixed upstream. - Split out new subpackage typelib-1_0-NM-1_0 and libnm0. - Require typelib-1_0-NM-1_0 and libnm0 by the -devel package. - Add pkgconfig(bluez) BuildRequires. - Replace pkgconfig(libsystemd-login) BuildRequires with pkgconfig(libsystemd) and pkgconfig(polkit-gobject-1) with pkgconfig(polkit-agent-1), following upstream.- Update to version 0.9.10.1: + Kernel 'cache' routes (such as those added by IPv6 operations) are ignored, preventing unwanted CPU usage. + Vala bindings for libnm-glib async methods have been added. + Some interactions with external OpenVPN daemon default routes have been fixed. + Fixed usage of libnm-glib connectivity checking from garbage-collected languages. + An unusual delay acquiring a DHCP lease with dhcpcd has been fixed. + A libnm-glib crash has been fixed when multiple NMClients are created. + A failure to pass certificate blobs to wpa_supplicant has been fixed. + A failure to send the inner private key password to wpa_supplicant has been fixed. + nmcli now returns earlier when activating master interfaces. + nmtui password fields now correctly display the password. + The IPv6 hop limit is no longer mistakenly set to 0 in some cases. + Some DHCPv6 failures are no longer fatal. + Handling of DHCP 'nak' and 'expire' states has been fixed in some cases. + WiFi band locking has been fixed. + Support for Bluetooth DUN with Bluez5 has returned. + Non-local users can now control networking after authenticating with PolicyKit. + Externally added routes no longer have their metrics overwritten. + Some child interfaces (eg VPN or WWAN) are no longer deconfigured when recognized. + Support for the PrimaryConnection D-Bus property has been backported. + IPv6 RDNSS/DNSSL forced expiration is now handled properly. + An invalid route to the DHCP server is no longer added in some configurations. + A crash when external master/slave changes were made has been fixed. + Various nmtui bugs for slaves, WiFi, and IP address buttons have been fixed. + DHCP no longer fails due to SIGPIPE when the systemd journal is restarted. + Unmanaged slaves are now updated correctly when they disappear. + Cooperation with external team interfaces has been fixed. + Bridge STP property ranges are now properly checked. + Manager state is now properly updated on resume. + Slave interfaces are no longer released on exit. + Static IPv6 configuration is now added before SLAAC is started. + Allow shared connections to be started without a carrier. + A crash when disconnecting older Nokia phones has been fixed. - Drop patches incorporated upstream: + 0001-core-don-t-auto-launch-logind-bgo-741572.patch. + NetworkManager-dhcpv6.patch.- Add NetworkManager-dhcpv6.patch: dhcp: let dhclient handle requesting the 'server-id' option (boo#912315).- Add 0001-core-don-t-auto-launch-logind-bgo-741572.patch: do not trigger logind start on system startup to avoid deadlock (boo#905639).- Handle NetworkManager-dispatcher.service using the systemd macros. - Enable NetworkManager-dispatcher.service in %post: as this is a dbus service, the 'systemd unit' must be enabled in order to be fired up./bin/sh/bin/sh/bin/sh/bin/shdhcdbdlibnm-glib-vpn1libnm-glib4libnm-util2armbuild22 1634063351  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmmmmqrsquvwxyz{1.22.10-lp152.2.9.11.22.10-lp152.2.9.11.22.10-lp152.2.9.11.141.14 NetworkManagerVPNdispatcher.dnfssystem-connectionsnm-dispatcher.conforg.freedesktop.NetworkManager.confnm-onlinenmclinmtuinmtui-connectnmtui-editnmtui-hostnameNetworkManagerdispatcher.d90-nm-cloud-setup.shno-wait.d90-nm-cloud-setup.shnm-cloud-setupnm-dhcp-helpernm-dispatchernm-iface-helpernm-initrd-generatorNetworkManager-dispatcher.serviceNetworkManager-wait-online.serviceNetworkManager.serviceNetworkManager.service.dNetworkManager-ovs.confnm-cloud-setup.servicenm-cloud-setup.timer84-nm-drivers.rules85-nm-unmanaged.rules90-nm-thunderbolt.rulesNetworkManager1.22.10libnm-device-plugin-adsl.solibnm-device-plugin-bluetooth.solibnm-device-plugin-ovs.solibnm-device-plugin-team.solibnm-device-plugin-wifi.solibnm-device-plugin-wwan.solibnm-ppp-plugin.solibnm-wwan.so2.4.7nm-pppd-plugin.soNetworkManagernmcliorg.freedesktop.NetworkManager.AccessPoint.xmlorg.freedesktop.NetworkManager.AgentManager.xmlorg.freedesktop.NetworkManager.Checkpoint.xmlorg.freedesktop.NetworkManager.Connection.Active.xmlorg.freedesktop.NetworkManager.DHCP4Config.xmlorg.freedesktop.NetworkManager.DHCP6Config.xmlorg.freedesktop.NetworkManager.Device.Adsl.xmlorg.freedesktop.NetworkManager.Device.Bluetooth.xmlorg.freedesktop.NetworkManager.Device.Bond.xmlorg.freedesktop.NetworkManager.Device.Bridge.xmlorg.freedesktop.NetworkManager.Device.Dummy.xmlorg.freedesktop.NetworkManager.Device.Generic.xmlorg.freedesktop.NetworkManager.Device.IPTunnel.xmlorg.freedesktop.NetworkManager.Device.Infiniband.xmlorg.freedesktop.NetworkManager.Device.Lowpan.xmlorg.freedesktop.NetworkManager.Device.Macsec.xmlorg.freedesktop.NetworkManager.Device.Macvlan.xmlorg.freedesktop.NetworkManager.Device.Modem.xmlorg.freedesktop.NetworkManager.Device.OlpcMesh.xmlorg.freedesktop.NetworkManager.Device.OvsBridge.xmlorg.freedesktop.NetworkManager.Device.OvsInterface.xmlorg.freedesktop.NetworkManager.Device.OvsPort.xmlorg.freedesktop.NetworkManager.Device.Ppp.xmlorg.freedesktop.NetworkManager.Device.Statistics.xmlorg.freedesktop.NetworkManager.Device.Team.xmlorg.freedesktop.NetworkManager.Device.Tun.xmlorg.freedesktop.NetworkManager.Device.Veth.xmlorg.freedesktop.NetworkManager.Device.Vlan.xmlorg.freedesktop.NetworkManager.Device.Vxlan.xmlorg.freedesktop.NetworkManager.Device.WiMax.xmlorg.freedesktop.NetworkManager.Device.WifiP2P.xmlorg.freedesktop.NetworkManager.Device.WireGuard.xmlorg.freedesktop.NetworkManager.Device.Wired.xmlorg.freedesktop.NetworkManager.Device.Wireless.xmlorg.freedesktop.NetworkManager.Device.Wpan.xmlorg.freedesktop.NetworkManager.Device.xmlorg.freedesktop.NetworkManager.DnsManager.xmlorg.freedesktop.NetworkManager.IP4Config.xmlorg.freedesktop.NetworkManager.IP6Config.xmlorg.freedesktop.NetworkManager.PPP.xmlorg.freedesktop.NetworkManager.SecretAgent.xmlorg.freedesktop.NetworkManager.Settings.Connection.xmlorg.freedesktop.NetworkManager.Settings.xmlorg.freedesktop.NetworkManager.VPN.Connection.xmlorg.freedesktop.NetworkManager.VPN.Plugin.xmlorg.freedesktop.NetworkManager.WiMax.Nsp.xmlorg.freedesktop.NetworkManager.WifiP2PPeer.xmlorg.freedesktop.NetworkManager.xmlorg.freedesktop.nm_dispatcher.serviceNetworkManagerAUTHORSCONTRIBUTINGChangeLogNEWSREADMETODOserver.confNetworkManagerCOPYINGnm-online.1.gznmcli.1.gznmtui-connect.1.gznmtui-edit.1.gznmtui-hostname.1.gznmtui.1.gzNetworkManager.conf.5.gznm-settings-keyfile.5.gznm-settings.5.gznm-system-settings.conf.5.gznm-openvswitch.7.gznmcli-examples.7.gzNetworkManager.8.gznm-initrd-generator.8.gzorg.freedesktop.NetworkManager.policyNetworkManagerNetworkManager/etc//etc/NetworkManager//etc/NetworkManager/dispatcher.d//etc/dbus-1/system.d//usr/bin//usr/lib//usr/lib/NetworkManager//usr/lib/NetworkManager/dispatcher.d//usr/lib/NetworkManager/dispatcher.d/no-wait.d//usr/lib/systemd/system//usr/lib/systemd/system/NetworkManager.service.d//usr/lib/udev/rules.d//usr/lib64//usr/lib64/NetworkManager//usr/lib64/NetworkManager/1.22.10//usr/lib64/pppd//usr/lib64/pppd/2.4.7//usr/sbin//usr/share/bash-completion/completions//usr/share/dbus-1/interfaces//usr/share/dbus-1/system-services//usr/share/doc/packages//usr/share/doc/packages/NetworkManager//usr/share/licenses//usr/share/licenses/NetworkManager//usr/share/man/man1//usr/share/man/man5//usr/share/man/man7//usr/share/man/man8//usr/share/polkit-1/actions//var/lib//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:17042/openSUSE_Leap_15.2_Update_ports/eb0698c54597c8b94052c749aae82a73-NetworkManager.openSUSE_Leap_15.2_Updatedrpmxz5aarch64-suse-linux   directoryBourne-Again shell script, ASCII text executableexported SGML document, ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=b27bc591a00550733a21c596fa9385010bf8d293, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=8d0d9a2dea589514e1eedf9c091f63c5b7d8239c, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=2ad35470fbf4afc07992cf6bbffc37f138ce34e4, for GNU/Linux 3.7.0, strippedPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=f82732cb0245665635170ec749f29defeee5615a, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=0ba85d9ce519acd6ce6dd6e85762300afb349729, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=750339bba2816db80c8655be331f2a1dc55c1e57, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=3fce02a7afde9836850449f8e39d276471993c6b, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=2a969d79d0acb80d0df0264e63cc5a2ab8286fbd, for GNU/Linux 3.7.0, strippedASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=12fb015e22d2457d7f0d7628ad310c77e06518e5, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=dc1cf6f4be0cce1486eb2d852a5397aea0469859, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e7810bd320edd65d0659f50ec8c1c07c96afb540, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=abcfe84dd06a61b93d823d8e95da7f0c1b85a0cc, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9e983345a1184a541f716f6d3e9648b01a7dc26d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=411b8e453595dbd285192fbeb1fdc7603e33fcc1, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7f54698f5985239c2e9054bb4c17edf922b7414e, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9e72898d0c8b9f39b8b51548f7350f0f1dc414f4, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5314333590076c473d38dea0ae881d90dea475bc, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=490bc5ddc4b7e9cd0eb4dd286f18fab5d5907f11, for GNU/Linux 3.7.0, strippedXML 1.0 document, ASCII textXML 1.0 document, ASCII text, with very long linestroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Algol 68 source, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)XML 1.0 document, UTF-8 Unicode textempty &CDV^i   RR#R RR"RRRR6RR R R7R-R+R%R$R/R*R'R,R)R&R.R#R(RRR"R8R3R4RRRR6RR R R7RRR*R+R&R-R(R%R$R/R'R,R)R.R#R RRRR"RRRRR6RR RR R7R,R$R/R#R+R)RRR"RRRRR6RR R RRRRR6RR R7R R#RR"RRRR6RR R RDR7R>R?RBRRRR=RCR:R1R0RRRRARRR6RR RR7R RRDR2RRR=RCR:R1R0RARRRRR6RR PR RRBRARR PR R7RR R!RRRR6RR PR RRRRRR6RR PR RR@RRRRR6RR PR7R RRRRR6RR P R RR!RRR6RR P R R7RRRRR6RR P R>R7RR R=RRRRR6RR R RRRRRRR6RR RDR2RR RRBR7RRRRCR:R1R0RAR=RR9R5RRRRRRR6RR q`'6!$!dnsmasqiptablesorg.freedesktop.ModemManagerrp-pppoeutf-87abc50af87f1fabb7c9c773b9eda90f5b156c3ee0f08eece18d23c50a77bb7f6?@7zXZ !t/]"k%ѡ9h]ss%_tĜJO'9{! qIB8BU2"f}4؇ҴL6 .Ǻ+( ^ܨGW=YPRT4Yt$"i4sx.7PP*/ cVppC~؏0EvC7`vdeK,Fӌ)76ˮSV6B Y+@jg&y*ݽô^%&T&K52豩+(ELgɟSCUiq%^zz:+!Pkؾ֫G߀~;ϓP+E@d@[f&6+b:pl *OWӺdE̲i:ğY'̙: =!onٯI<ϫrjI8w38KB*qQer`9)MJGx՚l.}ʵ Z _DJ0 ӆ%?LkW%ᠠ&je`Xnϯ()SZr=攽Z™~9R|%ˮM1'Wuqv!!$wi@݈P\JS2rA[,S,F^*D5dap\_mU?,yE])|[i\i ꦵ‡1:4 r7H*HeSR GF@C(6%,/(0}U+jl" Ȱs*k뭹IJ)f0\*k~.#NK^avzg?  #V, \ zH3o{◈Aumdoa}TrGˆ:Z]TނDth֕]e~4Uv:FP/Վm i΢n a G2D;y- C t}xI$u9 Ój( " >)1Ʈa1+iV"urJp߽5F̈́٩w.))K+Nu>!@12n[cϵldo?܇;mۄq RsTٶRI|+QCds<$G:.V*z馄֗rHo&N7\tXuTAkD quV6s+ͤw#eKň$@9gLn Oqo>q޻%!wHK?VTlk#dzfG+Ԇ]C2uxx9@]*Jԅz8ĮZaX!.Pʴ{$#˞D ֝թ=]"RP4מ @WĀaIĪK,qQpD2X=YA Md&$1.tv;/ojD}^CBÕ!2}fLFJdߢpSv]%d{`Q8wjPQNUi[k9|LxRК ;cxKR"'Oy} Pr3+%$^& 1~sG+,W2b'UΝuIW<)hz,rx-idaC'KN8BqM; :Es y|꫻hP+k*PN%`\F/8a^5̿*C9Mrea0-:ϻbOyUGK^h5%O1)lxw#CgH<0ipVNBE5HcACuQٓ} z|ow 3+A}A]+TM<_&GyQȆ8Xg]p`H43_r=$ xUjIOk9t yJl3íyv/ܯsY@R,N[ fsRԸ'`#Dy.m]K9]InES^¦ ؾH+I3!3#M5*(!DFh8=3/كBCůvHWVS|w~,@I,"*M!E)dKÆ)b!HgC7@a)Lѩ$Vpe!$pO_5`'Xa+T9mA`6>]t*=>AlˣEյv!qRsǚD`ǣvS"';zEIJRyxJQ\14N@"<qDZ\]Xnb-$5FLK0 @o} < cF:r^=I'].?WbSCOF_? dԀ_Q.^ Wf¤u\ ˆcT$WrP׊tp1>C10*S2JvV9?T`&6 DC W7zvC}3 ْ{C5D[΁:m]] xDdjt7D*zw 'Z. v{ؼ-V G3}s2fH9ty_GC|$=1.ׄfNRcͻQw%q Oc]3ӻI4 :C!(Lp,i37]W8t|_}jDL Zqo9EON _X{wQf{ty'?业"uhcƁlm2{ɳm adJ qyB>m"2$ KKޙr0nJoTPRD.?2.>#VwjI{qcz iG8-XJ MfcU!wɱ$ jcC(_U0N-WL&\FS qݣyנ복y>>l}.I_˘@͆}h4AD64jr; ?[%F\iQE&`at-8c:S5D&tV+tB+qX61gns"\7Z:֚ *rsa)!zb:g1.;k!b &<@#Wcl:Sldv[b"xjWq2SIy~%\`Yƒf TÒ~ =Tӻ%]'Dd ((0n&+Oi\F5$\_$*>kn,|؜[5 n6GV?}$*SlRFςTR]"*(F=c;+&bҕbogF&7>^΋7`Ծ%^ ջںX~!g' 뜃[߆oKbW*~JMya /(g9MZ? ^~{\gTd1gJz2wL3h7 / ׭kd轈>cS)Gue@[$%Nc).` z cWX /vqU91I`8 4o#&/Ri: ՂG 4F LL$G`q5 *Ek :ϊ}X8Wp0j,FmyXVy ]ę*aGR[IV]ͻt1@ԧm()#lx:—aQ+L! w @m ЍBofXD?ae3Re᱿1W"̒)շ*tॷ2?|v\⮅wO6r+;ioa'Y]kbh̢umLQъ68ν 5/峼$n2DOT_-vLÐt/.H y4]!c̚`t\sV뜒Ro33Tޕn&,:}zF z(! \+н+ ZE .G*.E*Ab(JS7G9`|W?څd >_r܏u.A'FM`q$z7O羓R  rqJ*w-4UN.~Ia"6g"WJޞ<׿л%I"z|#>LB1s9a:\HNuƙtHS'ÎjYHH5tI~,Pna'6]<|nߪTNJ'0lD.7y @,YpcH+ :"4bX.C3n/PK e|+GH?- c`^^:3hgSe9~݂@iTR7T^Rgi"XãWexE_r߷נ S / bv(iKarTWdKpaGdnC W e}#]0B [=X"JH9ަ8Vc Ґ .=ĮJm/k J{uL!Pv)̶ VӴ@LU`+jHb)&]r0Uzhs !)j廫QnicF\l-1^DJI.2d) &_,^hC *4GxmQ.3.>;@x WeҀkAZb}^PN}:#R9xV AM~f6tmVK7Odū{zb> f3Ϥ$(wqaY V}amÜ&1&d$Ta*RJq0,z\ivx,U@eZ9-FlB!l&O,x< Msq zdWq:);c_ve8E1 oTHgxx=;;p-aV|2;Ȇ[ > ݱ.0qlL!!F&r5ynn? 6^~aL)bZ?=m3]i;5<gH2rhiN2-ӕtG EmSHS> и wn]~PXL+Y\hªwQPj+#ot9zEno"Ff0|$/:@ӍI4\6/Gub9Jz܈F V_T0SI1$+IO"⵽Y>g8?ߝG/~"G٫{@>3,iXdʄQ6embW91ZWŠ^˜g T<'321h#іFj lK`hZӝ=XJ¹ekdQ窕WRSG5&UelUPxZV$ws<ʂބOYX#=9rhqv]#Wt#n+g_%mMf4 ]v2˨Tj7!Itƃ|J5uj=%NK \xw -nbtx||4|"cHpN'2DOђE/4N4T<Ǟ֬,,KRXjrճщmdjֳ|~KY2e__ #J~*i :y$8}*taDGhDFUSZHUYWb$jDr+ b+Q׆Z ~aCBn>`82A0r U8_cAm@8Igzoq *k%YT!%[ՉVdq k WT¹; H RZmjyeHRMt'*V$1 nr]+):X|¸)W^ܓ^gP&;L?Nh82d74wvr K)5t0-#9؎aȖ\3A6dƴ ܩ!yho7\TImFxR(v=FzK$b߆Q8 ?ɦ(Tp t+J51e@81/.9rLg]rvZMKƒ*m7\/_RŜ[h[J7~vEJ՗qB:pZ s/Af0ƟkT I$@9W$gI Wu/}=r6VpxJy>"7Ok;%n[i3V"+خ3-8nEzɦ%6WCh:'I9KڊĤ]F:PѷV´=VBt(M}eA(҈&:O`(WI^_#F#s^{ Q I{8ˆ5M57-1/zSycJ^@egiH<56qyes6g.ڷj{iik2:v\Lzu+*<iT qN hX̶ߝ}>S>ѸvMvdF5l,Su΃׉~&XƒۆKb~y3~lg1RAzyz⃹"W_7PEfǁhX~47y[_62}OK6u٢&R2j9猫qD+uy[֕3Lڿf"Et;8y||8sq`[DNA_8!=W[Xcmr"y[:!~ ^\\N+`$P$:s2&.cVrѸ!_fs:hn%gM^T}hZgP9-8uΝ O2sS26鷕H*q,^Ԍ¡l^Igv;:}Zܶa :U0é9NjHZͽD;6\ݕmeۓ\5' Xfw½A %0P2vU%i.Qx' Ao2ۗ蠊+33W:|KOު.<>⪰͏&yifA!].p#'ybA!?8l!\q̵͇U O~OU|˜9㏡WYݳ#d˘:Vkz^Î]u#xB"#V` f_  fTYGf}h)yv"ۺXm3yp2~5NZ y}Bw_ rTe=-eZ vkEm.VjP3zЂTJT`Qj½1mK yoRt`+Vs*_\,@1paVQ Gx s&<0e1 >mn44d`6JVKbcUCN1~Fːt*tu,(>wnp="ZY[/G 8ewg{Tݮ4FZ\bXdH04|)<DX>m;˷r w _ZdMq~}BGO]\j\EwfFtd7 -s{?+➈0$P%BigJG:ҕHs樔pgҲcyZ8-q[c 3 Zv0hDH M#;V𿬯GD >>iR.MƖiJuQΟ<'Ʉ6rSj7Ątrne7u7c_MVc>\77PvݺףRE Sˑ'bc81h%V<|Ў(I7eM쫬0xW8?Ѷ܆Zp:AIJɺnrW 7$c-č7bcQܧ'bv}hR4Ld"E3!=upw$2z*8>hB|.|F:ʖrs Nb_maM%rF9EL &AwڇOa#!a-n^M%T q1fRMSC0uT$gNy4# (/=i3a ON8(&Ҩ(ì؝Plˎ&,6{y@Q BFy>(|dA-1 y ڜ0 AtE[eC]#g - ]vnC@:<(,Fnk:gHJ/#+Sʻ4De~R@] h&)q' w&=iu\i_^GьApA= P~]5tD680!"&0.eqH8`= -m~靃PɴF5tyӳH#Y{EUge <K\Qn7~ww8>-Ǹ}(ץ/jTu9 $:DyS~[hiotN㣧Y/r[&G$Ap+.3(V!rm: T|q8(Ef!rkzEs8sci4 n 'fq#A5AۋC=fc:smR8[td Z'Do= ٔR3Bd8Мb'hS5+ZHw_&'AYn~ w^) Jk5`҃n%5N? W]`טPrӰq7}6 0ˍ6ܳ#PSCcY=-h ?RNxj> gvfp@5Htm| !%U)d6Ņ;P7Y٭pk9OTsBk|s|=5XNM&ׅUCpe@Ľ}{hVaْZbӝJ8^-G&>ouDUY~Cw Tnf C,{^cͿpM<~z7m\ha QLWCЃ<qh[ ydI_0wfXg-os !}G;iA l9ŵQ*?{\稍d`W{ ((3'sc y5ڝZ971tG(|_Zu+%kuifuL*RLc{Sюi Z= x%1*j,_$sOq X!הڪVW}C61gݥIHPւ烆Cn xt gSrXEPGb6Jȥ z{F;a7I]S6ߩF`#C|Z}D`^mS,WEgz^ .!nѱ[R]y[Z4i:֟4yNn@O Hāz6JcTk# 'Ii;tȹMzh&}T.F,H0E\inbq!cY۶ Gˇ:ԑ7*CYߥ+>>FՎ5akS|6 +P{ 3βLJIF=?rMȏ0;߀|Cd"2]cypggU\ʐ1U@e*a5͉˓Ӝ,A: H3 S%G:/X=ݺ:eb;LJ\N8Lrk#T;U֫n͍kI *]ibr! >ho,eZPzym8^Z@@=R LzxJ,pm@mFE-N nўT98Nƛ Ay,ωҰ'@!wIE,Q0D !l9FQp؍ ^/ՔvyG.9#ѻ08K0{v?8;= g&M=1JpH0*[[3!KC X'zr`a5 [$f2:MnV4R1qmuj ╻^'zKJ \5Tvf@=,a>®zi)0Q?_?zۉsM!rZU ,:h2<j?gX`*GmfZkX$E34o [94d}Tw~ LyRƌ5Pp($1mSS~ͻ/ʥBȂƃ^ :5["YG{4{8w(|f=gYeltlBrU JY]6KmƧBdhl"ٶBi{%E#JrEUӷxNN5A8d'C" 802b)!>V"V[E/[7-]}GUw4S:Z<_b/C c zV! ?z/G]$|4f9ntLhcw_s ddlhT|Y W"wJ_ pDzEAJEQ3쭿\M9_P_tkWDF؀IdFNGL5Vl>0io sH7̦83OatfN-kzV_mHafM`9r2}cĨ5LxNf>s@b^g1]?Fca |"sX} .P;H heSCaEU+>|Dj~3m8lrH󴧔_\_-A@o6L^W*skyPo΂ac2fc?~Osn%FLAgK&,Yw݆s|3C*$ }$b%L ~ ul1Zk]bq}H;#j |2O_{ }eU[H7_ #NzTG¡w9~᪥+wFV9e*=KM2BΪӫ('WWrtzZ6+ƌ{b1a速}ľ)ꑲ-gA/G|Q7zm$`gؑ,7zv:ȿݥnԓ*FB) #<ep/20S%+ȋj{z !Rf%9z2|z-S-sz$T,?*th1/Ȝ%VPnڒyCOوZFHhF"\7HJ^̝x=< h;6CV1 ir</Md>0NA)tm]nx/BDQ;g#A'~)7MOZ#Oe0O=ڙz[жbNi˷~jWu< \mhfdr3!+R *Rzxܞ2co>򥪲%u3 %q}4jm!jj:r,sw `lEn/w6?2*d uQR!oSu+ Nl ߠ@g3^ BN@_+Bg_y/|}/ZZEQt Xf . ٓFh̦ϨRS-LT3 G\qب K#=|2hk̢G_XOy$l/7DYeUCKP:dca0d8o} 'Mλ0g-4M'GDc΍޾i8GRO*1]R1{;Pbqk۔%A[8vuY sN򚾯Ǹ P3ʍ@:q`nJ3+J =-(w.SI,i܍Jp S}-6 +{rQt,y=BT#»4gnNG݌NRܧSQϛVיStV^[7)gR1AZ#")YO ޺mXEl ޒƸ,Wn*!) =k20{;TZgdqTh#gzg wڣUq)ZE ⛣/k@co<mPD1=srRE:9Omփzh-; ݥ^H s)v:k1 ~?¤n'lY)2WfG&hrF'a,cQƞ[hыyϝ\>_$&F[`O'$~'( Os HSf&!{ 8F.  w$aǥNXJPs rWm$<Ѻx$Pֳ C $ J䷣D ZK݋vׄ9CSc`E/R$Ju^p? r=ٲWg[~J_ eEPO9^`_X:45W"*W賹Br"j(R(ceP~G:h6TE >|)` WUk-%ڻ ;û{/>)dφ~NmQ(DѵƬJ 6QNdpb>5@.-$KJ:e ӗ_&, DwyIw~͊I=H]a[ByVX +M(Nɓ>7ÉdW ]e- \# fFz3>;x9En=in)a.ngYgcvVSRޡt]N =FbhRY;Ș[ugLdv,N8z#zl&izB6ZlIBV7!q6q1:LU \)9o4*G}_6.W[CҪ7=KГFJhpH'J eӎNi R=?Y:zu@1vup 懮ܒD;`E~[USw3`{x)CdHe?-V/jS?&:̺ʏ2<YVyJ$w b9_V'ONh4.'W]F⑊yF I'v/|lv;8qⴅ H$gWs}b%?.?5ТKr_cy3mC8THno΁#Q_C3lwx44ESz35DguW.̀TTOUr %,}M'2eI1ڟA\lG=Etb5iЀ<-)`, 5CBه #֥iiDh.D i"Ir شS4 ً9+ 8$Vh/&}D'wGZЩl`>N8G}f%`KGz/qJu>EW_OzBΕD0,n/Y0cH-V$H8'4|!zc@6`ji+HbY;Ɔ)|{٘6e{xF<ȱ~zSp`\֚ر)^w2&3W9+ \ fO L Aa SM xgZbEz^Ld4Ai; uUتԧzj޵vwϬ%J5ZXT KX6ܾ n \JTe\.jOf̄|#?GUN*D^hZo-(VC "܂Ts ^<|;y;jE3چ[Z j?\;L>CM'\4s[Ʌϋ!Jpi'3C8F&[^1nMiy+2T!z s؉'H풫ْaEW$Cwmaӂ^$|u=vX+2Q}8)<$ ݳQg 2a6ofTਝAxGGg" 6lSX"ɉ#-mO{3BV*4 Vx⥔[/pi2]WN?<_m,Dyd? ޺ֱCҦ*fb!ƢGe[{;cs'cjr(x 1IRkPP>| ͵hŕ!B't>ݿJ㚸_I5Ų#~.ˁ^FsUk peS+zOa nFI:UD2F%D H~¢ٰe&z @#uHvn)2(QVe?8ip1l*&K Jk (䠧77l>.U`Uf%[ *5+s܃\E%잵$ZniI-h! f<> wdE#J=NuݪռFc0H9IV!H:w-첒"ún&`'EL)2dK\@̳/oWCPL6O撓j~b>`Ա}qp`r<6I- *?# JEJ3b?1uH5{! ·r nΜn|@ nxo/gX\ `8Hbs~$<'Jll*sb 9(C',tEBEW !&< wDz\6>/uRPń`\ycn~r2hn]溞,!ġ,vn>F N4szRe)EQ#S M2~,XXLVQK}3+^K8f"A_?$iBN'!T6LŤ]o jv*^ WǧAc}ZD',@(b+RIcshMRqbfnՋ$>(ق~ŠqGua ,qSRJ3 2f#eU["'bcj~nZ_IR>N>L7. f%T):/BVCtxb^\Vhԛ>O0E1⇻EpH]⁐}e9 znEV#=? $r<0"t>0e\N pT]||A,0y MOaHlT#BcTѫcwAyrc_f:n&uHo@}5\T]Cj #W9mzyjh"˖]t;f˻;sMpfIj FTSuڠcZ֣Q6%),mO{ZF!\S]lrQ[`j'TjQ98ֱD39OiB[D&]+G/} =Y]Qu?Cw >[]RTpP_ {7(5Tv<[4{#c;`-em!7fKsmí]z)(Jx ;hyc3F:-%QckDZrɝwDyc0s و ݯFZ Je'@N}%I(/ȡeg@78tGV/@`bjS7Owtco{7 ]xM.#-k+eCυhC*/c"l=s  K%Y]#яJsY E|gx5)!D;)x+cj1}͢n%*4Ve}$Ia6i*ѳ0$GfJچϡ\)S*>"2SDe劑 +}:Wwo 9VW24mKz*áC78>Esd{nmzaQW g@YՒ[^'df)0}\g"%Y`=fYÃN>#OW"v %@u]Np9sOWG)3?L4"?9.M9 `xUSw~1 ;6f%\WtEB*h5v7#S ^/ԕ'{uOF"/ǝ4Y= >^DZeoRb98W%qŴAG{BW2iK#.$5,~̙>yu ^S-U?C|?T ,=*tE W3nj'7`Eо#LM䞻j濆02\ l^Qmi D -`3. !AuS?$VL+J^7 nZA3 vԮsסW4*sLj v#>i7=x2D̅_ccpJ[*wAwbDR"h֕?%ׂ'P2E n/N7$jHJP ʰ뭰uNI"㲛V+N߄ޮVHi+,eaZhU)v~ ϐ `Je"$oO` (v<൰ Y EwŚtBJ>(Z/oSuIt7ˀT&WU̠dk`p9rd. >4Z[B:6VC[Bc&Zv}! |ȦǤ [C5-ͫ)F--0$C.&cQ3VwF|'r4(`8qkՃ e~ʪ=+꿠#-4J"l崛UpW|>A2L$dŦw\Fv' R#3 C)\OlE-`ws`Չ?~]ZeVM]o)>|ꊤX]"b'X~%NK^oW+? M숼aBI6ƻ#e^,ې!f⊩ECh:Lm£Ve 5jPӜ˔GifF\PMq6CU6!&($uIO{&r%a,9m0R#6RXJ2*.k%|^_셭8$<`ҟTUkʽfT7fB^V~_\%= m>1'$x>Fc fݔɧN=t"#XI 5'o~ Ն_5qŠ36e)4@}Pw H/@PyT-MHUoSv)$uvɣmBzzZawɣfi 7T{܈c|J&8x? Zx{!9g/o;geI'~$ b5Q2HCC]h\-&f4_/+Ƕ.=Kŀs<ˆܶ3] 7ӎvU`>#i818U8P E $>|S=ZSu{۩*9E˓J; &ɾ߇,} cs;T M.M#]z W ˆ@3'rO"⨦?F2s0!`>,쥫*Bc}k^3O=kx~ *,^ 0E 1M,:M bvNA^V];XGne[lP?9R!fĂeH?wu]tkST#Ppq}WDEM"{/e!O&Ҁ4k!a;3¯ <}U2K o\?Z7`j!@^H־{Xf8x;6+~ニ5$f|+&_v>[0W-v$VM=:2m#fzx0g~_ևs1Q eovceѺp8 ->y{q=C[K&j>3N?gt?o|@t|'C`/ ޝXE%6Y&zL'>%U?t޷qFvx<0Sc'$QG,c $y[gڅ+}8Ym[ k~u_!O8 6hlyyp Me^35 tT&Iѹ@ <"D=,3I fgPg0;ut)=ˋj0 nS:l,VŒXbcv<_C,Ԃ@¥@aG5g^̀Zoe#B5="oiӰqHRJ-L/OY)}# I%C bƉ,K3sz vޘB%aFLn:yK}JՔ9z'Hq:TEb!0(R mb֣ōx&2޿dDC:L_-{W#VTY܁Go*e89z5/Eg(ZŒs[߂O|w㜍tݴ -v`9NXqqn,򅅁]m'X)e7f_cr~(&noEurQ] ;ԸvGI[, 4[3i&$(w\~]*?()nM.l.jxlz`A8ၳYXy25Yu0 b#<ә]!f扭4ҎR)ĝ$WI+/lZD*'EE}\w .;9ioe^RTx7Y(f9A}b2]}O~:no;M۲ct΍Vж#FX;f`"DLl);*l`+ eٻ=<& |mi @YO'C'[.Wa2cl>,y'UAZyI@ōw+ax3ȕ8> e5k6Z^シ`>_4EiVB} `WA$+ǻnK% i/n Lg[nG2"}+?>7թ4$2ad,Ӝr(/vB~&a^eMKr|m: ^vRX /V'{-#1\ ;U<]nr; yɛKfdD-Q$9?MA:Cl~'No^sJ] TwēBRu;u(6{9 0Otx }5 Kŷ4~Xwn8uf~ӷ@+pO"Ѷk"H؂hY|0 Q:U~я{i^8 ;IuyC_?q' -z݇Sfꃂ&ua4<~LϓR`=Hq TL[~7(U 94\M 8\횅^"Tpj8"-`Uf{'΀!6--' 3vwǮ;ՓP|@-^ +M#a Y_*V*?\$y3=$l+)I-.c5ߢ? ;؈Վ"o3vOFćP|([R  j0WK:bzΌ}w @2[uؓeFhkC.`C( J̿Cʎhfs*0;Wi6 dh^Go'ى]{FҞ}.-cLA)#Y8ۗEJ࠷}%T+Q@2'_X]Mүt}w2Ȟ^ ֶH*p_\쑍uc`eNc*"f&2= ^X>\](܌ e`Ϗެ"yIzQ{o/ r/펉klݓB[@@d˭xAyGHՕԎ]-Cޥk e_ĜP 9"O7yʺ$'uteK* &h̲P #a|¾ 4gLY[4D M(z?d"2/]Kq fF 6c/WLN±}X2_B^(|MLi>U1dŀn+2u'E}A3}dVY4l ҏVѩȱ{7d^[!EiO죳/i?'3rHFG{RbT2p,=h; ȮO27KҎGW|ɾI5Ӹ]5xPTL66c#S+$_ W>IË .?XoWa3x@y`\(B!ڷ OL:{$PŴÚ]LP_MW=dd&y*<`0-iaBl*e4UKL))Xkod͵0ba/9dݏcGXZC;jG+ܘ&26^Ǎq \[P("P9?,À-?hؓymպ=Mg yQ+@tq[%j}g.aV.ETC˾C0c< Qq:(VY3#*G:"҂ݶ'!%78G@ M~GQxs1gY_CLgL(F׷+Ӡ 5-z}׾8hh@ C1"?rg!XF:Nzi}פߐYajpfcۭ2E$]H|]'ɰbP4Ȥ>pH86ڷ@2SroG8 8zjv9H}> ]=1"(0Ru o'{]f-*n07"C\S됺מ#dlwt15 1ѥ*S _!ȻM[^(tNש7 y@b ']3 ,nxn̶C%`GK/HM)~#r:t ʼn k:s.KPj2V:rWZosG=NM0+!#QN&`E4KÛ1ۢI?gF$䅐%2S~l7Oԇ$޹31 2c wIaSٟ._O~ԙm'J[ {-`AKe*袼:4#^&pILtƫ{u9 QNT@6q7UK [N*qx ie8_S]3y ]$N fvkі0R2_fe]'Zc|Hc#ӳ5Y~'A ƭ&q%+gpDRUt{j՝G0Ep J-B-,7sueJj_=4n):ez1X9JP |`o꓂upz2ԏޣ &[C?%wT$P!5o:Wds!>8cPָAL:]|J߇)1p6xD=I#2/k(_ > GM:^ ́N}]q֣eɠr7V[8KiHS2ͽS[ p@zXKm & mWLNo!UR98U;\Τ\зYС1 #w{VVɚ?(aÎ`Q|;OEr2Pp8-궣OU $txM]ҙܚ%&}==-Y# < *+hJZ*wnL KцSh#<ŐݣAEkn*eN{ \~טxq=(t eAIj`{_۵Wiٿ)P?>^>-Tuq=EOb:'7aaP\%< Q #a0դcfOa`RͳD/%Aws j+;HU&<$r'/Um%re%f0VrKU%p+WjLo@*0,I"H/c &1+,J9b`LWb|4/nr H2Ŝm/^F)] 3X7 4]샴(zdq-)VQsm'?X4=)DX٦=MG|33F P@$NǺ#TD8a+1`UU,F!sy*nӛiU ufio}Dž_V9o69dD+ֆ=yu6kJ.Jr" x1l 콄jx_!uhɰ6Ir|#&Q(Bt~AF@ivBQx20ŤaLx{5ߐO+y 'юPC5guQ8܏"x8Pa[Q!2ߕ$T[pL.]S GNGahp'Z@̫_|Yim# Næ'w[[Рnp'5w;ŵ H`} ^`QmCi5_CCLn}yiKlãR_ 8eE Y ,P wwW @H:)ˡRe,WT0+A7tO`/EMRV2#\C=΀@Gj!{@HE?(z􁷏ma "HC)f :cV$*Du֕eUesTj^ojv@Urw v ~_;^usAEP\da7^V0 1 z(6m^ɥwwp^DAm9~Q;fS~.Aifx{eE.U Ipぺ`bK %_.9`^ÿ5=(oKi. )p` XCYW>F}ph Vwvg-ʠȹmCZD4FWO:ЕΣV;v M"mQ폝Bz>aKGlǘm~‡GqUׅ*N0h=QzpnO=|z36@lʘX#wD㶓cqz"BPǴMvJ WQyeֆH8~㧼B8=VGiŒ9;M=߀&B30<7KB1e>, >6qe]z\) Â],`Q23.ZDM9+K!`#Ez`.ޟm>B"n(GwWli`>Ѽ/;p?AXq҇O VftUƂ*DQg{g?k_2evCHWKҔZ6+X& U^Ja1?o!$T]/5*& 1ɠwˆ  3т*NmۈMa<%B!}+H6ᘸ&o'b5l8Qqq\3:̪yq=B[Wj1,Ch,k-U.MvF{xZVUms_^J?wvٿ;uq㫳jL*8ʼ q) e{)XNnQ0ݑx;Ly}I9I xtLCXۿaXG1m3ڋS6 ]q{tc1#o+i%8E^iI[ I&Lj3qo0t2sL 8^Eʎ9HȱO ⩈j,\>#4[^S,9댮)K51m:j׊ɺ˰&@q!6!t'CgGB%iSy{8YEk(uwW]` %N@Zar;Fk bF/1jNpn/ywD-z.8޿VAIl }ZU#5PI2EFGhse~3W/AXgj9G~gg z,X[ όOs("w#JQ9#X 5Ӿ?@;^ϳ=].H_Xk#wYziʝԞa%}({X;Ϸڲ QG >򚉍^tM9Ap=A+?Ι])ZP-lO ˷l;m8R|}`RڐAmlkxiQa'`Qe/A~ɏӒ , ƌn)Y '3R OlD0Fein]nDŽ@߃w#d&K,ӹ+a_q\ uWmͷ?A@eVer7y\WL t(d]3 Fnx%VP]rtdߟ/r4/bxz5ģA/zY!d λevqLyPxUyt^ /rhA̵\ѧpӆfPt|PʔOoN2&qI#g߃Xcx_ԕ9jIe>`gi,ޣ· (. wkfIvrר[?ez\k0 ^]s$SnD_L㊏8 A Yﺪ$H48u&ݑWWquAu'ՇQhbyVD njmӾqհgIE]ke^ew!bŨ󨭙+LD\X Cрt^(99sKZtLajX!\ LzyNٟ@!^h]ks5u撖5ʐ;c .XIXsCJlOiM?ϤncSE@ڤ\gx7x.y1b:.ќ N8s]_&4Q V*ȹjE Y krj ~A_fP/lZk'?yTkfjr X.h>[@[׆ElߒߕlThQ[)_j4 jb\$ͪL$69q%`88`;Ӌa9M+n-so1@Glv 2ϙo)sr電 ñ1"l\&.ٜap7U+Nm 9% Y_EZ>7 UP avIwG'{4]\STLzfh;<E_Ni .LV a:Vޜ`[y E(;A؟iv*s;*X?z%W!y!_$_u=|O>e~[*g`ӦX .q&oƔsL؟sk5zFIB )PVt&~$_ }%ɋ\OJ֑#{mOel+#wH0{bg?Ҥvx,/xh\@PPNeN{t AʱWA*a=FwnUGyfx)qZfޣמk RCWS\KZBbk.'Bj5KOڇބZ=ONaDCgqwc6sxHaz5[|fE!S) ce1;sY{ƨP.M%Kν%?st"\YT *@#@,~]:(,颠YXxՌZv5p}V'lt#xlk r7f1%)TZx$y@U'Tiݑs,D\ vN4)L1P_έU#gDaV KZvu&`f"]|F C}R _ Qx*㦉FҜ}) Ih)ۆ7ׯDfcigkSYѕl,9#mW&_u @{G2MEM]5RG7"2P}m{6RII_Mw,nMVde6?ܼᓗv0),LEA7AgkCbVVDzyzT!NjO=wxYO&<³Q M ȩeEx0]VlCCp3# 8oH-!laDAUUQYbNX؍{3w}N81 F @w&?[ss c%.ԡDHh]oVwf/ g! ˚"PdYr^Bfl.T}]~5ȖAPTLఄ=)3ڏL,nOX,љj@ TTTwA9@W-GwGA} CJ}0ϑS ǓWI𢝏w+/#$?(9s~|Ϯ R}$Kn1̥AbqJs#R`M2rL%FkYs$m44߃mƵoKDz*{gҦ3S7˥ d?!$Wnvs ~-&Muc d 5.-4tu*Wֹ;]m03LǴAp'08 6Tuσ/縕'kI=PYv lK nr/*~oZ]~Ҏ"JCA˚ޏ3MJw2Spqw,(\CQJ |mXqZp }{ObV63/l׽ Jk- Sod1޻6(q8CX}ݧ4y$W7iYb=Rj,W{AO2"jn" H*Z61ug)z%y|i*,y5M(vQloi۴7Iå|b!t!5U QjtvO7`9G]蹂q!E6Xj8RqEO#E4JRgEDn_dKuOl!N0q:\>Aݚ77e+N?¨? {7 vx5&OKMoҖ0 1/r/>cC)]XHHw>jjWe֊Smyܙ w(3w!bh!0>?؜o Yci>9RjRì3ۜ2Uhd2R4Wb,!U|QxdolBV?Xq2̶6+}, H"%]]@R>7JoȾ ^pRmrew取`f_sQ2B^YH#2a+-OL½IAI^j?/$.MnN}LX%5? ek*g:Wvoc r Z/Sl(Z0~hAd~LŪ}U &mI'Shcg0Y4i:=-Y/AFEQOu\5jvfkuUk݊zf]:yCtttIXX5z x}4.nNɑ;ۑM.s؃ӕ>NLu+u5 %h`bq +i?$#dž/;uVxR:4A:ثet+C_-`ic{D?'kYd^0pxˈ )mqG%ͣN {Wn=7Fa!sOxL҄kt-]XQM| _<_ p;j HL9;bErGV8 =oRT`i,.zdY2٠X{{ 0+O &ΎqXM==8cf9ϟ ˘I%/qsWFaxVBRc?'NZj y96Oex I5`0zF uH bn 7lbn6ӔVosq)5ƾhlrѾ2iLc0=2>ڀh@V~d P(\GN5 nޯ-o`![ޅ!ǁ$Ֆ*8/-w6PVqғ'Y p3I8eطz U't*.TNAO wtD+ny +S(Sk٬ϗh B FE@<;WM;oOrl9(N^@Lf=3]}e! 4Pu\,Y#7>R18Y &1Zi *EO؅fƸ*1p$쨀2WjJ1&w&yGjKӌfR%aNhS6 _*F eֱGEY[egZ%:́Z~t5P(5#FfBuy/,9xsH;}1~\*wx-ǥgof[Vq1w4 A>xkM@oN(f{#͔){˒ `wOH6C! !ےJӫ6%uY'|Y#Ҿ]@zT$8ztC܀cyP? t$/_ L&R1,*2Qbh&}r%KS37h*3kiu$DRY?"Jr43$e-xe7>wUFư.|XD]Ui )NPLKy䋖1p]ՖԕDKi)u 18,PVVE1Ё`X2 %2@x ԷHϭS6k[Ę1s:sK}k66%IMь"3r6h;1EN%ǧ0\t3eeô]:3\]'я781zżUg5ᥐ}ml[d qummu \_[u`pqط]J{X$+o47J`R^ܖ$-S|tgUbmU6N^AT D5o$U*}p%3Pg獐Q}_T `y"$'GyALS+`AQgqI^H>G+kd)8jK-˨>ʦFk>68c׆C>!X,vTGL,)`{[\c`NNgqj_ +b)v+VL`4W[w7ǻx9Rx#n6ؘ __Bc-{j|Nzh_ ehg*ƪ;bb[TpLPdم{  ??+ K^D"^S¸G*B'U#9’g_ڜkɽ񚿧 <"ɞ ,?<|TDHbVUpd 6p0u&>_ӣxl[l( (ğ39@ Ki4>s{KF+WEje=lmq57/`JѦ䛸#kޔnG:GH$DDVֻМ=WsS{u{ǰAYSmh dBPrQ=K7QsCd?98cOCcD'/(R>j Yѵ)(oÝMЄ*01$}!ZƼQ]iX$9v8\9bl6Q(Ji5uO fk6 < MiUǎ -YDu$]VLai?*]+%:䕞'z>[\NjB$o PP?k\X8D8Xf:Cq͊9`CFǁMUqj3 %[SSՖ$O "==jD K C9nX8p_)>S9GWM 2 9ٴɃ0WPb]U{\F -eҤRZ@VYi* qdtӝNx )H6ª  Owz 1NդϿ2~DxJ5 ˂h)k$cNˈJV^f4՜.HCsh0Ў#(#ywVOE%ӝaiB+hg"h/[5XVKHm԰E&Q^nMnxj-ec᪑e%l݆B/8׍S^hI]xA5hE< }8(4gQ`2[Jv/$Q:xP@n8+aD9l7sQҁWj4y! po'$;VqdzTGFher#x Q@t'PlC?ǎ3W.gXJ,-e.sU`)bh`i*<8b~74{2ObH +?w_HJ=k4W̫%1uŠ1CTe3@t{y6aDE7BH1 0?NNzܱ@XYIMyJq!ͳ#,KQ!Po^X6aAa"no38 ;3"3ߖ`JU{9,XUu*m0ok+ guV7Gpea"z90>Y%aiDo'w2t31Hl |&hS~PJvĺJ3WnZ 9zoL(k@q&$J JTI%v:,^H)|eTphsY3 ᭻>R4'ԗF w-s;%j(UOC,7Uh(eׯ b+<#Q~ݱM(B`\$Do6ĺ<3bĘ/Јt +vyPx`P; j2rN,(ߴ}VUn\fo.hc Ce|mC(| vVH&Xld2"e8fhkAgjiBk6zQfU[e=Ep^UUEz>\zuwƴ벷[Bf ^UH&]v$S_7A*9|CAH$i<> ycPQ`JCJZg陋[I-egգ42@_*St쇬O8ƒ ggm>Qϕ#? /H_"5R}K1>`l;tYI5 dt1{-Zy?ٛmp, hչێB|ErWz UZʧR$U3 IQWO]`R5 EjG*W1:M_Td3U!yR7#"',2=;(-^eˏ̭z0x%^l+#gpN^e" NԙYl>erO7_h(Г@Tƿ%]&Qo[n]s4YU$aGt~=1iIF(}RtR ~(=% 1xx'Fg8V )!E"+[5Sت*9vHAl:O[SƕSzyglj+63㲤KI.Dgrd-5HdYYq^R3֚>c}m<g@pu)qI#n02^,Cci DXcy @12uʙ5x uq'd0ٴ̐o8-N sLvxa~yŸ7X֍!$ɋ@Z[C.>0Q'<gcvz'`BSQ@4H@DZ];xυU ;25d֚-ؔ-.=A_B$P]_)[!6ט8(H;Tq9 I!*j#F Sy.Dᩝه=lH'Kƞϋڊ`Jނw /㰂-? _ZT#"7 bmpLOh_s͛ӓ&B~d6+"$c F]mjtVb;o]L fX|ϑ{+ǩO{]bdB^2O9R>'q??lŒ́>|Kn7gsp5jMMD;9Wiag4$cZ]~ hH]j CשPhv :RNUKGmH5tf"q%.V]hߧ mE?D8L([4^=gl=dA|B9tܦvpd>K|oN:B$.l V#ujkaܼP򪯈vѠKJA0A_t{ ,>5ؐϜnw< m V93+jL~.;M"`\2"j8",_Q5TZ.(k1qaVqFܩEg}=A1gMexll1yeJ2EGLu1_۴%J>Lכ/ȉ&)sW<ż*4,d{JU*C?(Bnsn CNnYy-1METy\R sVßK(x!>UW9`*yDhUkHo~dFZK1'rwzv- 963`YZY )+<ǏTAx)± ,n֩H2`3o\tM?@DdM-%]}V6鼫h%kߋv>$t彯a| 2<Q;R21 Sq;{Vc;aq4|[9ݮ#Jr}lݑ-r_ʉ^M ,h`jiE`dz Fn\n(TB8ւov#S_tX¨&E*\4/Mw?l o/gX˻m$4DWnU5wR#h0r}.2 ?݊ VZ{cu c(5O1{dTh0V2Ҕu/hINB`4Сnj-oJs9#KG ƇʂXrhIDj $bQ"ꚚU"=_LuF#Wi]]W%Dڎ9Rb;@E*zZ;Txq;|k(j,*  T´0c0Is {@y\G= (P#9Z[$1?9UfyP UB1L;TInȖb|xZkekbN(1Iuiۇ^j]:,-xM)2p*.,rgh}1 ^2tyVW+-6& =Vd) jн-b8#X3PHڅ*&s@-DZa?_Q\|佬/s0>_T!j/yVV 9=&CKAeLHSvktTtbt]fՄ ?<зnAO;λJQ&fƥzpC ۱4>վ ͘NÖ0SvX!n4Jz 7ѵ⋔ BHb"χt9dG}_!ZTԉ×kÁ>m(Pl,nL_k_[IJ€%bsEl̲p*+U'ٳG4ɦ|SsPzj }K/,S'hC. / F<{ɵVݔBg)P+c>A(R1djCj9cJuLWQ0\,3-!m1|1y[j|xM.)q0JȐt'sfsoJ~[:)a35dJhp`"/^ I CspC'D حЉvg0kX{+&lif"w$ ^)ի}ͨ|%Q}Uk↚>90I}?3b.`8 HYE!ʰ*% >!z6C9̥Kqew;HsBI oM iH=<v)ό>`J!6)Pa`G88oi=3JDw}qE7QIJqD/!*ͻq;b=|6=%ܦUsa6?`'eyR=JIFn;}>]JK%ƘTݷU(jJAA;lTm lNUb[[cD?t>zLj/>Q]cpK+fP\sfw&q+W%rr -jgzRˁC$jPq̷Bn .<ҸïZhPEtXcxx9mB%L16V۬40y˴%q*YglX ׵Rx5lW-ٓQ`~ߎل&.<֝Ul_VتIvP bXJşcЍZLBI7+f >ɨ[kˮqsVEH"v03IBPupzDerԦ8|$ 7_Xlɷ3`ʎ ?lx#U\<$h}(W11va%Њ6RU5Q`zAj=G^dvm|֑o~Ǿ[N)g;_pBg*аxثnf@or$GhGoT 9cJl>9uJ0[VJBzse4_V$ KCA:*W QNnN gdM;J߆ EeXE,dX1LN¦ 9|7vMMRNn4d`*3; sB2=K1- LN6syӮX!) kJU`ApFrE4J#'Y+ߡ"l+/! 1.@ - K+3:2Z(5i$c=So@EөQW<ߨ3L3֠O@2@88wTYPȲ#͢NNpєVx5 ZyT2[MӻYmsB"t6&TwM3{>x~-?nw?KF]e:52+tG BTN W36Eo)Qrst,َNdrqI? ܚJU3K(sF +}Sc{p>SErU4GanA4;0!4(jNy&ʽMQ[E[~.8D牅*ŧ{ʗLs]j7#$G 3IRl^T/NʌI~6fsX/u&d=kN1 ?W(&),Z XIʡNx{VKLTCIf\=eZpu{=Zl;20! 0qѸl6)nNhnmwN~2jo:&DQ=ں2E6#4gorMo}+nSZnVAŝ"ZZ9ë L1RU펬(l#Ƞ^CmV0PG ^Lލm4̤ꕻ^i(=6h ״۴cJK~njqz 9xFpP::Ro_ߟlR8J}TfZU=3"o>/Z93ZՔj/(g9WhŇPw= GVE;aһ[:NTy]dM32ͨj(HԿ : q I8aJiY06SQH1O|y73@xZݡzN} %}AY5SFeTp6,€I#[ 饏z28,1*' sg`_#XdZ\X-=G07'ceD TF3AϞ˓OE cS^ /(o:{I|uILȶ̵yMjAs1~/qqP3_~4)&8c AXZFt_(tBL tSq$&E 4OtoԊP/D>Ei˦2KP,k+G hd>6藞[sˣ 2ֻmn:?8@䯯" 9$E\o*ŖxUfon1XP rد,ޑh=K^W a5yӐ"BF@x/{ }X9=Ӹ͌aA!#@ZA_ְ!݅'yZ'8v6Q//y>=AH &WݍВAf#  LL|a3RUD9$7V|F#5o:{ۘZVT*++RX*c8ND#-3AԎSDZ rZB:0aKqdg4q䈝N&B!t^/IIiG."/""`<ُ;ԮɷqD`qMнw,V>/Fv[Hy lz{pt)8QyS>v|Ԏj~wb >@o:EPN`dD@g8fF:TVz̴s՛\A=φ+ڳؿdU@ +/ntx1ٖUp1ԦD@pi%?3nG H9[a M'0/>Q̼%?W :^j59O؁,(o&DzRdž&9ˈ~%!`cD՘qY[ =wZ )2n.Y&6Q:4uJo3.R<{K2r\s#^O\ Q>;PG; /$Rd?/q)κznKǘω1z+?6JNh輣 G5?nVm}}oɄ9b\ PQe ?.ogAkGnY9B/&WIv䪮b(fy$*>爮AKgK~Jg󓜉0%j;9Xr=xڣi&1Us}~l V9#,Ewҭ(>6c!r{<#2'i-dy5^KP!/C/-RMq5Znʵ#4?1_u(xEX[:_f rrVCM" J|[{-ȷ?sVO Zz@>]N_wt؂'le%|l[M3x,ۛ*H55@fLa? N꿏nZXV)sR%PP~2@8_v纙J8- ͞Af]mqASf+JRYO:0n)4Te -Z${E 46uQ0=F` @܋zσ.yFˇgC}>Eɓ wlKK.Ct/(]tުZۥ#Eqd>֦>d*EѬ/&wԀ$tipF2 'I1tS#g_E.3.0CByKJLLʰoh5 cF#`~NܝILJ"q6=h]sA܉Rzbŭa@Wn6m3ϬWh|&mK Q8-J犳[G -alnj|c G^~[YĴb=^@73V/ba*㎮%0_]}9w^Z[bШv*C`s$|ޙn6cd^“0m>*+Q^r$NbV n j}.գس9I;$NPTݍ]{ GGc{6$n}GFj?{̺^b 6d]E%t٫mQ$=O'GßsZć[Ǒ&jҔÁTcr`l@.#)!jg7M4Gbȟ6YeKV& Rq3nEe%ո!"Μ,ᮊ!m5~ ~صl}$c C-< pb֚ŅrO.|ʭe WV$PLqFƬ-q%0M]I{|t}ɻAw ;x oRtr\p gtCr?ѥc1pyݟ,,:SR UA@?ҩPiMY9@G=#u68%V4\P(uxu,܌N)b+u;8'+L8r劰ВgT8=G]U2S,Y#Ş >CA-OPfnR*%Cn\ݽX,^v,|c>Fmyݻ n˜\@a~&jo dZQ.i0ڙ!ڪ%/jlH*̿@`zБU7ZÔ߻Atj$u:$Oj)3^w z$}(ነ0>9q.塜ßx!o1 ewֽ (kRhDN BHz[oh3}&)$q~yBZlGZ@%FKйR6*wb 734yW4ҾѰ dlj- )s@H3vp\w3oeeUWVXe5v3 Y"8E,r{ I\\y4bhw^cs6R+0jxtri{9 cc<sxVrR%F<I-\ bhtQ}wbRDK,}Q2pxwnmZ}h.LgSھMu}Xb1ĦEݲUc+c>'|22d|<ચEJb3";%IyKvj\A%͖Y~E)uQxAKϱG&ƽb^fgl+̙=us[Mx2q9XD<C l!1sH*DL%( 8ď+w=(LAW,멿2CjD90+`x,}ρz>[1]1;Ո´'܍dTk̂qcW;u:׈/g mDפjᆕcs j "(?^ogf}O/>vve˙nDe(>P1gt7U9`aUnpS+#ȣF\W^p5n|K׹3EA0cMS`6T e 8G [8J[eulә9Ns>(%0%:RRИ:j$`a/& κCSڷKCA c yٜk< 7rtp;.o˭tD|K:iәNp8nTY#E_^N{H[^j!TjYI Ww0B-MHNӷLb(Tdt%Ru _i-ؠ0߉(=% N)lMKS-v%}̗H.E>@5&01أOW/c_znsK\'Kh||ԥ\a58Q-hm9D"?|0b5jK@ǂ^ JR>|sCG>Vx'k%GU8a:NYz^N1FB@4D +6wsˊpH>9^*d!4T"37ujgp-J=OpXn"◰u9SUgzf;[ 5dp%׶TVn >+ڷZmlpvĒxrğ';3ޚDKWrR@t`W(_6Sz5qQaNĘ9luZlւ)1%DO7oU1hS/c)nn`ݻmUt%`H]9" LpGʒ^Hvɐ1+~rxz!:_cޓ27FmEWs3+0F%2"o^G'Ӽm*؍^9x@W0|"/ ThRF .6hj}'@<+*LuBFD6(_NN$-'8a{.7X-ْL ]od68\08R^.iğ[[$f.Mwt&ߋt2NJƤ&}ENͅ)6qKc ]nߗEY4{nb?թ.h7G:!>좤m/o2xV{GG{B>IH[[s9wǗo&N_?ץJ }gsuj65e+Y^MlQ(\̬N|ϯcsɾp{u-_dg9-wߋSk4[ةOj? L">wU3\IYEaw"NҤ5e.]a6oծ*g ¦*KͳU]RkN.oz;k8Π'z Mи `~?)԰w)t~ꕙίy~@oz^>9ȦStrsr}~u{RD{uXi3PHL ӃwkE\ڬtJ(idw?953K}o3&tK&7iz\4ۜhg5m2\yJt4 Ɉ5?vW#,2iʕIQ UnX Up>W:Dγ{ӹf0PvVB^kcns*,b;([ idHJ e&mQxjʘRc=$ HJ1`B'/` S.4 x퓲l@9{R%Ixo埜m]Q5 FśM}y>א+hZ;*f-+;#$܈TW;$ ͽ 0OD׹Y8#кw' af_Hbslc+OMASޜɧS^E'.؂L!gE&.vMwtf::xTizATv`dp@m=2cg$[ =w AfӔIZĎ'5g `P[#Rʫ]|tgtԧ_t1w:O/YQ$VhU DQ`CUЧw9Y#)O3sp)I:>{Cݩ7 @ IaIX#ai3$^a>ĆB-lvw0V ;'pHF%"(%?75S4 X&ɣ|Y*8\56 (ayH $9*|* b-<@|VuXʮO2:?U3yLhfd;s'& k>GC% =Aj|̺ؤġ|i;u,ve ,{JEdFi׎Jۉ%0*6'ؾ^mੈei6)['zXZA^Q!*q̼L<|%g sE`|CMQ̓Px .X2N qμ;['a~-VMuGMaMGN &pSԶ`W dDX,ބí%S(\SE GgFud!z&& Kdݤ BUtig7 p;9Ad?#烂~i!Y+͝81p 94ėQPp]"7ly'_|֐6#IGXw>RlR^^RvL6T|VK͒ӟ|TO198_e4~CЌ_cS!8Svb³ܠT \_DW:U?Ɖ/Tt5UM/KҬTVh)Ѡ:x=E}?V}U4pJ;4Z}7,HM^U,Ϫ8z$"/ŋ7^;;s3ZGh?K΅(6tVg\5K OǥII%58_VIr ֵtK|wm ' %Wdž >I2yE?|) Qo;֣=k6mb 츿T)D]S֗ͺ&;4Vb%99j9@í/aEKշxU 2WE)E伔+X6_lڇxzyda21cRu=xOM;D%yMA~pl/5(gQa5acs{3dž,pbbp?a@od}2a') Aޞixɯ8H jO_V#-zߡm0Q&d)ev``"t!B[i8qʍzz,kzDHP'mEC dwGv"<Qឺ|h'kW(%]_,|\ԊW` ʟ!6_/Q˺B2!,b8 E{1ZKS 3Հb $Y8(W1swMՉVC{7kү 2PĠquN,Dhi?Y'ګVfCfWCgkE6-Pџo _%jQj:dIibL`pOYfV`mˬ@U^W%9ױ pVOp77`vߠX?³9֮jrn$M4-Hōh20!pҨwL.&ߠL" \Y&K0❴g^ Ma!oT ¥}r{ k r؂U^qՒYe汊pYde16@ht$Vs4:Doef7|Zߖ4}wMѾ3v*Ry sgZȘZ2IG  10E'Jjs /BWNNgjOhikw#IE4G3wBߵ%S /xC%xj5!bpoo@太X9p '9/ߝ~E!nּ< 3YLGC\Ffpg+ Ĥ,mM͠ǂ,ꦷ)BΆrd2R04ӃaCIc=k e4^* 0)2h5:N:ҙTaۘmn_B!م@4DNiJ*M7H'tJ/ϡL[3"&nW$C0D؞NiO}3#8R1órzsAhКǿN~wZ3~f ˏdz>]-pdalf< -K iL#M۪mN ";AB蘆Fܮ:Ųիr&5J ᤂC!u֘ jH~oGPج^-[h\/F?g?O'a`|z8>yby9%xoW?\~9a|Q^z C`H z})HR~=u+(m 'y^F ogyD:}y02IuMl:gk5P񋐑1qL,t"4ݡG"7o/|tP/VU e^=ǃ4|Х&T)g~3'Yzo9:!+(*;yճ5ZCwڤj+kᗴWٯC5};gCv޽ SP F+m h-;Dž@^ BP&e#*oޅTUOql=7O;Wp O#x~89''%i|yr~g'GGu61C0Gg^য়O)tjt94ryuq _ ϰ'GpZ#x4>9;<ŏ?yaR# xl]bhw_Hh'Nyq͟j9FSkrbIgg yDE`&@R!n@(c %s'>@ߩ췾 +ַ /ȿ݇ Z}&E'@91PHÛSO;OsD+M*`Fz{ihݥ)10 ^+8dT_g￰ B5]viZ9&c5|.笨|YBvmP5iȪ=9~@sYA }C,i.d7^T'ɤU'9NoAgþ j!ns >;bD֎ua2Jtx5wDYLZRZ Ơo-_#LN 4XCSu[^EVnSKԸY>Hq†Һ u~_N}ڛ$~kĬ6-O &Pȷxٴ2wNZ;CU!JaGt1\RJ0IvsV 9P$exe)iLd4SM[}ɞT8l3@`[9̻; 8v)IX'ʪ2MM*MwNOv+z7'yсڞEi,]q:pȲ,Z.[_Av?.W\`ARhD,$^E 'ARg_ JRl EZC&01v16TG=@AۨP)D3^^"4P1V2Fח!idѹHE}!![$a5bOU&R?SrH1+t>GJpM^`Tu{#[t?q %< & fJB0@ZjH()\ %.x*}@lDngP+>v$RR_KGsٽFl2lmDjf`8hn rsa ެOTy noCN08yb4)IPUę 'r[M[qѽ0L;U}K}ӟŋe+kHVFJ'闹PEԖ8['XusPv0h zaoa:Ilg7l~cԪ͜M.`kk(]`4ۺ|o,Ն^(Exh{D< sݞ5"N1Dj,]K~E=LY BxI򞁇1܊[I oeFl;7G |y):%e&jY%ۋHm5 ʜbFFk^ /E\ԺڦY855DJOpsk1 Gv}2;_K m=by7d:/KGJ8/a$@Rd~ )JI/'6tr|u]|>GRGafݱ?b<›_CzfC󟆍KC-x﹖mz؉[DSRe|~359,XgY|}pV<۸߳Wk|RnI(Fw4@h¹+ [uJA =q$(Kw=2܆wuK44Kwoۛ%_o%] ~m#y/xjZ/ 86e s%NaRRN(H l9'T#mվ3/K@xOb"`N W<Ū\K覘=m?CÉav%J o-ȗUJ#`Bi^ā[E?h V c&+d$l= a1-ҀL"|0ۡM2z~G2V)Ӂb @1oJBDGLQ3%GM9Wȁ,IV]@$M"A}%r`4I^n$Ni>6sZ%VZr,I$ʸ~Asa]NqwVSJaG-V"7WvtzP'ۑYKARܲx̉CHȮM>g/xYI}NK|yM#5u 9r*} >ir AcX<&>:r-zc07HV"f/;/8ۑX hMl @}ˠ?q`}VPP`m/ιP=z϶4Onf+m)) ZQj9rNUcT#d&Ww q1Ϊ#$Udi! Ȗdd;fZP/4s ,y.4ɀy00)\81%J32ql+20c>Y,(QK2Sgˈ S9:ּ%QfP~1/)pT(Kvp%1UӖl,!3_i@泊 i]اIz;3ܩEV2D8Y ]4E=}P?j&fCHeۊM^+90Ę93&I8!PJBIiMR2deMK(}.}); $c^@[¨,@Ho3=hf k. Њ,.svl?;:V daH+G>} XeHCs~MmVl`l-J 4l$+5={tl^'M" 2vaouZi/mz~nW5- KCᡏ9P8j激9Moq@SXd K~ !c j5O\|!Xu~=;ĉ0us*DYY^DxqʱS|,یrQLOGnss|#ZؕH3lnt046-CcJ`Ͷםͼ"\qsMކ]4 2bϳ'χ-j=yiv0-͢Q q$ME CD#aA3, >,@Ѫ4V2)SRC̽7?L]\;{pi =+ԃ4aŕlFa"b giyIn[~/,'ɨdC{hG$ufXG܊JZ}T8-\EDar MJ]hM-p#?+G&+6Rf\^# Ǻ)_<(m`9&;[F:H/c1.VB"Pd,(cıg.m>` >Ao{FZUPҺE  lz$蹢 s I#l'Qm V iē Y*/e >6>NKO-&FHSrYJ\8U釗#(q`~K+uωt5b10:-Aٓ, tiʸ$N #i\aǸyM>1Uj,N ٬yg}ϓgfĻ63p|YKd.d5G[Vlg~|ׅڌbȺiղ9-s['I-`ѐ3Z h7!";*.K݈Rci^__ZLtiiрTԔzw*\)lgSTse +~3>g2,.쯻j۽M#TXd|){7T_"etpzq8HWvfp"8WQ\wεtJ \BI)zCQpJnW*9PK~=A S.ȧ ϞY"!R.s(=(GjGOݭA kQgIٔ2v-A4hcl,r#i )-<3_^Y'-V8k.eGz}MwIGUd๷/;皨 $aT3XЧyuֳ郵 sm,E:^$Y21Pxm~ AhJ[AO?&G{F:Y g3fb$FOiIv6exoKv{ oeQŤEv2uW~iEAZ~˰pg9j cG=a7zelЄ_i݇ؑ@˯E a5 t?>6\="~:[`gj|xxzz!"oKLFI 7e7m8  8/׬Йp%/Q}V^Zh$0f5ᆠJEmոn*t;x靺٪_Ɛ:U;dki6B{ lc FI3t^8n##ԙ.NLj]?8 OKOtpZ)[T4u@!Rζn9݋ ^@Q>=`N&#O ,a,/oo>G'R/ORW Mw17F7A-hʖ s +&匕e41Q5`qJ%cNoՂl,/a]i\[%z'pS#$]^O>sYSUDIq*/I6˪,mTK)[U?g L:ކ^⾝|[QpʪCm\,tA47 (@{,AYJVtN\@en(6TEBױ)^;9 %ʆ;/|~WXY"vaY4r?#b(۴qS.5D!ΛcQUd [IASjc5ЂU6B/Arcvzw/k2X9}i4ɋ{~O {^bbȒc̤Pk]ӆ6 )8(b`!#wX3@(E@YC>h=*ɹ&J( />*&#n;ɢa *Ew 7XO0I@ )9q9N'Y8&E4S- UQsUau}l!?oKb=Eni-a;3*gk)(* w.*-c\B IN 5m,cC|֐I*Aġ\?FM1B^cS}P^"ǐ9O6&M)q9[aQo]Eھ{'4.%WƄ!hBۋXkoNYk |`l] A|Fχgb6m6姵jS(|2R;, уFQ ~ܼ ~=g8#˝3,ˑIEgῨ GIK _Zd8QZ8_rBޙW- +|$At.YգĤDBy-tJ9?]t`SK9TcJfJ.淳,O''WSx7q QFD98}>\~hpCQ>c_}!?rv}A#5v`E Bޥg U%XR9[>fCB/vSb-$A'19@b:Q-) xH-b9_)TZx̍tKуW ki]INnՙ'YHK'{Krvre#Ö1tL gmK-pQ j%Smo%C;]LbDY,M[Ot-Ϣ=ܟqNÙ & @6*9r`Qҏ v}+_tb3 H76K%3TJ3Sa|0V勚%_'-+ g0ni e}5Om>R_xyafؕүزDߕu<13oo8&د +oR=c95= Zҩd)|Xl 44Z&D'Z6$I0<_\e;b%t]$WG?Eg=i@ΓVIz}??;G07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!ty5D7FINyoecgF閶 YZ